Meis

Overview
NameMeis
Smed IDSMED30011784
Length (bp)808
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011784

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30011784h1SMcG0014159 Contig38194newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011784h1SMcG0014159 Contig38194uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011784h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011784h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011784h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011784h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30011784h1SMcG0014159 Smed-meissmed_ncbi_20240424PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011784h1SMcG0014159 meissmed_ncbi_20240424PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30011784h1SMcG0014159 meissmed_ncbi_20240424PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30011784h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Meis vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 94.3597 bits (233), Expect = 5.200e-24
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:    1 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 47          
BLAST of Meis vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 93.2041 bits (230), Expect = 1.057e-23
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:    1 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 47          
BLAST of Meis vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 93.2041 bits (230), Expect = 6.301e-23
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:   59 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 105          
BLAST of Meis vs. Ensembl Human
Match: MEIS1 (Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000])

HSP 1 Score: 91.6633 bits (226), Expect = 9.315e-23
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI+DR+
Sbjct:   19 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRE 65          
BLAST of Meis vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 94.7449 bits (234), Expect = 1.139e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:    6 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 52          
BLAST of Meis vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.657e-18
Identity = 32/46 (69.57%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDR 141
            ++Q++Q+LRFHLLE+EKVHELCDNFC RY+ CLKGKMP+D+V ++R
Sbjct:  135 MLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDER 180          
BLAST of Meis vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.660e-18
Identity = 32/46 (69.57%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDR 141
            ++Q++Q+LRFHLLE+EKVHELCDNFC RY+ CLKGKMP+D+V ++R
Sbjct:  172 MLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDER 217          
BLAST of Meis vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.814e-18
Identity = 32/46 (69.57%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDR 141
            ++Q++Q+LRFHLLE+EKVHELCDNFC RY+ CLKGKMP+D+V ++R
Sbjct:  172 MLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDER 217          
BLAST of Meis vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.814e-18
Identity = 32/46 (69.57%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDR 141
            ++Q++Q+LRFHLLE+EKVHELCDNFC RY+ CLKGKMP+D+V ++R
Sbjct:  172 MLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDER 217          
BLAST of Meis vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 84.7297 bits (208), Expect = 1.849e-18
Identity = 32/46 (69.57%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDR 141
            ++Q++Q+LRFHLLE+EKVHELCDNFC RY+ CLKGKMP+D+V ++R
Sbjct:   98 MLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDER 143          
BLAST of Meis vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0344145)

HSP 1 Score: 93.2041 bits (230), Expect = 3.224e-22
Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  164 MVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 210          
BLAST of Meis vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100455)

HSP 1 Score: 93.2041 bits (230), Expect = 3.224e-22
Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  164 MVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 210          
BLAST of Meis vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100454)

