Cyclin t1

Overview
NameCyclin t1
Smed IDSMED30011777
Length (bp)1353
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin t1 (SMED30011777) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin t1 (SMED30011777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin t1 (SMED30011777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin t1 (SMED30011777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30011777h1SMcG0017060 dd_Smed_v4_1288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011777h1SMcG0017060 dd_Smed_v4_1288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin t1 vs. Ensembl Human
Match: CCNT1 (cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599])

HSP 1 Score: 128.257 bits (321), Expect = 4.099e-31
Identity = 76/221 (34.39%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLK 253          
BLAST of Cyclin t1 vs. Ensembl Human
Match: CCNT2 (cyclin T2 [Source:HGNC Symbol;Acc:HGNC:1600])

HSP 1 Score: 127.487 bits (319), Expect = 6.561e-31
Identity = 92/294 (31.29%), Postives = 144/294 (48.98%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-------LSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGE-SQT-------------VNSTTSIP--KSIQKPLIETAPVESEKQEPLEEGEI 860
            +L  RQ  A LIQ++G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+ ARKL  ++K  +        L   + D+  ++    V  LE+IML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK     +A    R+    G+ S+T             V+S T +P   S QKP     P       PL  G I
Sbjct:   33 ELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELV-ILETIMLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPV----PLNSGNI 320          
BLAST of Cyclin t1 vs. Ensembl Human
Match: CCNT2 (cyclin T2 [Source:HGNC Symbol;Acc:HGNC:1600])

HSP 1 Score: 126.716 bits (317), Expect = 1.172e-30
Identity = 92/294 (31.29%), Postives = 144/294 (48.98%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-------LSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGE-SQT-------------VNSTTSIP--KSIQKPLIETAPVESEKQEPLEEGEI 860
            +L  RQ  A LIQ++G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+ ARKL  ++K  +        L   + D+  ++    V  LE+IML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK     +A    R+    G+ S+T             V+S T +P   S QKP     P       PL  G I
Sbjct:   33 ELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELV-ILETIMLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPV----PLNSGNI 320          
BLAST of Cyclin t1 vs. Ensembl Human
Match: CCNT1 (cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599])

HSP 1 Score: 83.1889 bits (204), Expect = 5.122e-18
Identity = 53/148 (35.81%), Postives = 78/148 (52.70%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTS 488
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN 180          
BLAST of Cyclin t1 vs. Ensembl Human
Match: CCNT1 (cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599])

HSP 1 Score: 83.1889 bits (204), Expect = 5.122e-18
Identity = 53/148 (35.81%), Postives = 78/148 (52.70%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTS 488
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN 180          
BLAST of Cyclin t1 vs. Ensembl Celegans
Match: cit-1.2 (Cyclin-T1.2 [Source:UniProtKB/Swiss-Prot;Acc:P34424])

HSP 1 Score: 78.9518 bits (193), Expect = 1.842e-15
Identity = 61/226 (26.99%), Postives = 108/226 (47.79%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLG--LVHNVSQ-LLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLS---GKQIDS--NFERIVSAVHALESIMLMSVGFP-RLDFVHPHIV--IMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDI-----NLRPWFSSISSGLTNSILQKMSKEFLDIYVKTP 692
            +L  RQ     I D+   L H   +  L   A    ++ +   S        VA    +LA K+ED  +KL  +V  ++Q      KQ  S  +F    + V  +E ++L ++ F   +D  H +++  + D+ K  +++   + TAY++ T +L +T  SVR+S   IA A + +A+ +  I + DI     + R W+      +T   ++ M+KEFLDI+ + P
Sbjct:   46 ELSKRQQGGVFIFDIAMQLTHGKGEHGLSGVAATLFNRFFNVHSLKRCDFRDVAAACVFLAGKNEDAPKKLKYVVTQLWQFKYPHNKQFQSEQHFLDQCNVVTLIEDVLLKTISFDINVDLPHQYVLKLMRDVEKGRNVYKDMVKTAYYMATDVLIITDWSVRYSCASIATACVNIAAFFHNINMDDIVPFELSDR-WYRLEDQSMTREEVEAMTKEFLDIFSRNP 270          
BLAST of Cyclin t1 vs. Ensembl Celegans
Match: cit-1.1 (Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P34425])

HSP 1 Score: 76.2554 bits (186), Expect = 8.617e-15
Identity = 59/240 (24.58%), Postives = 114/240 (47.50%), Query Frame = 3
Query:   63 DLKYRQICATLIQDL--GLVH------NVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG-KQIDSNFERIVSA--VHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDI---HNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINL------RPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNF 722
            +L  RQ+ A  IQ++  GL +       +    +  A  +MH+ Y   S+ +     V     +LA KS++C RKL+ ++    +    KQ+ +   R  +A  +  LES++L ++ F  L+   PHI ++DI+KK D    +      AY+  T ++ +T  S+R+S   ++   +++ + +  + ++ +         PW++     +TN  L++M  +FL  Y  +        FNF
Sbjct:   42 ELASRQMAAAFIQEMIDGLNNVKDPKMKIGHTGLCVAHTHMHRFYYLHSFKKYDYRDVGAACVFLAGKSQECPRKLSHVISVWRERKDRKQLTTETARNEAAQIIVLLESMILQTIAFD-LNVHLPHIYVLDIMKKVDKKEHYRPLTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFADFINEDSPWYAKFDETMTNEKLREMEVDFLVTYRNSCQFHHASKFNF 280          
BLAST of Cyclin t1 vs. Ensembl Celegans
Match: cit-1.1 (Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P34425])

HSP 1 Score: 76.2554 bits (186), Expect = 8.911e-15
Identity = 59/240 (24.58%), Postives = 114/240 (47.50%), Query Frame = 3
Query:   63 DLKYRQICATLIQDL--GLVH------NVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG-KQIDSNFERIVSA--VHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDI---HNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDI------NLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNF 722
            +L  RQ+ A  IQ++  GL +       +    +  A  +MH+ Y   S+ +     V     +LA KS++C RKL+ ++    +    KQ+ +   R  +A  +  LES++L ++ F  L+   PHI ++DI+KK D    +      AY+  T ++ +T  S+R+S   ++   +++ + +  + ++ +         PW++     +TN  L++M  +FL  Y  +        FNF
Sbjct:   42 ELASRQMAAAFIQEMIDGLNNVKDPKMKIGHTGLCVAHTHMHRFYYLHSFKKYDYRDVGAACVFLAGKSQECPRKLSHVISVWRERKDRKQLTTETARNEAAQIIVLLESMILQTIAF-DLNVHLPHIYVLDIMKKVDKKEHYRPLTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFADFINEDSPWYAKFDETMTNEKLREMEVDFLVTYRNSCQFHHASKFNF 280          
BLAST of Cyclin t1 vs. Ensembl Celegans
Match: cit-1.2 (Cyclin-T1.2 [Source:UniProtKB/Swiss-Prot;Acc:P34424])

