Si:ch73-222h13.1

Overview
NameSi:ch73-222h13.1
Smed IDSMED30011780
Length (bp)2139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch73-222h13.1 (SMED30011780) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch73-222h13.1 (SMED30011780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch73-222h13.1 (SMED30011780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch73-222h13.1 (SMED30011780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011780h1SMcG0010979 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011780h1SMcG0010979 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0010979 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0010979 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011780h1SMcG0010979 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011780h1SMcG0010979 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30011780h1SMcG0010980 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011780h1SMcG0010980 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0010980 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0010980 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011780h1SMcG0010980 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011780h1SMcG0010980 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30011780h1SMcG0021887 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011780h1SMcG0021887 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0021887 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30011780h1SMcG0021887 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011780h1SMcG0021887 Contig3433newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011780h1SMcG0021887 Contig3433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30011780h1SMcG0021887 SmedASXL_009932SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30011780h1SMcG0021887 Contig11358uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011780h1SMcG0021887 Contig11358newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011780h1SMcG0021887 dd_Smed_v4_12752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011780h1SMcG0021889 Contig11358uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011780h1SMcG0021889 Contig11358newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30011780h1SMcG0021887 dd_Smed_v6_12752_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011780h1SMcG0021887 dd_Smed_v4_12752_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 154.451 bits (389), Expect = 1.222e-41
Identity = 72/224 (32.14%), Postives = 128/224 (57.14%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPER-MVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGL 776
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P  I      +G   T  + L     V+F + I +I+ H + +I+  +G+IP  G   V + F P  Y T +  + +++SQ+N +P  C   G   P +
Sbjct:   39 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFPSFINLSNVLLGESKTYVIPLQCSCPVDFEFYITLIQSHQAFAIEPTSGIIPANGKMTVTIKFTPFQYGTAQIKMQLWISQFNSQPYECVFTGTCYPNM 261          
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 158.303 bits (399), Expect = 1.298e-39
Identity = 73/228 (32.02%), Postives = 129/228 (56.58%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPER-MVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKL 788
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P  I      +G   T  + L     V+F + I +I+ H + +I+  +G+IP  G   V + F P  Y T +  + +++SQ+N +P  C   G   P +   L
Sbjct:   39 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFPSFINLSNVLLGESKTYVIPLQCSCPVDFEFYITLIQSHQAFAIEPTSGIIPANGKMTVTIKFTPFQYGTAQIKMQLWISQFNSQPYECVFTGTCYPNMALPL 265          
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 113.62 bits (283), Expect = 1.689e-28
Identity = 52/145 (35.86%), Postives = 89/145 (61.38%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLT 539
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P  I      +G    KHLT
Sbjct:   29 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFPSFINLSNVLLGERIRKHLT 172          
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 107.842 bits (268), Expect = 1.971e-26
Identity = 48/137 (35.04%), Postives = 85/137 (62.04%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIG 515
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P  I      +G
Sbjct:   39 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFPSFINLSNVLLG 174          
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 107.842 bits (268), Expect = 2.857e-26
Identity = 46/126 (36.51%), Postives = 82/126 (65.08%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIP 482
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P
Sbjct:   39 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFP 163          
BLAST of Si:ch73-222h13.1 vs. Ensembl Zebrafish
Match: si:ch73-222h13.1 (si:ch73-222h13.1 [Source:ZFIN;Acc:ZDB-GENE-090313-144])

HSP 1 Score: 189.889 bits (481), Expect = 2.207e-50
Identity = 96/273 (35.16%), Postives = 160/273 (58.61%), Query Frame = 3
Query:   72 MTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIENSDLISLSKLELKRKSIKSNALL 890
            + D  TI T   +PNHL +T +F    SN++++ EP E+HF+G+++ +   + LK  N+S ++   HI+PP +K FQ+KYTK  R+VPG      + F PD+ R ++D I+IH K  E N++VP++AYP I  L IP +I+ P  P+G   T  + L     V+F +++  ++ H + ++  L+G+IP  G T + ++F P  Y T + T+ + +SQ+N KP+  T+ G+S P     LL+++PD +  E  D     K   K  ++ S+  L
Sbjct:   27 LEDTRTIAT---VPNHLLETKVFTTLKSNSVVQAEPSELHFSGFEVGKDYKKILKLVNVSSDVLSVHILPPQTKEFQIKYTKKCRLVPGLAYTVTVFFRPDEWRYFSDNIRIHGK-GEENLLVPVHAYPVINDLHIPSHISLPPVPLGQSTTHVIPLSCSCPVDFEFQVHCLQPHKAFTVRPLSGIIPANGKTVLKVTFTPLRYGTADITLQLIISQFNSKPVIWTVTGSSTP----YLLLSKPDGNGDEEEDFADEQKTYGKYPTLTSHPKL 291          
BLAST of Si:ch73-222h13.1 vs. Ensembl Xenopus
Match: ENSXETT00000018114.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:100493735])

HSP 1 Score: 108.997 bits (271), Expect = 8.417e-27
Identity = 46/136 (33.82%), Postives = 81/136 (59.56%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIG 515
            +PNHL ++ I+ +   N+ +E +P  +HF GY++ + + Q LK  N+S ++   HIIPP +K+F + Y+K +R+VPG  +   + F PD+ R Y D I++H +  E  ++VP++ YP +  +  P  I      +G
Sbjct:   38 VPNHLLESKIYSKLHKNSAVEAKPGILHFGGYEIGKCHQQSLKLINVSADVMNIHIIPPQTKHFSISYSKAQRLVPGLAITVTVRFNPDEWRYYYDCIRLHCQGGE-TLLVPVHGYPVMNRVDFPSRINLSDVALG 172          
BLAST of Si:ch73-222h13.1 vs. Ensembl Mouse
Match: Cfap221 (cilia and flagella associated protein 221 [Source:MGI Symbol;Acc:MGI:2684947])