HSP 1 Score: 93.2041 bits (230), Expect = 3.536e-22
Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  164 MVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 210          
BLAST of Meis vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 94.3597 bits (233), Expect = 1.022e-21
Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  164 MVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 210          
BLAST of Meis vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 94.3597 bits (233), Expect = 1.086e-21
Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  164 MVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 210          
BLAST of Meis vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 93.5893 bits (231), Expect = 2.294e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  143 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 189          
BLAST of Meis vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.131e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  143 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 189          
BLAST of Meis vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 94.3597 bits (233), Expect = 1.229e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI+DR+
Sbjct:  143 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRE 189          
BLAST of Meis vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.338e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  143 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 189          
BLAST of Meis vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.394e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  142 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 188          
BLAST of Meis vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 95.9005 bits (237), Expect = 4.792e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVI+DRD
Sbjct:  139 MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRD 185          
BLAST of Meis vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 95.1301 bits (235), Expect = 4.832e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIEDR+
Sbjct:  145 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDRE 191          
BLAST of Meis vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 95.1301 bits (235), Expect = 5.029e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIEDR+
Sbjct:  145 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDRE 191          
BLAST of Meis vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 95.9005 bits (237), Expect = 5.156e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIEDR+
Sbjct:  145 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDRE 191          
BLAST of Meis vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 94.3597 bits (233), Expect = 6.231e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIEDR+
Sbjct:   92 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDRE 138          
BLAST of Meis vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 95.5153 bits (236), Expect = 1.304e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVIEDRD
Sbjct:  136 MVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRD 182          
BLAST of Meis vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 95.9005 bits (237), Expect = 2.204e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVIEDRD
Sbjct:  136 MVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRD 182          
BLAST of Meis vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 93.2041 bits (230), Expect = 2.451e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI+DR+
Sbjct:  118 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRE 164          
BLAST of Meis vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 95.1301 bits (235), Expect = 8.121e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  147 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 193          
BLAST of Meis vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 95.1301 bits (235), Expect = 9.408e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  147 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 193          
BLAST of Meis vs. UniProt/SwissProt
Match: sp|Q99687|MEIS3_HUMAN (Homeobox protein Meis3 OS=Homo sapiens OX=9606 GN=MEIS3 PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 1.301e-21
Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVIEDRD
Sbjct:  133 MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRD 179          
BLAST of Meis vs. UniProt/SwissProt
Match: sp|P97368|MEIS3_MOUSE (Homeobox protein Meis3 OS=Mus musculus OX=10090 GN=Meis3 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.542e-21
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            ++QA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVIEDRD
Sbjct:  136 MVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRD 182          
BLAST of Meis vs. UniProt/SwissProt
Match: sp|Q6DIF3|MEIS3_XENTR (Homeobox protein meis3 OS=Xenopus tropicalis OX=8364 GN=meis3 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.538e-21
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVI+DRD
Sbjct:  139 MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRD 185          
BLAST of Meis vs. UniProt/SwissProt
Match: sp|Q5U4X3|MEI3A_XENLA (Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.563e-21
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVI+DRD
Sbjct:  139 MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRD 185          
BLAST of Meis vs. UniProt/SwissProt
Match: sp|Q7ZY13|MEI3B_XENLA (Homeobox protein meis3-B OS=Xenopus laevis OX=8355 GN=meis3-b PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.661e-21
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVH+LCDNFC RYITCLKGKMPIDLVI+DRD
Sbjct:  139 MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRD 185          
BLAST of Meis vs. TrEMBL
Match: J7FUV3 (Meis OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 5.959e-56
Identity = 126/139 (90.65%), Postives = 128/139 (92.09%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLNFGQSSAIPANQTGXXXXXXXXXXXXXXPQICSDHVSTPLSYYNTLSLNNSALAPNETNQV*EIFP---KYQKIILES 411
            IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQ    FP    Y +I + S
Sbjct:  376 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQYRRSFPNIKNYSRIDVNS 514          

HSP 2 Score: 68.1662 bits (165), Expect = 3.300e-9
Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 3
Query:  393 KNYSRIDVNSKIPNEYADCSVFLXXXXXXXXXXXXXXXXXXXCTTDDNLSTIH 551
            KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIH
Sbjct:  505 KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIH 557          
BLAST of Meis vs. TrEMBL
Match: A0A504YY93 (Homeobox protein Meis2 OS=Fasciola gigantica OX=46835 GN=FGIG_01411 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.355e-22
Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLNFGQSSAIPANQT 225
            IIQA+QVLRFHLLEIEKVHELCDNFC+RYITCL+GKMPIDLVIEDRDS GSTGS +SP  ++    S I +N T
Sbjct:  387 IIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVSGTLPSNISSNNT 460          
BLAST of Meis vs. TrEMBL
Match: A0A4Z2D6H1 (Homeobox protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004090 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 7.606e-22
Identity = 53/62 (85.48%), Postives = 58/62 (93.55%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLN 189
            IIQA+QVLRFHLLEIEKVHELCDNFC+RYITCL+GKMPIDLVIEDRDS GSTGS +SP  +N
Sbjct:  266 IIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVN 327          
BLAST of Meis vs. TrEMBL
Match: A0A094ZWT4 (Homeobox protein homothorax OS=Schistosoma haematobium OX=6185 GN=MS3_05978 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.903e-21
Identity = 53/62 (85.48%), Postives = 58/62 (93.55%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLN 189
            IIQA+QVLRFHLLEIEKVHELCDNFC+RYITCL+GKMPIDLVIEDRDS GSTGS +SP  +N
Sbjct:   56 IIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVN 117          
BLAST of Meis vs. TrEMBL
Match: A0A430Q7N1 (Meis_PKNOX_N domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0003541 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.939e-21
Identity = 53/62 (85.48%), Postives = 58/62 (93.55%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLN 189
            IIQA+QVLRFHLLEIEKVHELCDNFC+RYITCL+GKMPIDLVIEDRDS GSTGS +SP  +N
Sbjct:  446 IIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVN 507          
BLAST of Meis vs. Ensembl Cavefish
Match: meis2a (homeobox protein Meis1-like [Source:NCBI gene;Acc:103032373])