HSP 1 Score: 55.8398 bits (133), Expect = 2.747e-8
Identity = 30/97 (30.93%), Postives = 54/97 (55.67%), Query Frame = 3
Query:  417 IMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDI-----NLRPWFSSISSGLTNSILQKMSKEFLDIYVKTP 692
            + D+ K  +++   + TAY++ T +L +T  SVR+S   IA A + +A+ +  I + DI     + R W+      +T   ++ M+KEFLDI+ + P
Sbjct:    1 MRDVEKGRNVYKDMVKTAYYMATDVLIITDWSVRYSCASIATACVNIAAFFHNINMDDIVPFELSDR-WYRLEDQSMTREEVEAMTKEFLDIFSRNP 96          
BLAST of Cyclin t1 vs. Ensembl Fly
Match: CycT (gene:FBgn0025455 transcript:FBtr0333124)

HSP 1 Score: 125.946 bits (315), Expect = 1.537e-30
Identity = 70/236 (29.66%), Postives = 128/236 (54.24%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIEL-KDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNS 767
            +L+YRQ+ A LIQ++G    VSQL INTAIVYMH+ Y   S+       +A  S +LA+K E+  RKL  +++   +      + N+  +   +   E+++L ++GF  +   HPH  ++   +          T+YF+ ++ LHLT++ +++    +A   +Y+A KW   E+ +    + WF  +   ++  +L++++ EF+ IY K+P +LK K  N ++       ++T NS
Sbjct:   67 ELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAELAQELVFNENVLLQTLGF-DVAIDHPHTHVVRTCQLVKACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYEKSPARLKSK-LNSIKAIAQGASNRTANS 300          
BLAST of Cyclin t1 vs. Ensembl Fly
Match: CycT (gene:FBgn0025455 transcript:FBtr0075205)

HSP 1 Score: 125.946 bits (315), Expect = 1.537e-30
Identity = 70/236 (29.66%), Postives = 128/236 (54.24%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIEL-KDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNS 767
            +L+YRQ+ A LIQ++G    VSQL INTAIVYMH+ Y   S+       +A  S +LA+K E+  RKL  +++   +      + N+  +   +   E+++L ++GF  +   HPH  ++   +          T+YF+ ++ LHLT++ +++    +A   +Y+A KW   E+ +    + WF  +   ++  +L++++ EF+ IY K+P +LK K  N ++       ++T NS
Sbjct:   67 ELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAELAQELVFNENVLLQTLGF-DVAIDHPHTHVVRTCQLVKACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYEKSPARLKSK-LNSIKAIAQGASNRTANS 300          
BLAST of Cyclin t1 vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0344022)

HSP 1 Score: 59.6918 bits (143), Expect = 2.271e-9
Identity = 53/220 (24.09%), Postives = 90/220 (40.91%), Query Frame = 3
Query:   69 KYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVS----AVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIH----NGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRP-----WFSSISSGLTNSILQKMSKEFLDIYVKT 689
            +YR+  A  I + G    +    + T +VY H+ Y   S+        A    + A K E+  +K  DI+KT     G   D+ F          V  LE I+L ++ F  L   HP+  ++   K +          +  A+      L  T + ++   + IA A +++ASK     ++D   R      W+    S +T  IL+ +  + LD+Y  T
Sbjct:   28 RYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTA---RGILTDNYFYSFGDDPKEEVMTLERILLQTIKF-DLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLS-TVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLYQST 242          
BLAST of Cyclin t1 vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0085942)

HSP 1 Score: 59.6918 bits (143), Expect = 2.271e-9
Identity = 53/220 (24.09%), Postives = 90/220 (40.91%), Query Frame = 3
Query:   69 KYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVS----AVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIH----NGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRP-----WFSSISSGLTNSILQKMSKEFLDIYVKT 689
            +YR+  A  I + G    +    + T +VY H+ Y   S+        A    + A K E+  +K  DI+KT     G   D+ F          V  LE I+L ++ F  L   HP+  ++   K +          +  A+      L  T + ++   + IA A +++ASK     ++D   R      W+    S +T  IL+ +  + LD+Y  T
Sbjct:   28 RYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTA---RGILTDNYFYSFGDDPKEEVMTLERILLQTIKF-DLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLS-TVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLYQST 242          
BLAST of Cyclin t1 vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0085941)

HSP 1 Score: 59.6918 bits (143), Expect = 2.271e-9
Identity = 53/220 (24.09%), Postives = 90/220 (40.91%), Query Frame = 3
Query:   69 KYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVS----AVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIH----NGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRP-----WFSSISSGLTNSILQKMSKEFLDIYVKT 689
            +YR+  A  I + G    +    + T +VY H+ Y   S+        A    + A K E+  +K  DI+KT     G   D+ F          V  LE I+L ++ F  L   HP+  ++   K +          +  A+      L  T + ++   + IA A +++ASK     ++D   R      W+    S +T  IL+ +  + LD+Y  T
Sbjct:   28 RYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTA---RGILTDNYFYSFGDDPKEEVMTLERILLQTIKF-DLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLS-TVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLYQST 242          
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Match: ccnt2a (cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779])

HSP 1 Score: 128.257 bits (321), Expect = 1.686e-31
Identity = 74/221 (33.48%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    IA   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDTKSNAYLQQAQELVILETIVLQTLGF-EITIEHPHTDVVKCSQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDNSVTLELLDELTHEFLQILEKTPSRLK 252          
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Match: ccnt2a (cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779])

HSP 1 Score: 127.872 bits (320), Expect = 2.952e-31
Identity = 74/221 (33.48%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    IA   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDTKSNAYLQQAQELVILETIVLQTLGF-EITIEHPHTDVVKCSQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDNSVTLELLDELTHEFLQILEKTPSRLK 252          
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Match: ccnt1 (cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397])