HSP 1 Score: 175.252 bits (443), Expect = 2.503e-45
Identity = 119/443 (26.86%), Postives = 206/443 (46.50%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGL-----ERKLLITQPDKSHI--ENSDLISLSKLELKRKSIK---------------SNALLDSEIKNAQPXXXX--------------XXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFR-FDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRL 1322
            +PNHL ++ ++ +  +N +I+  P  VHF GY++  K+ Q L   NISDE +  HI+PP +KYFQ+ + K E R++PG  +   I F+PD+ R Y D I+IH K  ++ ++VPI+AYP +  L  P  I      +G   +  + L     V+F + I +++ H + +I+  +G+IP  G   V + F P  Y   +  I +++SQ+N +P  C   G   P +     E K L T+  K ++  E +  +       K K  K               SN    + + N +P  +                  ++  +  FE +VR+++  E +N ++WQ   G +  + +   ++ ++ +    +Y  N     E  E  R  T  +   +R  R      +E+    D    V   W+ R  A  RF+ AA K+++  RL
Sbjct:   39 VPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQINFEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCK-GDDTLLVPIHAYPVLNNLDFPTFINLSDVFLGESKSYVIPLQCSCPVDFEFHITLLRSHQAFTIEPKSGIIPANGKAKVTVKFTPIQYGMAQIKIQLWISQFNSQPYECVFTGTCYPNMALPLEEFKRLNTRSKKVNVPLEKTTYVQFYPAPAKAKPQKLKEIDYQDLRFPADLSNPFAVATVLNQEPGKLKIKELKQVLDQGDEISKTRQMKEAIFEQKVRQDILTEIENHLKWQVHLGKEHTTYRFKRELTEEWKKARAKYKQNRGDPVEGEELQRLQT--EQSQKRIVRDLKGKRQEFHPNFDP--LVNNVWLTRHRAQRRFQQAARKIMLERRL 476          
BLAST of Si:ch73-222h13.1 vs. Ensembl Mouse
Match: Cfap221 (cilia and flagella associated protein 221 [Source:MGI Symbol;Acc:MGI:2684947])

HSP 1 Score: 175.252 bits (443), Expect = 2.503e-45
Identity = 119/443 (26.86%), Postives = 206/443 (46.50%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGL-----ERKLLITQPDKSHI--ENSDLISLSKLELKRKSIK---------------SNALLDSEIKNAQPXXXX--------------XXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFR-FDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRL 1322
            +PNHL ++ ++ +  +N +I+  P  VHF GY++  K+ Q L   NISDE +  HI+PP +KYFQ+ + K E R++PG  +   I F+PD+ R Y D I+IH K  ++ ++VPI+AYP +  L  P  I      +G   +  + L     V+F + I +++ H + +I+  +G+IP  G   V + F P  Y   +  I +++SQ+N +P  C   G   P +     E K L T+  K ++  E +  +       K K  K               SN    + + N +P  +                  ++  +  FE +VR+++  E +N ++WQ   G +  + +   ++ ++ +    +Y  N     E  E  R  T  +   +R  R      +E+    D    V   W+ R  A  RF+ AA K+++  RL
Sbjct:   39 VPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQINFEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCK-GDDTLLVPIHAYPVLNNLDFPTFINLSDVFLGESKSYVIPLQCSCPVDFEFHITLLRSHQAFTIEPKSGIIPANGKAKVTVKFTPIQYGMAQIKIQLWISQFNSQPYECVFTGTCYPNMALPLEEFKRLNTRSKKVNVPLEKTTYVQFYPAPAKAKPQKLKEIDYQDLRFPADLSNPFAVATVLNQEPGKLKIKELKQVLDQGDEISKTRQMKEAIFEQKVRQDILTEIENHLKWQVHLGKEHTTYRFKRELTEEWKKARAKYKQNRGDPVEGEELQRLQT--EQSQKRIVRDLKGKRQEFHPNFDP--LVNNVWLTRHRAQRRFQQAARKIMLERRL 476          
BLAST of Si:ch73-222h13.1 vs. Ensembl Mouse
Match: Cfap221 (cilia and flagella associated protein 221 [Source:MGI Symbol;Acc:MGI:2684947])