HSP 1 Score: 95.1301 bits (235), Expect = 3.761e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI+DRD
Sbjct:  139 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRD 185          
BLAST of Meis vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 94.7449 bits (234), Expect = 8.545e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  147 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 193          
BLAST of Meis vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 93.9745 bits (232), Expect = 1.012e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  147 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 193          
BLAST of Meis vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 94.7449 bits (234), Expect = 1.049e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  146 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 192          
BLAST of Meis vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 93.9745 bits (232), Expect = 1.179e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  147 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 193          
BLAST of Meis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001860.1 (pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 gene:ENSPMAG00000001690.1 transcript:ENSPMAT00000001860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 4.423e-24
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI+DRD
Sbjct:   65 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRD 111          
BLAST of Meis vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 63.5438 bits (153), Expect = 4.237e-12
Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPID 123
            +++AVQVLR HLLE+EKV ELC +FC RYI CL+GK+  D
Sbjct:  101 MLKAVQVLRIHLLELEKVRELCQDFCERYIACLRGKLSSD 140          
BLAST of Meis vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 63.5438 bits (153), Expect = 7.056e-12
Identity = 26/40 (65.00%), Postives = 34/40 (85.00%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPID 123
            +++A+QVLR HLLE+EKV +LC +FC+RYITCLK KM  D
Sbjct:  105 MVKAIQVLRIHLLELEKVSDLCKDFCSRYITCLKSKMHSD 144          
BLAST of Meis vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 92.0485 bits (227), Expect = 8.232e-22
Identity = 38/47 (80.85%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYITCLKGKMPIDLV+++++
Sbjct:  104 MIQAIQVLRFHLLELEKVHELCDNFCKRYITCLKGKMPIDLVMDEKE 150          
BLAST of Meis vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 64.6994 bits (156), Expect = 3.104e-12
Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKM 114
            II+A+QV R HLLE+EKV+ELC +FC RYI CLKGKM
Sbjct:   68 IIKAIQVFRIHLLELEKVNELCKDFCQRYIACLKGKM 104          
BLAST of Meis vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 94.3597 bits (233), Expect = 6.388e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIE+RD
Sbjct:  120 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEERD 166          
BLAST of Meis vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 94.3597 bits (233), Expect = 6.464e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVIE+RD
Sbjct:  135 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEERD 181          
BLAST of Meis vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 94.3597 bits (233), Expect = 7.355e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  131 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 177          
BLAST of Meis vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 94.7449 bits (234), Expect = 8.201e-22
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  145 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 191          
BLAST of Meis vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 93.9745 bits (232), Expect = 1.028e-21
Identity = 40/47 (85.11%), Postives = 46/47 (97.87%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +IQA+QVLRFHLLE+EKVHELCDNFC RYI+CLKGKMPIDLVI++RD
Sbjct:  145 MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD 191          
BLAST of Meis vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 199.134 bits (505), Expect = 9.792e-59
Identity = 126/139 (90.65%), Postives = 128/139 (92.09%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLNFGQSSAIPANQTGXXXXXXXXXXXXXXPQICSDHVSTPLSYYNTLSLNNSALAPNETNQV*EIFP---KYQKIILES 411
            IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQ    FP    Y +I + S
Sbjct:  198 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQYRRSFPNIKNYSRIDVNS 336          