HSP 1 Score: 125.176 bits (313), Expect = 2.333e-30
Identity = 74/221 (33.48%), Postives = 117/221 (52.94%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHA------LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+       +A  + +LA+K E+  RKL  ++K  +     Q  S   R  + +        LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++S   +A   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   37 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMVQSFTRFHRNVIAPAALFLAAKVEEQPRKLEHVIKVTHACLNPQDPSPDTRSDTYLQQAQDLVILESIILQTLGF-EITIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYSPPIVACVCIHLACKWSNWEIPVSTDGKHWWQYVDPTVTLELLDELTHEFLQILEKTPSRLK 256          
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Match: ccnt2b (cyclin T2b [Source:ZFIN;Acc:ZDB-GENE-030131-183])

HSP 1 Score: 124.02 bits (310), Expect = 3.121e-30
Identity = 73/221 (33.03%), Postives = 116/221 (52.49%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +         +DS     +        LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    +A   +++A KW   E+    + + W+  +   +T  +L  ++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPHDPPLDSKSSAYLQQAQELVLLETIVLQTLGF-EITIEHPHTDVVRCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSDGKHWWEYVDRAVTLQLLDDLTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Match: ccnt2b (cyclin T2b [Source:ZFIN;Acc:ZDB-GENE-030131-183])

HSP 1 Score: 119.013 bits (297), Expect = 2.082e-28
Identity = 76/236 (32.20%), Postives = 119/236 (50.42%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNG---------------FIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +         +DS     +        LE+I+L ++GF  +   HPH    D+V+   +  G                  T+YF+ T+ LHLTT  ++H    +A   +++A KW   E+    + + W+  +   +T  +L  ++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPHDPPLDSKSSAYLQQAQELVLLETIVLQTLGF-EITIEHPHT---DVVRCTQLVRGRNRWTETKLMSSSKDLAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSDGKHWWEYVDRAVTLQLLDDLTHEFLQILEKTPSRLK 265          
BLAST of Cyclin t1 vs. Ensembl Xenopus
Match: CCNT2 (cyclin T2 [Source:NCBI gene;Acc:100488125])

HSP 1 Score: 127.872 bits (320), Expect = 3.293e-31
Identity = 73/221 (33.03%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG---KQIDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +        Q+D+  E  +        LE+++L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKYHRNVMSPTALFLAAKVEEQPRKLEHVIKVAHACLNPVEPQLDTKSEGYLQQAQELVTLETVLLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDQSVTLELLDELTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. Ensembl Xenopus
Match: CCNT2 (cyclin T2 [Source:NCBI gene;Acc:100488125])

HSP 1 Score: 127.102 bits (318), Expect = 8.868e-31
Identity = 73/221 (33.03%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG---KQIDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +        Q+D+  E  +        LE+++L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKYHRNVMSPTALFLAAKVEEQPRKLEHVIKVAHACLNPVEPQLDTKSEGYLQQAQELVTLETVLLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDQSVTLELLDELTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. Ensembl Xenopus
Match: CCNT1 (cyclin T1 [Source:NCBI gene;Acc:100170179])

HSP 1 Score: 124.405 bits (311), Expect = 4.972e-30
Identity = 72/221 (32.58%), Postives = 117/221 (52.94%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG---KQIDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVY+H+ Y   S+       V   + +LA+K E+  RKL  +++  +          D+  E  +        LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + +PW+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   29 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYVHRFYMVQSFTRFHRNSVGPAALFLAAKVEEQPRKLEHVIRVAHACLSPLEPAPDTRSEAYLQQAQDLVILESIILQTLGF-EITIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKPWWEYVDVTVTLKLLDELTHEFLQILEKTPNRLK 248          
BLAST of Cyclin t1 vs. Ensembl Xenopus
Match: CCNT1 (cyclin T1 [Source:NCBI gene;Acc:100170179])

HSP 1 Score: 124.02 bits (310), Expect = 6.015e-30
Identity = 72/221 (32.58%), Postives = 117/221 (52.94%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG---KQIDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVY+H+ Y   S+       V   + +LA+K E+  RKL  +++  +          D+  E  +        LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + +PW+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   43 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYVHRFYMVQSFTRFHRNSVGPAALFLAAKVEEQPRKLEHVIRVAHACLSPLEPAPDTRSEAYLQQAQDLVILESIILQTLGF-EITIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKPWWEYVDVTVTLKLLDELTHEFLQILEKTPNRLK 262          
BLAST of Cyclin t1 vs. Ensembl Xenopus
Match: CCNT2 (cyclin T2 [Source:NCBI gene;Acc:100488125])

HSP 1 Score: 102.834 bits (255), Expect = 7.697e-23
Identity = 59/200 (29.50%), Postives = 104/200 (52.00%), Query Frame = 3
Query:  126 SQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSG---KQIDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            + L INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +        Q+D+  E  +        LE+++L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:    5 THLTINTAIVYMHRFYMHHSFTKYHRNVMSPTALFLAAKVEEQPRKLEHVIKVAHACLNPVEPQLDTKSEGYLQQAQELVTLETVLLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDQSVTLELLDELTHEFLQILEKTPSRLK 203          
BLAST of Cyclin t1 vs. Ensembl Mouse
Match: Ccnt2 (cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199])

HSP 1 Score: 128.642 bits (322), Expect = 1.523e-31
Identity = 75/222 (33.78%), Postives = 121/222 (54.50%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-------LSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L +RQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+ ARKL  ++K  +        L   + D+  ++    V  LE+IML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSHRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELV-LLETIMLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPSRLK 252          
BLAST of Cyclin t1 vs. Ensembl Mouse
Match: Ccnt2 (cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199])

HSP 1 Score: 128.257 bits (321), Expect = 2.668e-31
Identity = 75/222 (33.78%), Postives = 121/222 (54.50%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-------LSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L +RQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+ ARKL  ++K  +        L   + D+  ++    V  LE+IML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSHRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELV-LLETIMLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPSRLK 252          
BLAST of Cyclin t1 vs. Ensembl Mouse
Match: Ccnt1 (cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363])