HSP 1 Score: 113.62 bits (283), Expect = 1.412e-28
Identity = 52/126 (41.27%), Postives = 81/126 (64.29%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIP 482
            +PNHL ++ ++ +  +N +I+  P  VHF GY++  K+ Q L   NISDE +  HI+PP +KYFQ+ + K E R++PG  +   I F+PD+ R Y D I+IH K  ++ ++VPI+AYP +  L  P
Sbjct:   39 VPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQINFEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCK-GDDTLLVPIHAYPVLNNLDFP 163          
BLAST of Si:ch73-222h13.1 vs. UniProt/SwissProt
Match: sp|A9Q751|PCDP1_MOUSE (Cilia- and flagella-associated protein 221 OS=Mus musculus OX=10090 GN=Cfap221 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.751e-44
Identity = 119/443 (26.86%), Postives = 206/443 (46.50%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPE-RMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGL-----ERKLLITQPDKSHI--ENSDLISLSKLELKRKSIK---------------SNALLDSEIKNAQPXXXX--------------XXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFR-FDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRL 1322
            +PNHL ++ ++ +  +N +I+  P  VHF GY++  K+ Q L   NISDE +  HI+PP +KYFQ+ + K E R++PG  +   I F+PD+ R Y D I+IH K  ++ ++VPI+AYP +  L  P  I      +G   +  + L     V+F + I +++ H + +I+  +G+IP  G   V + F P  Y   +  I +++SQ+N +P  C   G   P +     E K L T+  K ++  E +  +       K K  K               SN    + + N +P  +                  ++  +  FE +VR+++  E +N ++WQ   G +  + +   ++ ++ +    +Y  N     E  E  R  T  +   +R  R      +E+    D    V   W+ R  A  RF+ AA K+++  RL
Sbjct:   39 VPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQINFEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCK-GDDTLLVPIHAYPVLNNLDFPTFINLSDVFLGESKSYVIPLQCSCPVDFEFHITLLRSHQAFTIEPKSGIIPANGKAKVTVKFTPIQYGMAQIKIQLWISQFNSQPYECVFTGTCYPNMALPLEEFKRLNTRSKKVNVPLEKTTYVQFYPAPAKAKPQKLKEIDYQDLRFPADLSNPFAVATVLNQEPGKLKIKELKQVLDQGDEISKTRQMKEAIFEQKVRQDILTEIENHLKWQVHLGKEHTTYRFKRELTEEWKKARAKYKQNRGDPVEGEELQRLQT--EQSQKRIVRDLKGKRQEFHPNFDP--LVNNVWLTRHRAQRRFQQAARKIMLERRL 476          
BLAST of Si:ch73-222h13.1 vs. UniProt/SwissProt
Match: sp|Q4G0U5|PCDP1_HUMAN (Cilia- and flagella-associated protein 221 OS=Homo sapiens OX=9606 GN=CFAP221 PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 6.235e-39
Identity = 73/228 (32.02%), Postives = 129/228 (56.58%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPER-MVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKL 788
            +PNHL ++ ++ +  +N +I+  P  +HF GY++ +++ Q L   N+S+E +R HI+PP +KYF++ Y + E  +VPG  +   + F+PD+ R Y D I++H K  ++ ++VPI+AYP +  L  P  I      +G   T  + L     V+F + I +I+ H + +I+  +G+IP  G   V + F P  Y T +  + +++SQ+N +P  C   G   P +   L
Sbjct:   39 VPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVRKEHHLVPGLSLTVTVTFSPDEWRYYYDCIRVHCK-GDDTLLVPIHAYPVMNSLDFPSFINLSNVLLGESKTYVIPLQCSCPVDFEFYITLIQSHQAFAIEPTSGIIPANGKMTVTIKFTPFQYGTAQIKMQLWISQFNSQPYECVFTGTCYPNMALPL 265          
BLAST of Si:ch73-222h13.1 vs. UniProt/SwissProt
Match: sp|A8J6X7|PCDP1_CHLRE (Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.896e-25
Identity = 70/228 (30.70%), Postives = 114/228 (50.00%), Query Frame = 3
Query:  111 PNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPER---MVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERK 785
            PN L    ++ +  +  I++ EP  ++F GY+L +   Q L+  N+    +RFHIIPP + +F  K T P +   + PG   +  + F P + R Y D +++H +  E N+++P++AYP       P  + F    +G    +  TL     V+F YEIV +K +P+  ++   GV+P RG   V + F P    T E  I   V+   + P T  L+  +E GL  K
Sbjct:   97 PNTLTYNRVYSKVGNTRILQAEPAVLNFGGYELGKVYSQVLRIRNVRASGTRFHIIPPSTPFF--KATCPAKKGLLAPGMTEEVAVEFCPTQYRYYYDCVRVHCE--EENLLIPLHAYPVANEALFPTRVDFGRVALGQEVVRSHTLECKVPVDFEYEIVEVKPNPAFRVEPARGVVPGRGRVTVDMWFCPLALTTEEAVIETEVAGV-YVPDT-MLLSAAEVGLRTK 318          
BLAST of Si:ch73-222h13.1 vs. UniProt/SwissProt
Match: sp|A8JFU2|CFA65_CHLRE (Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.476e-7
Identity = 27/128 (21.09%), Postives = 64/128 (50.00%), Query Frame = 3
Query:  177 PKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNV 560
            P+++ +  +    +  ++L   N+S  + +     P SK F + + +P ++ PG      ++F P K ++Y+D +++   +   + +VP++AY  +  +++P  + F  TP     T  L + +  +V
Sbjct:   44 PEQLEWRHWNPGTEYVKQLVLKNVSTSVLKIRFKQPTSKAFGMDFPEPFKLRPGMSQPLKVVFRPLKQQHYSDNVELFVGNV--SCLVPVHAYTPVTHIEVPPALDFGFTPTKETVTAQLPVRNTGDV 169          
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Match: A0A210PQI2 (Primary ciliary dyskinesia protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19807 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 2.551e-64
Identity = 152/469 (32.41%), Postives = 236/469 (50.32%), Query Frame = 3
Query:   57 FLINKMTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHI-ENSDLISLSKLELKRKSIKSN----------------ALLD-----SEIKNAQPXXXXXXXXXXXXVD-----------------FESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECY-RNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRL 1343
             LI+ M  ++    +  IPNHL +T I+   A N +I+ +P  VHF GY L++K+ Q L   N S E+ R HIIPP +KYF LKY K ER+VPG  ++C I FT D+ R Y D I+I+    E N+++PI+ YP +     P+  +FP  P+GH  TK   L  ++ ++F + +  I+ HPS S+  +TGVIP  G++ V ++F P +++T    I + +SQ+N KPI C   G S PG+ +++   Q +   + +   L  L +   KR+ +K                    LD     +++ N +P  +   + ++  +                  FE  VR+NV  E+QNQ+RWQ   G   I++ + EKI   R   + +Y    R      E Y R  T   + ++RTFR  +         DT  +  + W VR  AL RF   A KVI++ R+  +L  L
Sbjct:   23 LLIDTM-QLVEPRKQQTIPNHLLETKIYSTVAQNAMIQAKPAVVHFGGYSLHKKHVQTLSIVNASTEVIRMHIIPPQTKYFYLKYKKTERLVPGLTIECTIEFTADEWRYYYDCIRINCP-GEENLVIPIHGYPVMSTDDFPQQFSFPPVPVGHKMTKVFPLRCEAPIDFEFNLTYIQPHPSFSVQPMTGVIPAHGESEVSVTFAPLEFLTAMMKIQLVISQFNSKPIICNFCGTSLPGMLKEISEQQYESEEVLDPRTLTPLGRSRKKRQKVKPRKPEVQQDIEYGGVRFPPQLDTPYAVAQVLNQEPGKLRAKDFRETVITKSKDKPKAATRQMKEAVFEHSVRQNVYEERQNQLRWQVKLGDDQITNADREKILVARSDAWDQYKYERRGDPIPEEEYCRQETA--TTFKRTFRESTTLALETAKFDT--YSNDLWAVRHAALARFAQTARKVILHARVNHKLNSL 485          
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Match: A0A3Q0KN48 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.809e-62
Identity = 154/479 (32.15%), Postives = 242/479 (50.52%), Query Frame = 3
Query:  111 PNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKN---YQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSH------IEN-SDLISLSKLELKR-----------------KSIKS----------------NALLDSEIKNAQP----XXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNI-------------RKQNELS-----ECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRLVES 1352
            PNHL +T IF +   N  I VEP E++F       +     ++ +  NIS  ++R HI+PP +KYFQL Y +P+ +VPG+ + C ++F PDK+  Y D I++HT+D EN +I+PIYAYP I   + P  I FP T IG   T H+ + S S V+F Y I +I ++PS +I  + GV+  R  T +++ F P +Y TCE    ++++Q NF+P  CT+IGN+ PGLE     + P   +       EN S+L+  +K E+ +                 KSIK+                  LLDS  K +       +     +++  + FES V +++  E++NQ+RWQ+  GA P+S  E  KI   + ++ Y+Y L+I             R  +EL      E +  S +  S++    +F   E           F    W+ R   +++FRS    +IIN R+  RLK+L ++
Sbjct:   18 PNHLLNTEIFWKMGCNKFIAVEPAEIYFDNVSFRSQKSGIMRQFELKNISGRVTRLHILPPDTKYFQLSYKQPKCLVPGYSITCRLVFFPDKSSYYEDCIRVHTEDHENQLIIPIYAYPVIGDFEFPEFIEFPPTNIGKKKTHHIPIKSTSTVDFEYRIQIIHNNPSFTIQPMKGVLHARQITELLIDFQPNNYSTCELKFELHIAQVNFQPKCCTVIGNALPGLE-----SSPHSCYDDDVDDDENLSELLDTNKCEISQSLHSRRMKKSKYSSQIIKSIKTPKCENLPEITCPHHLVKFLLDSHEKLSSSQRNNTTTEGLTRQQKLLIFESMVHQDLIDEQRNQVRWQSKLGANPLSAGERIKILDSQALETYKYQLSIPTSSANFKSSKGHRILSELRPYRPVEPFNKSLITRSEFTIEPKFHIVE-----------FTKAKWLYRCDMIEKFRSTISSIIINRRMIKRLKKLKQA 480          
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Match: A0A094ZJC7 (Primary ciliary dyskinesia protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_01148 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 7.862e-62
Identity = 122/323 (37.77%), Postives = 182/323 (56.35%), Query Frame = 3
Query:  150 ASNTIIEVEPKEVHFAGYKLNEKN---YQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPXXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLN 1109
              N  I VEP E++F       +     ++ +  NISD ++R HI+PP +KYF+L Y +P+ +VPG+ + C +IF PDK   Y D I++HT+D EN +IVPIYAYP I   + P  I FP T IG   T H+ + S S V+F + I +I  HPS SI  + GV+     T +++ F P  Y TCE    ++++Q NF+P  CT+IGN+ PGLER +L     K  I       L K  L  +      L+ S+  N    +     +++  + FES V +N+  E++NQ+RWQ+  GA P+S +E  KI   RE+ + +Y +N
Sbjct:    2 GCNKFIAVEPAEIYFDNISFRSQKSGIMKQFELKNISDRVTRLHILPPDTKYFRLSYKQPKCLVPGYSITCHLIFFPDKPSYYEDCIRVHTEDHENQLIVPIYAYPVIGDFEFPEFIEFPSTNIGKKKTHHIPIKSSSAVDFEFRIQIIHIHPSFSIQPVKGVLHAGQITELLIDFQPNSYSTCELKFELHIAQVNFQPKCCTVIGNALPGLERYVLRIGTPKYEITCPH--HLVKFLLGSQ----EKLISSQRNNT---TTEGLTRQQKLLTFESMVHQNLIDEQRNQVRWQSKLGANPLSPEERVKILDSRELAWKQYYVN 315          
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Match: A0A267E1G8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034468g2 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 5.441e-60
Identity = 96/225 (42.67%), Postives = 154/225 (68.44%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLER 782
            +PN+  DT IF +   N I+E  P  VHFAG+  N+ + +++KF N+S E++RFHI+PP + +F+L Y K +R+VPGF V+C++ F P + R Y D ++IH+KD +NN+I+PI+AYP +   + P+ + FP  P+G+  T+ + L S + VEF +EI +   +P  +++ L+G IP  G+  + ++F P D+VT E T+ + VSQ+NF P+TC L+G+S PG+ER
Sbjct:   63 VPNYFLDTQIFNKMGRNAIVEAHPAVVHFAGFTPNQIHVRKVKFANVSTEVTRFHILPPETPFFKLTYEKRDRLVPGFAVQCVLEFKPTEVRYYYDALRIHSKDDKNNLIIPIHAYPVLGYNEFPKQVKFPAIPVGYRRTQIIPLRSRAPVEFEFEIKITHPNPVFTVEPLSGSIPADGEVDIAVTFAPIDFVTAEMTMELRVSQFNFAPLTCHLMGHSAPGMER 287          