HSP 2 Score: 177.178 bits (448), Expect = 1.108e-50
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 3
Query:  393 KNYSRIDVNSKIPNEYADCSVFLXXXXXXXXXXXXXXXXXXXCTTDDNLSTIHXXXXXXXXXXXXXXXXXXXKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE 788
            KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIHNSCNLTTLSNNNNNNNLSSKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE
Sbjct:  327 KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIHNSCNLTTLSNNNNNNNLSSKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE 458          
BLAST of Meis vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 199.134 bits (505), Expect = 9.921e-59
Identity = 126/139 (90.65%), Postives = 128/139 (92.09%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXPNNLNFGQSSAIPANQTGXXXXXXXXXXXXXXPQICSDHVSTPLSYYNTLSLNNSALAPNETNQV*EIFP---KYQKIILES 411
            IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQ    FP    Y +I + S
Sbjct:  198 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSPNNLNFGQSSAIPANQTGLLSNNLNISNSNLLPQICSDHVSTPLSYYNTLSLNNSALAPNETNQYRRSFPNIKNYSRIDVNS 336          

HSP 2 Score: 176.792 bits (447), Expect = 1.244e-50
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 3
Query:  393 KNYSRIDVNSKIPNEYADCSVFLXXXXXXXXXXXXXXXXXXXCTTDDNLSTIHXXXXXXXXXXXXXXXXXXXKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE 788
            KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIHNSCNLTTLSNNNNNNNLSSKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE
Sbjct:  327 KNYSRIDVNSKIPNEYADCSVFLNANSESMNSNSNLSINMRSCTTDDNLSTIHNSCNLTTLSNNNNNNNLSSKRFINSEDYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQNIDE 458          
BLAST of Meis vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.623e-23
Identity = 51/58 (87.93%), Postives = 55/58 (94.83%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDXXXXXXXXXXP 177
            +IQA+QVLRFHLLEIEKVHELCDNFC+RYITCLK KMPIDLVIEDRDS GSTGS +SP
Sbjct:  167 MIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASP 224          
BLAST of Meis vs. Planmine SMEST
Match: SMESG000013307.1 (SMESG000013307.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.155e-10
Identity = 24/47 (51.06%), Postives = 37/47 (78.72%), Query Frame = 1
Query:    4 IIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRD 144
            +++A+QVLR HL+E+ KV+ELC +FC+RYI CLK K+  D + +D +
Sbjct:   89 MVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSE 135          
The following BLAST results are available for this feature:
BLAST of Meis vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS25.200e-2485.11Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS21.057e-2385.11Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS26.301e-2385.11Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS19.315e-2385.11Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000][more]
MEIS21.139e-2285.11Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
back to top
BLAST of Meis vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-621.657e-1869.57Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.660e-1869.57Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.814e-1869.57Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.814e-1869.57Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.849e-1869.57Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Meis vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth3.224e-2282.98gene:FBgn0001235 transcript:FBtr0344145[more]
hth3.224e-2282.98gene:FBgn0001235 transcript:FBtr0100455[more]
hth3.536e-2282.98gene:FBgn0001235 transcript:FBtr0100454[more]
hth1.022e-2182.98gene:FBgn0001235 transcript:FBtr0082256[more]
hth1.086e-2182.98gene:FBgn0001235 transcript:FBtr0082255[more]
back to top
BLAST of Meis vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a2.294e-2285.11Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.131e-2185.11Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis1b1.229e-2185.11Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis2a1.338e-2185.11Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.394e-2185.11Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of Meis vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis34.792e-2287.23Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
MEIS14.832e-2287.23Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS15.029e-2287.23Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS15.156e-2287.23Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS16.231e-2287.23Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
back to top