HSP 1 Score: 126.716 bits (317), Expect = 8.026e-31
Identity = 75/221 (33.94%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     +A  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. Ensembl Mouse
Match: Ccnt1 (cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363])

HSP 1 Score: 126.716 bits (317), Expect = 8.026e-31
Identity = 75/221 (33.94%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     +A  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. Ensembl Mouse
Match: Ccnt1 (cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363])

HSP 1 Score: 81.2629 bits (199), Expect = 1.575e-17
Identity = 52/150 (34.67%), Postives = 79/150 (52.67%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSML 494
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     +A  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ +
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNRI 182          
BLAST of Cyclin t1 vs. UniProt/SwissProt
Match: sp|Q7TQK0|CCNT2_MOUSE (Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.866e-30
Identity = 75/222 (33.78%), Postives = 121/222 (54.50%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-------LSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L +RQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+ ARKL  ++K  +        L   + D+  ++    V  LE+IML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSHRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELV-LLETIMLQTLGF-EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPSRLK 252          
BLAST of Cyclin t1 vs. UniProt/SwissProt
Match: sp|Q8HXN7|CCNT1_PANTR (Cyclin-T1 OS=Pan troglodytes OX=9598 GN=CCNT1 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.875e-30
Identity = 76/221 (34.39%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   33 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLK 252          
BLAST of Cyclin t1 vs. UniProt/SwissProt
Match: sp|O60563|CCNT1_HUMAN (Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.968e-30
Identity = 76/221 (34.39%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLK 253          
BLAST of Cyclin t1 vs. UniProt/SwissProt
Match: sp|Q9XT26|CCNT1_HORSE (Cyclin-T1 OS=Equus caballus OX=9796 GN=CCNT1 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.355e-30
Identity = 76/221 (34.39%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     VA  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRNSVAPAALFLAAKVEEQPKKLEHVIKVAHACLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLK 253          
BLAST of Cyclin t1 vs. UniProt/SwissProt
Match: sp|Q9QWV9|CCNT1_MOUSE (Cyclin-T1 OS=Mus musculus OX=10090 GN=Ccnt1 PE=1 SV=3)

HSP 1 Score: 126.716 bits (317), Expect = 5.614e-30
Identity = 75/221 (33.94%), Postives = 121/221 (54.75%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A L+QD+G   NVSQL INTAIVYMH+ Y   S+ +     +A  + +LA+K E+  +KL  ++K  +     Q    D+  E  +  V     LESI+L ++GF  L   HPH  ++   +          T+YF+ T+ LHLTT S++++   +A   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   34 ELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGF-ELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPSRLK 253          
BLAST of Cyclin t1 vs. TrEMBL
Match: A0A0R3SRN3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7848 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 3.057e-50
Identity = 88/219 (40.18%), Postives = 144/219 (65.75%), Query Frame = 3
Query:   60 LDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ----IDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            ++L  RQ CA LIQ++G   + +Q++IN+A+ YM   YE+FS + +KP++ A+T+ Y+ASK+ED +RKL+ I+   Y +  KQ      S + RIV  +H+LE I+LM +GF ++D  HPHI+++++++K DI       +YF+C+++LH TTL +RHS + IAA +LYVA+KW   ++K  N   WF   S  L    ++KM++EF+  +    +K+K
Sbjct:    1 MNLAKRQQCACLIQEIGSRMSTTQVVINSALCYMQYFYERFSPDTVKPIFTAITTLYIASKTEDYSRKLSFIIGAAYNVLKKQPPDQASSVYHRIVRTIHSLEGILLMVIGFRKMDIKHPHIILIEMLRKSDIPKEVATCSYFVCSNILHFTTLFLRHSPEAIAAVSLYVAAKWLNFDIKAKN-ESWFHVFSKDLKFDEIRKMAEEFIVTFNAVDVKIK 218          
BLAST of Cyclin t1 vs. TrEMBL
Match: A0A0R3VT48 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS391 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.068e-49
Identity = 92/233 (39.48%), Postives = 144/233 (61.80%), Query Frame = 3
Query:   57 TLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQI----DSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNK 743
            +++L  RQ CA LIQ++G     +Q++IN A+ YMH  YE FS   +KPV V++ S YLA K+ED +RKL+ ++   Y +  K +     S F RIV  +HALE  +LM VGF ++D  HPH+++++++++ D       T+YF+CT +LH TTL +RHS + IAA +LYVA+KW+  ++K  +   W+   S  LT   ++KM+ EF   +    IK+K +  N L+   N+
Sbjct:    7 SMNLARRQQCACLIQEIGSRIPTTQVVINAALFYMHNFYEVFSPETVKPVMVSIASLYLACKTEDFSRKLSLLISVAYNVFKKSVPPESSSTFRRIVQNIHALEGTILMVVGFQKMDVKHPHVILINVLRQNDFPKQVSHTSYFVCTHILHFTTLLLRHSMEAIAATSLYVAAKWNNYDIKSEDGE-WYRLFSRELTLEEIRKMADEFTQAFQACDIKIKNQVKNTLKMNFNR 238          
BLAST of Cyclin t1 vs. TrEMBL
Match: A0A0R3TRC3 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10123 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.957e-49
Identity = 88/219 (40.18%), Postives = 141/219 (64.38%), Query Frame = 3
Query:   60 LDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ----IDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            ++L  RQ CA LIQ++G   + +Q++IN+A+ YM   YE+FS + +KP++ A+T+ Y+ASK+ED +RKL+ I+   Y +  KQ      S F RIV  +H+LE I+LM +GF ++D  HPHI+++++++K DI       +YF+C+++LH TTL + HS + IAA +LYV++KW   ++K  N   WF   S  L    ++KMS EF+  +     K+K
Sbjct:    1 MNLAKRQQCACLIQEIGSRMSTTQVVINSALCYMQYFYERFSPDTVKPIFTAITTLYIASKTEDYSRKLSFIIGAAYNVLKKQPPDQTSSVFHRIVRTIHSLEGILLMVIGFRKMDIKHPHIILIEMLRKSDIPKEVATCSYFVCSNVLHFTTLFLHHSPEAIAAVSLYVSAKWLNFDIKAKN-ESWFHIFSKDLRVEEIRKMSDEFISTFNSVDAKIK 218          
BLAST of Cyclin t1 vs. TrEMBL
Match: A0A068WQI0 (Cyclin t1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000062100 PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 6.315e-48
Identity = 91/233 (39.06%), Postives = 144/233 (61.80%), Query Frame = 3
Query:   57 TLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGK----QIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNK 743
            +++L  RQ CA LIQ++G     +Q++IN A+ YMH  YE FS   +KPV V++ S YLA K+ED +RKL+ ++   Y +  K    +  S F RIV  +HALES +LM VGF ++D  HPH+++++++++ D       T+YF+CT +LH TTL + HS + IAA +LYVA+KW+  ++K  +   W+   S  LT   ++KM+ EF   +    +K+K +  N L+   N+
Sbjct:    7 SMNLARRQQCACLIQEIGSRIPTTQVVINAALFYMHNFYEVFSPETVKPVMVSIASLYLACKTEDFSRKLSLLISVAYGVFKKTAPAESSSTFRRIVQNIHALESTILMVVGFQKMDVKHPHVILINVLRQNDFPKQVSHTSYFVCTHILHFTTLLLHHSMEAIAATSLYVAAKWNNYDIKSEDGE-WYRLFSRDLTLEEIRKMADEFTQAFQACDVKIKNQVKNTLKMNFNR 238          
BLAST of Cyclin t1 vs. TrEMBL
Match: A0A087VXE4 (Cyclin t1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000062100 PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 7.160e-48
Identity = 91/233 (39.06%), Postives = 144/233 (61.80%), Query Frame = 3
Query:   57 TLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGK----QIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNK 743
            +++L  RQ CA LIQ++G     +Q++IN A+ YMH  YE FS   +KPV V++ S YLA K+ED +RKL+ ++   Y +  K    +  S F RIV  +HALES +LM VGF ++D  HPH+++++++++ D       T+YF+CT +LH TTL + HS + IAA +LYVA+KW+  ++K  +   W+   S  LT   ++KM+ EF   +    +K+K +  N L+   N+
Sbjct:    7 SMNLARRQQCACLIQEIGSRIPTTQVVINAALFYMHNFYEVFSPETVKPVMVSIASLYLACKTEDFSRKLSLLISVAYGVFKKTAPAESSSTFRRIVQNIHALESTILMVVGFQKMDVKHPHVILINVLRQNDFPKQVSHTSYFVCTHILHFTTLLLHHSMEAIAATSLYVAAKWNNYDIKSEDGE-WYRLFSRDLTLEEIRKMADEFTQAFQACDVKIKNQVKNTLKMNFNR 238          
BLAST of Cyclin t1 vs. Ensembl Cavefish
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:103023729])