HSP 2 Score: 62.7734 bits (151), Expect = 2.911e-6
Identity = 63/242 (26.03%), Postives = 102/242 (42.15%), Query Frame = 3
Query:  960 FESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQ-----FVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRLVE-----SGGNYHEVDTSNMYPGGKTLTFSRPLDELAEERL----------PKYQITFENKFDMTEYKLLLPIQPQ-------YSYLDLQVPLQMQVLNYERIDTSSLN 1604
            FE  V +NV  E+QNQ+RWQ   G   ++D+E   +  +REM +  Y    RK+ + +        D     R  R      +  D+  TP      +  + W  R  A  +F  AA+KVI+  R   +L  L +       G Y  + T++M    K        ++L + +L          P +Q   + K        L P  P+       Y++  LQVPL  Q+ +Y+R+D  +L+
Sbjct:  417 FEQEVTQNVYDERQNQLRWQVKLGDNVLTDEETAAMLAEREMAWQYYR---RKRGDPTPAEELERSDTEAQSRRTRRQVDASDGQDSAPTPTANFDLYKNDKWESRWSARFQFVQAAWKVIVRRRADEKLAGLRQLFIDWGKGKYAALTTTDME--RKEEDEELAEEQLKDSQLQLESVGTLTFPTHQTAQQIKKMEEAAPPLFPPMPEQPVCRRSYAFHPLQVPLHYQLQHYDRVDVHALS 653          
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Match: V4AEA6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_144748 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 6.195e-60
Identity = 135/445 (30.34%), Postives = 232/445 (52.13%), Query Frame = 3
Query:  108 IPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLI----TQPDKSHIENSDLISLSKLELKRKSIKSNALLD-----SEIKNAQPX----------------XXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREM--DFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQ------FVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRL 1343
            +PNH+ +T +F +   N ++   P  V F G+    K+ Q L   N S E+   HIIPP +K+F +KY K +RM PG  ++C + F  D+ R Y D I++H +  E N+++P++AYP +   Q P+N  FP  P+G    +   +  +  V+F Y++ +IK HP +SI+ L+G +P  G   + ++F P +++T + T+ +  SQ+N KPI C   G+S PGL + +++         +H +  +    +  E+ +  IK  A++D     +++ N QP                 S   ++++  +  FE  VR+NV  E+QNQ+RWQ   G + I   +  +I ++R+   D Y++    R+Q+ + +   N    + ++ RT R       Y+  I T +      +  + W VR  ALD+F  AA K+II NR + +LK L
Sbjct:   42 VPNHILETKLFAKVGKNELVHSRPATVQFEGFTTESKHIQNLSIVNASTEVVSLHIIPPQTKHFSIKYDKNKRMGPGLTLECSVEFIGDEYRYYYDCIRVHCQ-GEENLLIPLHAYPVLDLKQFPQNFIFPAVPVGESICRKFPIKCNVPVDFEYQLELIKQHPFLSIEPLSGTVPGNGQVDISVTFSPCEFLTAQLTVQLITSQFNSKPILCNFTGSSAPGLLKYVILLFLRIYSIYAHHQIYNFYPYNIFEIIQNGIKFPAVIDTPHAVAQVLNQQPGKLKAKDVRENLTSQKDSKKATSRQMKEALFEQAVRKNVYEERQNQLRWQVKLGDEQIKQSKRVQILEERDQAWDIYKFT---RRQDPVEDKEYNRLKTEIEYRRTMR------PYNQVIITFEDAKFDLYTNDLWAVRHAALDKFIQAARKIIIRNRGEAKLKSL 476          
BLAST of Si:ch73-222h13.1 vs. Ensembl Cavefish
Match: si:ch73-222h13.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:103031475])