BLAST of Meis vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis31.304e-2287.23Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis32.204e-2287.23Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis12.451e-2285.11Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis28.121e-2285.11Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis29.408e-2285.11Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
back to top
BLAST of Meis vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99687|MEIS3_HUMAN1.301e-2189.36Homeobox protein Meis3 OS=Homo sapiens OX=9606 GN=... [more]
sp|P97368|MEIS3_MOUSE1.542e-2187.23Homeobox protein Meis3 OS=Mus musculus OX=10090 GN... [more]
sp|Q6DIF3|MEIS3_XENTR2.538e-2187.23Homeobox protein meis3 OS=Xenopus tropicalis OX=83... [more]
sp|Q5U4X3|MEI3A_XENLA2.563e-2187.23Homeobox protein meis3-A OS=Xenopus laevis OX=8355... [more]
sp|Q7ZY13|MEI3B_XENLA2.661e-2187.23Homeobox protein meis3-B OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of Meis vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J7FUV35.959e-5690.65Meis OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A504YY936.355e-2275.68Homeobox protein Meis2 OS=Fasciola gigantica OX=46... [more]
A0A4Z2D6H17.606e-2285.48Homeobox protein OS=Schistosoma japonicum OX=6182 ... [more]
A0A094ZWT41.903e-2185.48Homeobox protein homothorax OS=Schistosoma haemato... [more]
A0A430Q7N12.939e-2185.48Meis_PKNOX_N domain-containing protein OS=Schistos... [more]
back to top
BLAST of Meis vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a3.761e-2287.23homeobox protein Meis1-like [Source:NCBI gene;Acc:... [more]
meis2a8.545e-2285.11Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a1.012e-2185.11Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a1.049e-2185.11Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a1.179e-2185.11Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
back to top
BLAST of Meis vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001860.14.423e-2487.23pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 g... [more]
pknox24.237e-1265.00pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pknox27.056e-1265.00pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Meis vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meis vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO364398.232e-2280.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393753.104e-1272.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Meis vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a6.388e-2287.23homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis2a6.464e-2287.23homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis2a7.355e-2285.11Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a8.201e-2285.11Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a1.028e-2185.11Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of Meis vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000006530.19.792e-5990.65SMESG000006530.1[more]
SMESG000006530.19.921e-5990.65SMESG000006530.1[more]
SMESG000078684.11.623e-2387.93SMESG000078684.1[more]
SMESG000013307.11.155e-1051.06SMESG000013307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011784 ID=SMED30011784|Name=Meis|organism=Schmidtea mediterranea sexual|type=transcript|length=808bp
TAGATTATCCAAGCTGTTCAAGTTTTAAGATTCCATTTGTTAGAAATTGA
AAAGGTGCATGAGTTGTGCGACAATTTCTGCACTCGGTATATCACGTGTT
TAAAGGGGAAAATGCCGATAGATTTGGTGATTGAAGATAGAGATTCTACC
GGGTCTACTGGGTCTACCTCGAGTCCGAATAATTTAAATTTCGGTCAGAG
CAGTGCAATTCCAGCTAACCAAACCGGCTTGTTGTCAAACAATCTTAATA
TTTCCAATTCAAATCTCCTTCCGCAAATTTGTTCCGATCACGTTTCAACC
CCATTATCTTACTATAACACTCTTTCATTAAACAATTCAGCTTTGGCTCC
CAATGAAACCAATCAGGTATAGGAGATCTTTCCCAAATATCAAAAAATTA
TTCTCGAATCGACGTCAACTCTAAAATCCCTAATGAATATGCAGATTGTT
CGGTCTTTTTAAATGCGAATTCCGAATCCATGAACAGTAATAGCAACCTT
TCAATTAACATGAGATCTTGTACAACTGACGATAACTTGTCAACTATTCA
CAATTCCTGCAATTTAACCACTTTGTCAAATAATAATAATAATAATAATT
TGAGTTCAAAAAGATTTATTAATTCCGAAGATTATAATAGCAGTCACAAT
AAGAGCGAATTGATAACCCTTGAAAGCGTTGACCACCAGAATGTTGCTGA
CGATTCAAACGAAAAACCTTCAATGATGTCACAGCCGTCAAGATTATTAA
ACATTCATAAAAATTCCAACAGACAAAATATTGACGAAAGTAATTTATCA
TCATTTTT
back to top

protein sequence of SMED30011784-orf-1

>SMED30011784-orf-1 ID=SMED30011784-orf-1|Name=SMED30011784-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MNSNSNLSINMRSCTTDDNLSTIHNSCNLTTLSNNNNNNNLSSKRFINSE
DYNSSHNKSELITLESVDHQNVADDSNEKPSMMSQPSRLLNIHKNSNRQN
IDESNLSSF
back to top
Aliases
The feature 'Meis' has the following synonyms
Synonym
meis
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000103central nervous system
Vocabulary: INTERPRO
TermDefinition
IPR032453PKNOX/Meis_N
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27