HSP 1 Score: 126.331 bits (316), Expect = 7.336e-31
Identity = 80/263 (30.42%), Postives = 134/263 (50.95%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAP 818
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++  KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK     +A    ++    G+S    S T    S  + +++ AP
Sbjct:   33 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDAKSNAYLQQAQELVILETIVLQTLGF-EITIEHPHTDVVKCSQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLVCKWSKREIPLSTDGKSWWEYVDNSVTIELLDELTTEFLQILEKTPSRLKKIRHWRATQAAKKLKTDGQSSETGSFTG---SQDQSILDAAP 291          
BLAST of Cyclin t1 vs. Ensembl Cavefish
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:103023729])

HSP 1 Score: 126.331 bits (316), Expect = 8.349e-31
Identity = 80/263 (30.42%), Postives = 134/263 (50.95%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAP 818
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    IA   +++  KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK     +A    ++    G+S    S T    S  + +++ AP
Sbjct:   33 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDAKSNAYLQQAQELVILETIVLQTLGF-EITIEHPHTDVVKCSQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLVCKWSKREIPLSTDGKSWWEYVDNSVTIELLDELTTEFLQILEKTPSRLKKIRHWRATQAAKKLKTDGQSSETGSFTG---SQDQSILDAAP 291          
BLAST of Cyclin t1 vs. Ensembl Cavefish
Match: ccnt2b (cyclin-T2-like [Source:NCBI gene;Acc:103028284])

HSP 1 Score: 124.02 bits (310), Expect = 4.278e-30
Identity = 80/247 (32.39%), Postives = 134/247 (54.25%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSN---FERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGESQTVNST 770
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D++   + +    +  LE+I+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    +A   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK     +A    +R  +K ESQ V+S+
Sbjct:   48 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVSHACLNPQEPPLDTSSNVYLQQAQELVLLETIVLQTLGF-EITIEHPHTDVVRCSQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVVACVCIHLACKWSNWEIPISSDGKHWWEYLDPTVTLQLLDQLTHEFLQILEKTPSRLKRIRNWRATQAAKR--SKTESQPVDSS 291          
BLAST of Cyclin t1 vs. Ensembl Cavefish
Match: ccnt2b (cyclin-T2-like [Source:NCBI gene;Acc:103028284])

HSP 1 Score: 120.939 bits (302), Expect = 4.117e-29
Identity = 83/256 (32.42%), Postives = 137/256 (53.52%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSN---FERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNG---------FIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK----LKAFNFLRRFHNKGESQTVNST 770
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D++   + +    +  LE+I+L ++GF  +   HPH    D+V+   +  G            T+YF+ T+ LHLTT  +++    +A   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  KTP +LK     +A    +R  +K ESQ V+S+
Sbjct:   44 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVSHACLNPQEPPLDTSSNVYLQQAQELVLLETIVLQTLGF-EITIEHPHT---DVVRCSQLVRGRCFHLSSKDLAQTSYFMATNSLHLTTFCLQYKPTVVACVCIHLACKWSNWEIPISSDGKHWWEYLDPTVTLQLLDQLTHEFLQILEKTPSRLKRIRNWRATQAAKR--SKTESQPVDSS 293          
BLAST of Cyclin t1 vs. Ensembl Cavefish
Match: ccnt1 (cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397])