HSP 1 Score: 192.586 bits (488), Expect = 1.780e-51
Identity = 128/463 (27.65%), Postives = 217/463 (46.87%), Query Frame = 3
Query:  114 NHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLER------------------KLLIT----------------------QPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPXXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWM-------VRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGN 1361
             HL  T ++ ++ SN  +EV+P E+HF G+++     + LK  NIS ++   HI+P  +KYF  +YTK  R+VPG      + F+PD+ R + D I++H +  E N++VP++AYP I  L IP +I  P  P+GH     + L     ++F +++  ++ H + +I  L+GVIP  G T   ++F P  Y T E T+ + +SQ+N KP  CTL  +  P   R                  ++L++                       P  S ++ S    L+K+ L+     S  LL   + + Q    +   ++  +   E++V+ NV  E+ N ++WQ   G    S ++  KI Q++E    EY           +  R+S   ++D+       S  +   +   TP  +P   +       VR+  L  F+ AA+KVI+  R++ RL  L +   N
Sbjct:   37 QHLLPTRVYVKFRSNNKVEVDPLELHFRGFEVGRNYKKVLKLINISSDVLDVHILPTQTKYFHTEYTKKNRLVPGLSYTITVRFSPDEWRYFYDSIRVHCQ-GEENLLVPVHAYPVIDDLHIPSHIYLPAVPLGHSIAHVIPLSCSCPIDFEFQVHCLQPHEAFTIQPLSGVIPANGKTDFTVTFRPDQYGTAEITLQLLISQFNSKPFVCTLTASCSPQRTRGQPGKNEKSNTILQDRKPEVLLSLPADRRIKLQRFQHKKKIKPDDSPQSSAVDVSTPAGLAKMLLQPHDKLSYKLLREAMSHTQ---TAHQTRQMKEASLENKVQFNVQKERVNHLQWQVNLGELLSSTEQKMKILQEQEFAAAEY-----------KAGRDSGGREADFNSVLPKLSLHRVQRNAEQTPHHLPAFSVNVSSQLEVRQRLLRLFQQAAYKVILQCRMKNRLLVLQQLASN 484          
BLAST of Si:ch73-222h13.1 vs. Ensembl Cavefish
Match: si:ch73-222h13.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:103031475])

HSP 1 Score: 190.66 bits (483), Expect = 6.352e-51
Identity = 126/460 (27.39%), Postives = 215/460 (46.74%), Query Frame = 3
Query:  123 NDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLER------------------KLLIT----------------------QPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPXXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWM-------VRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGN 1361
            N+  ++ ++ SN  +EV+P E+HF G+++     + LK  NIS ++   HI+P  +KYF  +YTK  R+VPG      + F+PD+ R + D I++H +  E N++VP++AYP I  L IP +I  P  P+GH     + L     ++F +++  ++ H + +I  L+GVIP  G T   ++F P  Y T E T+ + +SQ+N KP  CTL  +  P   R                  ++L++                       P  S ++ S    L+K+ L+     S  LL   + + Q    +   ++  +   E++V+ NV  E+ N ++WQ   G    S ++  KI Q++E    EY              R+S   ++D+       S  +   +   TP  +P   +       VR+  L  F+ AA+KVI+  R++ RL  L +   N
Sbjct:   37 NNAGVYVKFRSNNKVEVDPLELHFRGFEVGRNYKKVLKLINISSDVLDVHILPTQTKYFHTEYTKKNRLVPGLSYTITVRFSPDEWRYFYDSIRVHCQ-GEENLLVPVHAYPVIDDLHIPSHIYLPAVPLGHSIAHVIPLSCSCPIDFEFQVHCLQPHEAFTIQPLSGVIPANGKTDFTVTFRPDQYGTAEITLQLLISQFNSKPFVCTLTASCSPQRTRGQPGKNEKSNTILQDRKPEVLLSLPADRRIKLQRFQHKKKIKPDDSPQSSAVDVSTPAGLAKMLLQPHDKLSYKLLREAMSHTQ---TAHQTRQMKEASLENKVQFNVQKERVNHLQWQVNLGELLSSTEQKMKILQEQEFAAAEYKAG-----------RDSGGREADFNSVLPKLSLHRVQRNAEQTPHHLPAFSVNVSSQLEVRQRLLRLFQQAAYKVILQCRMKNRLLVLQQLASN 481          
BLAST of Si:ch73-222h13.1 vs. Ensembl Nematostella
Match: EDO48935 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHY4])

HSP 1 Score: 166.777 bits (421), Expect = 2.645e-43
Identity = 145/515 (28.16%), Postives = 221/515 (42.91%), Query Frame = 3
Query:  237 FTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLL-ITQPD--KSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPXXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDF-YEYNLNIR--KQNELSECYR---NSTVDDSDWERTFRFDSYEKEYD--------------------------DTIDTPQFVPEC-------WMVRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGNYHEVDTSNMYPGGKTLTFSRPLDELAEERL-----PKYQITFENKFDMTEYK-------------LLLPIQP-------QYSYLDLQVPLQMQVLNYE 1580
              NIS E  R HIIPP +K+F +KY K ER VPG +++  I FTPD+ R Y D I+IH++  E N++VPI+AYP +     P+ + F   P+G   TK + L  ++ V+F +++ V++ +P+  +  LTGVIP      + ++F P DY T    + + +SQ+N +P+ CT  G SEPGL ++L   +QPD       N  L  +    L R  +K      S    AQ             +   + +   V  ++Q +++ +  R A           KQ +E  F Y+   NI+  +QN+L  C R   N+  + S  +   +    EKEY                              D P   P+        W  R + L++F  A  KVII +R          +  N H +  S    G +   F+R      EER+        Q T  + F    YK               L +QP          YL L+VP Q  +L Y+
Sbjct:    1 IANISSETQRMHIIPPSTKHFYIKYNKKERFVPGLFIEVTIEFTPDEWRYYYDCIRIHSR-GEENLLVPIHAYPVMSSEAFPKEVHFAPVPLGESKTKMIPLRCEAPVDFEFQLTVLQPNPAFRVSPLTGVIPGGEMVKIQVTFTPIDYSTAIMKLQLLISQFNAEPLVCTFTGTSEPGLAKRLKEKSQPDIFPDKPRNGILDPVMIDPLGRTRMKKLKTKPSGDGKAQEIVRDGYRFPTTGLSNPAAI-AAVLSQQQGKLKAKDVRQAVQSRKDFTGSTKQMKETMFEYQVYQNIQEERQNQLRWCVRLGENTLAEPSKRQILAQRTKAEKEYKLNRGDPVPRREFNRSSTGCQLRRVHRQACDVPDHQPKFDVLVNDEWSKRHMVLNKFIQAGRKVIIRSR----------ANKNLHSL--SGFLSGWRKGKFTRDQTSNVEERVLDTIPGNIQPTSIHPFSFPLYKSPDIKDDLEVDALGTLSVQPTAVKVKTHIPYLTLKVPQQYHLLGYK 501          
BLAST of Si:ch73-222h13.1 vs. Ensembl Medaka
Match: ENSORLT00000046744.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:101157925])

HSP 1 Score: 166.392 bits (420), Expect = 1.679e-42
Identity = 85/263 (32.32%), Postives = 143/263 (54.37%), Query Frame = 3
Query:  111 PNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQP---DKSHIENSDLISLSKLELKRKSIKSNALL 890
            P  L ++        N+ ++ EP E+HF+G++LN+   + LK  N+S E  R HI+P ++++FQ  +TK  R++PG      + F PD+ R + D I +   + E N+++P++AYP I  L IP +I     P+G    + + L     V+F +++++I+ H + S+  L GVI    ++ + ++F P  Y T   T  + VSQ+N KP  CT+ G+S P L   +L  QP   D +  E   L  L + + KR+S K  + L
Sbjct:   34 PRQLLESKTVANPKRNSQVQAEPPELHFSGFQLNKHYQKTLKLINVSSEALRIHIVPTLTEHFQTTFTKKYRLIPGLAYTLKVAFCPDEWRYFYDCIHVCC-EGEENLLIPVHAYPVIDDLHIPAHIDLAAVPLGQSVQRVIPLRCRCPVDFEFQVLLIQSHEAFSVQPLAGVISANEESKITVTFSPRQYRTSSITFQLVVSQFNTKPYLCTVTGSSAPHLGPSVLQNQPSRTDSAPPEQKGLAPLKRDKTKRRSSKEASKL 295          
BLAST of Si:ch73-222h13.1 vs. Ensembl Medaka
Match: ENSORLT00000036876.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:101157925])

HSP 1 Score: 69.707 bits (169), Expect = 7.311e-12
Identity = 39/122 (31.97%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  534 LTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQP---DKSHIENSDLISLSKLELKRKSIKSNALL 890
            + L     V+F +++++I+ H + S+  L GVI    ++ + ++F P  Y T   T  + VSQ+N KP  CT+ G+S P L   +L  QP   D +  E   L  L + + KR+S K  + L
Sbjct:   99 IPLRCRCPVDFEFQVLLIQSHEAFSVQPLAGVISANEESKITVTFSPRQYRTSSITFQLVVSQFNTKPYLCTVTGSSAPHLGPSVLQNQPSRTDSAPPEQKGLAPLKRDKTKRRSSKEASKL 220          
BLAST of Si:ch73-222h13.1 vs. Ensembl Medaka
Match: ENSORLT00000041483.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:101157925])