HSP 1 Score: 106.686 bits (265), Expect = 2.826e-24
Identity = 76/222 (34.23%), Postives = 118/222 (53.15%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVH---ALESIMLMSVGFPRLDFVHPHIV-IMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A  IQD+G   N SQL INT IVYMH+ Y   S+       +A  + +LASK E+  RKL  +++  +     Q   +DS  +  V       ALESI+L ++    +D  H H+V    +V+  D+      T+YF+ T+ LHLTT  +++S   +A   +++A KW   E+    + + W+  + S +T  +L  ++ EFL I  KTP +LK
Sbjct:   37 ELSYRQQAANFIQDMGQRLN-SQLSINTGIVYMHRFYMVQSFTLFHRNVIAPAALFLASKVEEQPRKLEHVIRVAHACLNPQDPTLDSRSDTYVQQSQDLVALESIILQTLFDITIDHPHSHVVKCTQLVRSKDL----AQTSYFMATN-LHLTTFCLQYSPTVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDSKVTLELL-DLTHEFLQILEKTPNRLK 251          
BLAST of Cyclin t1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003616.1 (pep scaffold:Pmarinus_7.0:GL476475:418210:425326:1 gene:ENSPMAG00000003277.1 transcript:ENSPMAT00000003616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 2.665e-33
Identity = 76/226 (33.63%), Postives = 120/226 (53.10%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLY-----EKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHAL---ESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y      KF  N + P      + +LA+K E+  RKL  ++K  +     Q   +D+  +  +     L   E +ML ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    +A   +++A KW   E+    + +PW+  + +G++ ++L  ++ EFL I  KTP +LK
Sbjct:   24 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLQTFSKFHRNAISPA-----ALFLAAKVEEQPRKLEHVIKVAHACLNPQEAPLDTKSDAYLQQAQDLVMNEHVMLQTLGF-EITIDHPHTYVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSDGKPWWEYVDNGVSMNLLDALTHEFLQILEKTPNRLK 243          
BLAST of Cyclin t1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007549.1 (pep scaffold:Pmarinus_7.0:GL483420:1071:10573:1 gene:ENSPMAG00000006818.1 transcript:ENSPMAT00000007549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 4.455e-11
Identity = 39/129 (30.23%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  120 NVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQ-LSGKQIDSNFERIVSAVHA-----LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTS 488
            N  QL+INTAIVYMH+ +   S+ ++    +A ++ +LA+K ED  RKL  +++     L+ ++   N + +V    A     LE+++L ++GF  +  VHPH  ++   +          T+YF+ T+
Sbjct:    2 NRPQLVINTAIVYMHRFFMFHSFKDVHKHLLAQSAIFLAAKVEDQPRKLEHVIRVAQACLAPREAPLNPKHLVYLQKAQDLIMLETMLLQTLGF-DVTVVHPHTHVVKCSQLVRASKDLAHTSYFMATN 129          
BLAST of Cyclin t1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003411.1 (pep scaffold:Pmarinus_7.0:GL483875:8648:11677:-1 gene:ENSPMAG00000003120.1 transcript:ENSPMAT00000003411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 6.742e-8
Identity = 49/193 (25.39%), Postives = 83/193 (43.01%), Query Frame = 3
Query:   30 AMTSADDPITLDLKYRQICATLIQD----LGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVS-----AVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNG----FIDTAY-FICTSMLHLTTLSVRHSTQEIAAAALYVASK 566
            +M    D +T + +YR+  A  I D    LGL+H+     + T +VY H+ Y   S+ +           +LA K E+  +K  DI+KT   L     D  F +         V  LE I+L ++ F  L   HP+  ++   K+           +  A+ F+  S+   T L ++   + I  A +Y+A +
Sbjct:   22 SMQEGMDAVT-ESRYRREGARFIFDVGTRLGLLHDRHYDTLATGMVYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLN---DVQFAQFGDDPKQEEVMVLERILLQTIKFD-LQLEHPYHFLLKYAKQLKGDKSKLQKLVQMAWTFVNDSL--CTMLCLQWEPEIIGVAVMYLAGR 207          
BLAST of Cyclin t1 vs. Ensembl Nematostella
Match: EDO42905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S058])

HSP 1 Score: 114.775 bits (286), Expect = 2.208e-29
Identity = 69/221 (31.22%), Postives = 120/221 (54.30%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQL---SGKQIDSNFERIVSAVHAL---ESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIEL-KDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  ATLIQD+G   +VSQL INT+IVYMH+ Y    + +     +A    +L++K E+  RKL  +++  +      G  ++   E  +     L   ESI+L ++GF  +   HPH  ++  ++           +YF+ T+ LHLTTL ++     +A A +++A KW   E+ +  + + W+  I+  +T  +L ++++EF++I  K P +LK
Sbjct:   35 ELSYRQQAATLIQDMGQRLSVSQLTINTSIVYMHRFYMCHPFQKFHRHAMAPCCLFLSAKVEEQPRKLEHVIRVAHACLHRDGPPLNPESEEYLQQAQDLIENESILLQTLGF-EVTVHHPHTYVVKGIQLVRASKDLGQASYFMATNSLHLTTLCLQFKPPVVACACIHLACKWCNYEIPQSSDHKYWWQYINPTVTKKLLDEIAQEFVNIMEKCPSRLK 254          
BLAST of Cyclin t1 vs. Ensembl Nematostella
Match: EDO45644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSI9])

HSP 1 Score: 70.4774 bits (171), Expect = 6.246e-14
Identity = 48/212 (22.64%), Postives = 107/212 (50.47%), Query Frame = 3
Query:   93 LIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGK-----QIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVI---MDIVKKYDIHNGF-------IDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDIN-LRPWFSSISSGLTNSILQKMSKEFLDIY 680
             I + G   ++ Q  +++A V  H+ ++     +  P  + MT+ YLASK+E+C  K+ D++   Y+ S K     +I++ +  +  +V   E +ML  +GF R+ + +PH  +   + +++ +     +       I  +Y + +   H   L + +    +A A L+ A +   +E+     +RPW+ ++ S +T  ++Q ++++ +D+Y
Sbjct:   23 FIMESGAKLSLPQNAMSSACVLYHQFWKGCDPKDFDPYLIGMTAIYLASKAEECPCKVRDVINVCYRSSHKDSPCLEINARYWELRESVVNCELLMLRVLGF-RVSYDNPHKYLLHYLKVLQDWTCPGMWERSQVPQISWSYLLDS---HHIPLCLEYPPAHVAVALLHFAVECVGLEVPSQEAVRPWWKALCSDVTPELIQSITEDVMDMY 230          
BLAST of Cyclin t1 vs. Ensembl Medaka
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:101159477])

HSP 1 Score: 129.028 bits (323), Expect = 1.131e-31
Identity = 75/221 (33.94%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    IA   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   92 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDTKSNAYLQQAQELVILESIVLQTLGF-EITIDHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDNSVTLELLDELTHEFLQILEKTPSRLK 311          
BLAST of Cyclin t1 vs. Ensembl Medaka
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:101159477])

HSP 1 Score: 128.642 bits (322), Expect = 1.756e-31
Identity = 75/221 (33.94%), Postives = 119/221 (53.85%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---IDSNFERIVSAVHA---LESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D+     +        LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  ++H    IA   +++A KW   E+    + + W+  + + +T  +L +++ EFL I  KTP +LK
Sbjct:   92 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQEPPLDTKSNAYLQQAQELVILESIVLQTLGF-EITIDHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDNSVTLELLDELTHEFLQILEKTPSRLK 311          
BLAST of Cyclin t1 vs. Ensembl Medaka
Match: ccnt2b (cyclin-T2 [Source:NCBI gene;Acc:101157196])

HSP 1 Score: 125.946 bits (315), Expect = 5.614e-31
Identity = 75/221 (33.94%), Postives = 120/221 (54.30%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ---ID---SNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLK 704
            +L YRQ  A LIQD+G   NVSQL+INTAIVYMH+ Y   S+ +     ++ T+ +LA+K E+  RKL  ++K  +     Q   +D   S F+     +  LESI+L ++GF  +   HPH  ++   +          T+YF+ T+ LHLTT  + +    +A   +++A KW   E+    + + W+  +   +T  +L +++ EFL I  +TP KLK
Sbjct:   33 ELSYRQQAANLIQDIGQRLNVSQLIINTAIVYMHRFYMIHSFTKFHRNIISQTTLFLAAKVEEQPRKLEHVIKMAHAFINPQEPALDTKSSAFQLQAHELVVLESIVLQTLGF-EITVDHPHTDVVRCSQLVRASRDLAQTSYFMATNSLHLTTFCLEYRPTVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDRTVTLQLLDELTHEFLQILERTPSKLK 252          
BLAST of Cyclin t1 vs. Ensembl Medaka
Match: ccnt1 (cyclin T1 [Source:NCBI gene;Acc:101175653])

HSP 1 Score: 96.6709 bits (239), Expect = 2.164e-22
Identity = 65/214 (30.37%), Postives = 107/214 (50.00%), Query Frame = 3
Query:   63 DLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLY--EKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQ-------IDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELK-DINLRPWFSSISSGLTNSILQKMSKEFLD 674
            +L YRQ  A LIQD+G   NVSQL INTAIVYMH+ Y  + F+        ++  + +LA+K E+  RKL  ++K  +     Q        D+   +    V  LESI+L ++ F  +   HPH  ++   +          T+YF+ T+ LHLTT  +++    +A   +++A KW   E+    + + W+  +   +T  +L   S+  L+
Sbjct:   35 ELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTRFHRNVSVISPAALFLAAKVEEQPRKLEHVIKVAHACLNPQEPSPDVRSDAYLTQAQDLV-ILESIILQTLAF-EITIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYCPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDGTSQILLN 246          
BLAST of Cyclin t1 vs. Ensembl Medaka
Match: ccnq (cyclin Q [Source:NCBI gene;Acc:101174665])

HSP 1 Score: 63.929 bits (154), Expect = 4.394e-11
Identity = 52/226 (23.01%), Postives = 102/226 (45.13%), Query Frame = 3
Query:   42 ADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGK-----QIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPH-------IVIMDIVKKYDIHNGFI-DTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIY 680
            AD   + D +        I ++G+   +  + + TA V  H+ +++    E +P  VAM+  YLA K E+   +  DIV   ++   K     + D  F  +  +V   E ++L  +GF  +   HPH       + +  +V ++      + +T++ +     H   +S+RH+ Q IA A LY+A     +EL  +  + W+  +   +T + +  +  + L +Y
Sbjct:   28 ADTETSRDTRTHFRVCRFIMEIGVKLGMHSIPVATACVLYHRFFKRVCLREYEPYLVAMSCVYLAGKVEEQHIRTRDIVNVSHRYFNKGSAPLECDKEFWELRDSVVQCELLILRQLGF-HVSIEHPHKYLLHFLLSVKSLVNRHAWSRTPVAETSWALLRDCYH-GNMSIRHTPQHIAIATLYLALNSYGVELP-VGEKEWWQVLCENVTKADIHAVISDLLKLY 250          
BLAST of Cyclin t1 vs. Planmine SMEST
Match: SMESG000066586.1 (SMESG000066586.1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 382/387 (98.71%), Postives = 384/387 (99.22%), Query Frame = 3
Query:   33 MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVRSENLHQNRKLSLHQYYQRKDAPETSHKPSPINKNNDFPKXXXXXXXXXXDKKRRHEHSISTTSLNKYTKTELNNRVESESKESSYYQNRQEKGATPNDYYMF 1193
            MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTL VRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLT S+LQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVRSENLHQNRKLSLHQYYQRKDAPETSHKPSPINKNNDFPKSYSHSSNNSSDKKRRHEHSIS TSLNKYTKTELNNR+ESESKESSYYQNRQEKGATPNDYYMF
Sbjct:    1 MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLCVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTISVLQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVRSENLHQNRKLSLHQYYQRKDAPETSHKPSPINKNNDFPKSYSHSSNNSSDKKRRHEHSISATSLNKYTKTELNNRLESESKESSYYQNRQEKGATPNDYYMF 387          
BLAST of Cyclin t1 vs. Planmine SMEST
Match: SMESG000066586.1 (SMESG000066586.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 362/387 (93.54%), Postives = 365/387 (94.32%), Query Frame = 3
Query:   33 MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVRSENLHQNRKLSLHQYYQRKDAPETSHKPSPINKNNDFPKXXXXXXXXXXDKKRRHEHSISTTSLNKYTKTELNNRVESESKESSYYQNRQEKGATPNDYYMF 1193
            MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTL VRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLT S+LQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVR                   +APETSHKPSPINKNNDFPKSYSHSSNNSSDKKRRHEHSIS TSLNKYTKTELNNR+ESESKESSYYQNRQEKGATPNDYYMF
Sbjct:    1 MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLCVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTISVLQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIPKSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVR-------------------NAPETSHKPSPINKNNDFPKSYSHSSNNSSDKKRRHEHSISATSLNKYTKTELNNRLESESKESSYYQNRQEKGATPNDYYMF 368          
BLAST of Cyclin t1 vs. Planmine SMEST
Match: SMESG000066582.1 (SMESG000066582.1)