HSP 1 Score: 69.707 bits (169), Expect = 7.311e-12
Identity = 39/122 (31.97%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  534 LTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQP---DKSHIENSDLISLSKLELKRKSIKSNALL 890
            + L     V+F +++++I+ H + S+  L GVI    ++ + ++F P  Y T   T  + VSQ+N KP  CT+ G+S P L   +L  QP   D +  E   L  L + + KR+S K  + L
Sbjct:   99 IPLRCRCPVDFEFQVLLIQSHEAFSVQPLAGVISANEESKITVTFSPRQYRTSSITFQLVVSQFNTKPYLCTVTGSSAPHLGPSVLQNQPSRTDSAPPEQKGLAPLKRDKTKRRSSKEASKL 220          
BLAST of Si:ch73-222h13.1 vs. Planmine SMEST
Match: SMESG000081135.1 (SMESG000081135.1)

HSP 1 Score: 1369.76 bits (3544), Expect = 0.000e+0
Identity = 677/679 (99.71%), Postives = 679/679 (100.00%), Query Frame = 3
Query:   72 MTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPXXXXXXXXXXXXVDFESRVRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGNYHEVDTSNMYPGGKTLTFSRPLDELAEERLPKYQITFENKFDMTEYKLLLPIQPQYSYLDLQVPLQMQVLNYERIDTSSLNYQAVKTDFKARSSTDTEVVVSNEVDEIVAPILYTKQSNAHSFIDKDRTLTVFPHNCSYFDNYSYFPLYYYENELLENKAPIDMDWKVSKSSFLMCKKNVKSNKSPLLVKALESSLLPRQAPNLMKKSDLDQLDYRNSNDVPTINSDMMYAEFPILKTLTENLYKKWND 2108
            MTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPNSISKSNKKKLKVDFESRVRENVTIEKQN+IRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGNYHEVDTSNMYPGGKTLTFSRPLDELAEERLPKYQITFENKFDMTEYKLLLPIQPQYSYLDLQVPLQMQVLNYERIDTSSLNYQAVKTDFKARSSTDTEVVVSNEVDEIVAPI+YTKQSNAHSFIDKDRTLTVFPHNCSYFDNYSYFPLYYYENELLENKAPIDMDWKVSKSSFLMCKKNVKSNKSPLLVKALESSLLPRQAPNLMKKSDLDQLDYRNSNDVPTINSDMMYAEFPILKTLTENLYKKWND
Sbjct:    1 MTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKNYQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTPDKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHICTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFLPTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIENSDLISLSKLELKRKSIKSNALLDSEIKNAQPNSISKSNKKKLKVDFESRVRENVTIEKQNKIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQNELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIALDRFRSAAFKVIINNRLQFRLKRLVESGGNYHEVDTSNMYPGGKTLTFSRPLDELAEERLPKYQITFENKFDMTEYKLLLPIQPQYSYLDLQVPLQMQVLNYERIDTSSLNYQAVKTDFKARSSTDTEVVVSNEVDEIVAPIVYTKQSNAHSFIDKDRTLTVFPHNCSYFDNYSYFPLYYYENELLENKAPIDMDWKVSKSSFLMCKKNVKSNKSPLLVKALESSLLPRQAPNLMKKSDLDQLDYRNSNDVPTINSDMMYAEFPILKTLTENLYKKWND 679          
The following BLAST results are available for this feature:
BLAST of Si:ch73-222h13.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP2211.222e-4132.14cilia and flagella associated protein 221 [Source:... [more]
CFAP2211.298e-3932.02cilia and flagella associated protein 221 [Source:... [more]
CFAP2211.689e-2835.86cilia and flagella associated protein 221 [Source:... [more]
CFAP2211.971e-2635.04cilia and flagella associated protein 221 [Source:... [more]
CFAP2212.857e-2636.51cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch73-222h13.12.207e-5035.16si:ch73-222h13.1 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000018114.18.417e-2733.82cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cfap2212.503e-4526.86cilia and flagella associated protein 221 [Source:... [more]
Cfap2212.503e-4526.86cilia and flagella associated protein 221 [Source:... [more]
Cfap2211.412e-2841.27cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A9Q751|PCDP1_MOUSE1.751e-4426.86Cilia- and flagella-associated protein 221 OS=Mus ... [more]
sp|Q4G0U5|PCDP1_HUMAN6.235e-3932.02Cilia- and flagella-associated protein 221 OS=Homo... [more]
sp|A8J6X7|PCDP1_CHLRE1.896e-2530.70Cilia- and flagella-associated protein 221 homolog... [more]
sp|A8JFU2|CFA65_CHLRE4.476e-721.09Cilia- and flagella-associated protein 65 (Fragmen... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PQI22.551e-6432.41Primary ciliary dyskinesia protein 1 OS=Mizuhopect... [more]
A0A3Q0KN485.809e-6232.15Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A094ZJC77.862e-6237.77Primary ciliary dyskinesia protein 1 OS=Schistosom... [more]
A0A267E1G85.441e-6042.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4AEA66.195e-6030.34Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch73-222h13.11.780e-5127.65cilia and flagella associated protein 221 [Source:... [more]
si:ch73-222h13.16.352e-5127.39cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489352.645e-4328.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000046744.11.679e-4232.32cilia and flagella associated protein 221 [Source:... [more]
ENSORLT00000036876.17.311e-1231.97cilia and flagella associated protein 221 [Source:... [more]
ENSORLT00000041483.17.311e-1231.97cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of Si:ch73-222h13.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000081135.10.000e+099.71SMESG000081135.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011780 ID=SMED30011780|Name=Si:ch73-222h13.1|organism=Schmidtea mediterranea sexual|type=transcript|length=2139bp
TATAAAATGCATATTATCTTTAAAAATAGTTTAATTTAAATCGGTTGATT
TATTAATTTCTTATTAATAAAATGACAGATATTATTACAATCAACACCAA
GGGTTTGATACCAAATCACTTAAATGACACAAATATATTTTGTCGATATG
CATCAAACACTATAATTGAGGTGGAACCAAAAGAAGTGCATTTTGCTGGC
TACAAGTTAAACGAAAAAAATTATCAAGAACTAAAATTCACGAATATCTC
GGATGAAATTTCTCGATTCCATATTATCCCGCCTGTGTCTAAATACTTTC
AATTGAAATATACAAAACCAGAAAGAATGGTTCCAGGTTTCTATGTGAAA
TGCATGATTATTTTCACTCCTGATAAAGCTCGAAATTATAATGATTTCAT
TAAAATTCACACGAAGGACAGTGAAAACAATGTGATTGTTCCAATTTATG
CATATCCAGCGATCCAGGGTCTCCAGATTCCCAGGAATATTGCATTTCCA
GTGACACCTATAGGGCATATATGCACAAAACATTTGACTCTTCATTCTGA
CAGTAATGTTGAATTTGTCTATGAAATCGTTGTAATCAAAGATCATCCAT
CAATTTCGATTGATAAATTGACGGGAGTTATTCCCGTCAGAGGGGACACA
TTTGTCGTTTTGAGCTTTCTGCCAACTGATTATGTAACGTGTGAAAAAAC
CATAAATATATACGTATCACAATACAATTTCAAGCCAATTACTTGCACAT
TAATTGGAAATTCTGAGCCTGGATTAGAAAGAAAGCTTCTCATAACACAA
CCTGACAAAAGTCATATAGAGAACTCCGATTTGATTTCCCTATCAAAATT
GGAACTGAAAAGAAAGTCCATAAAATCCAACGCATTATTAGATTCGGAAA
TTAAAAATGCTCAACCCAATTCCATTTCGAAATCAAATAAAAAGAAATTG
AAGGTGGATTTCGAATCAAGGGTTCGAGAAAATGTAACTATTGAAAAGCA
AAATCAAATTCGATGGCAAACATTTCGAGGTGCGCAGCCAATCTCTGATC
AAGAAGTTGAAAAGATCAAACAAAAACGAGAAATGGACTTCTATGAATAC
AACCTTAATATACGAAAACAAAATGAGCTATCTGAATGTTATAGAAACTC
AACAGTGGATGATTCCGATTGGGAGCGTACATTTCGTTTCGATTCATATG
AAAAAGAATATGATGACACAATTGATACTCCTCAATTCGTTCCCGAATGC
TGGATGGTTCGTAAAATAGCTCTTGATAGATTTAGGTCTGCAGCTTTCAA
AGTTATTATAAACAACCGATTACAGTTTCGATTAAAACGACTTGTGGAAT
CTGGAGGAAATTATCACGAAGTCGATACTTCTAATATGTATCCCGGTGGG
AAAACTCTTACATTTTCTCGCCCATTGGATGAACTTGCGGAAGAAAGATT
ACCAAAATATCAAATAACATTTGAAAATAAATTTGACATGACAGAATATA
AATTATTACTGCCGATTCAACCGCAATATTCGTATTTGGATTTACAGGTT
CCACTTCAAATGCAAGTTTTAAACTACGAGAGGATAGATACATCAAGTTT
AAATTATCAAGCTGTCAAAACAGATTTTAAAGCGAGATCTTCGACAGACA
CGGAAGTCGTTGTCTCAAACGAAGTGGATGAAATAGTTGCTCCGATTTTG
TATACAAAACAGTCTAATGCGCATTCATTCATTGATAAGGATAGAACTCT
AACGGTGTTTCCTCATAATTGCTCTTACTTTGACAATTATTCGTATTTTC
CACTGTATTATTATGAAAATGAATTACTGGAAAATAAAGCCCCGATTGAT
ATGGATTGGAAGGTTTCAAAATCCTCATTTTTAATGTGTAAAAAGAACGT
CAAATCCAATAAAAGTCCTTTACTAGTAAAAGCCCTCGAATCAAGTCTAC
TTCCTCGACAAGCACCAAATTTGATGAAGAAATCTGATCTGGATCAGCTG
GATTACAGAAATTCTAATGATGTACCTACTATCAATTCAGACATGATGTA
TGCTGAATTTCCGATACTAAAGACGTTGACTGAAAACCTATATAAAAAGT
GGAATGATTAATTTTGTTTTAATTAATAAAAAAATTTGA
back to top

protein sequence of SMED30011780-orf-1

>SMED30011780-orf-1 ID=SMED30011780-orf-1|Name=SMED30011780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MTDIITINTKGLIPNHLNDTNIFCRYASNTIIEVEPKEVHFAGYKLNEKN
YQELKFTNISDEISRFHIIPPVSKYFQLKYTKPERMVPGFYVKCMIIFTP
DKARNYNDFIKIHTKDSENNVIVPIYAYPAIQGLQIPRNIAFPVTPIGHI
CTKHLTLHSDSNVEFVYEIVVIKDHPSISIDKLTGVIPVRGDTFVVLSFL
PTDYVTCEKTINIYVSQYNFKPITCTLIGNSEPGLERKLLITQPDKSHIE
NSDLISLSKLELKRKSIKSNALLDSEIKNAQPNSISKSNKKKLKVDFESR
VRENVTIEKQNQIRWQTFRGAQPISDQEVEKIKQKREMDFYEYNLNIRKQ
NELSECYRNSTVDDSDWERTFRFDSYEKEYDDTIDTPQFVPECWMVRKIA
LDRFRSAAFKVIINNRLQFRLKRLVESGGNYHEVDTSNMYPGGKTLTFSR
PLDELAEERLPKYQITFENKFDMTEYKLLLPIQPQYSYLDLQVPLQMQVL
NYERIDTSSLNYQAVKTDFKARSSTDTEVVVSNEVDEIVAPILYTKQSNA
HSFIDKDRTLTVFPHNCSYFDNYSYFPLYYYENELLENKAPIDMDWKVSK
SSFLMCKKNVKSNKSPLLVKALESSLLPRQAPNLMKKSDLDQLDYRNSND
VPTINSDMMYAEFPILKTLTENLYKKWND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0003341cilium movement
GO:0030030cell projection organization
GO:0044458motile cilium assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR029676Gm101
Vocabulary: molecular function
TermDefinition
GO:0005516calmodulin binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 130..232
e-value: 1.2E-7
score: 34.0
coord: 28..128
e-value: 2.0E-5
score: 26.8
IPR029676Primary ciliary dyskinesia protein 1PANTHERPTHR46500FAMILY NOT NAMEDcoord: 13..277
coord: 286..571