HSP 1 Score: 132.109 bits (331), Expect = 7.827e-35
Identity = 71/217 (32.72%), Postives = 129/217 (59.45%), Query Frame = 3
Query:   66 LKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAF 716
            LK + +CATLIQ+LG++ N SQ +I+  I+YMH ++ K +  +++P+YVA  S +L++K +D   ++  +V+ +  L GK   S   +I   +  LE  ++   G   ++ +HP+  I  +  KY   + FI +  FICTS+LH T   ++++++ +A  A+Y+A+KW+YI+L   + + WF  I   +  + +  +S  FL ++ + P  LK+ AF
Sbjct:    6 LKRQIVCATLIQELGVLCNRSQEVIDVGIIYMHNIFVKLNQKKIQPIYVAAVSLFLSTKYQDKRIEMKLLVEKVLIL-GKLSPSKNLKIEYYITCLEHTVIGLFG-TIMNMIHPNFFIKKVHNKYKFDDDFICSVSFICTSILHYTDFVIQYNSEYVAIIAIYIATKWNYIDLVKYDHKHWFQFIDPSIQTTKIIDLSHHFLKVFKEIPNNLKVIAF 220          
BLAST of Cyclin t1 vs. Planmine SMEST
Match: SMESG000066582.1 (SMESG000066582.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.586e-23
Identity = 55/186 (29.57%), Postives = 105/186 (56.45%), Query Frame = 3
Query:  159 MHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGLTNSILQKMSKEFLDIYVKTPIKLKLKAF 716
            MH ++ K +  +++P+YVA  S +L++K +D   ++  +V+ +  L GK   S   +I   +  LE  ++   G   ++ +HP+  I  +  KY   + FI +  FICTS+LH T   ++++++ +A  A+Y+A+KW+YI+L   + + WF  I   +  + +  +S  FL ++ + P  LK+ AF
Sbjct:    1 MHNIFVKLNQKKIQPIYVAAVSLFLSTKYQDKRIEMKLLVEKVLIL-GKLSPSKNLKIEYYITCLEHTVIGLFG-TIMNMIHPNFFIKKVHNKYKFDDDFICSVSFICTSILHYTDFVIQYNSEYVAIIAIYIATKWNYIDLVKYDHKHWFQFIDPSIQTTKIIDLSHHFLKVFKEIPNNLKVIAF 184          
BLAST of Cyclin t1 vs. Planmine SMEST
Match: SMESG000004055.1 (SMESG000004055.1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.852e-12
Identity = 58/227 (25.55%), Postives = 102/227 (44.93%), Query Frame = 3
Query:   30 AMTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKFSYNELKPVYVAMTSFYLASKSEDCARKLNDIVK-TMYQLSGKQIDSNFERIVSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFID-----TAYFICTSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDIN----LRPWFSSISSGLTNSILQKMSKEFLDIY 680
            ++    DP   D KYR   AT I +LG    +      TA+VY H+ Y   S+  +     A    +LA K E+  +K  DIV  T   L  K  +         +  +E I+L ++ F  L   HP+  +++ V+K       ++     +  FI  S+   T L ++   + +A A LY+A+K +  E++        + W+ S   G+T  +++ +  + LD+Y
Sbjct:   21 SLADGIDPRVED-KYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFNEFGNDPKEEIMTMERILLKTIKF-DLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR--TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 243          
The following BLAST results are available for this feature:
BLAST of Cyclin t1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCNT14.099e-3134.39cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599][more]
CCNT26.561e-3131.29cyclin T2 [Source:HGNC Symbol;Acc:HGNC:1600][more]
CCNT21.172e-3031.29cyclin T2 [Source:HGNC Symbol;Acc:HGNC:1600][more]
CCNT15.122e-1835.81cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599][more]
CCNT15.122e-1835.81cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599][more]
back to top
BLAST of Cyclin t1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cit-1.21.842e-1526.99Cyclin-T1.2 [Source:UniProtKB/Swiss-Prot;Acc:P344... [more]
cit-1.18.617e-1524.58Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P344... [more]
cit-1.18.911e-1524.58Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P344... [more]
cit-1.22.747e-830.93Cyclin-T1.2 [Source:UniProtKB/Swiss-Prot;Acc:P344... [more]
back to top
BLAST of Cyclin t1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CycT1.537e-3029.66gene:FBgn0025455 transcript:FBtr0333124[more]
CycT1.537e-3029.66gene:FBgn0025455 transcript:FBtr0075205[more]
CycK2.271e-924.09gene:FBgn0025674 transcript:FBtr0344022[more]
CycK2.271e-924.09gene:FBgn0025674 transcript:FBtr0085942[more]
CycK2.271e-924.09gene:FBgn0025674 transcript:FBtr0085941[more]
back to top
BLAST of Cyclin t1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnt2a1.686e-3133.48cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779][more]
ccnt2a2.952e-3133.48cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779][more]
ccnt12.333e-3033.48cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397][more]
ccnt2b3.121e-3033.03cyclin T2b [Source:ZFIN;Acc:ZDB-GENE-030131-183][more]
ccnt2b2.082e-2832.20cyclin T2b [Source:ZFIN;Acc:ZDB-GENE-030131-183][more]
back to top
BLAST of Cyclin t1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCNT23.293e-3133.03cyclin T2 [Source:NCBI gene;Acc:100488125][more]
CCNT28.868e-3133.03cyclin T2 [Source:NCBI gene;Acc:100488125][more]
CCNT14.972e-3032.58cyclin T1 [Source:NCBI gene;Acc:100170179][more]
CCNT16.015e-3032.58cyclin T1 [Source:NCBI gene;Acc:100170179][more]
CCNT27.697e-2329.50cyclin T2 [Source:NCBI gene;Acc:100488125][more]
back to top
BLAST of Cyclin t1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccnt21.523e-3133.78cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199][more]
Ccnt22.668e-3133.78cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199][more]
Ccnt18.026e-3133.94cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363][more]
Ccnt18.026e-3133.94cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363][more]
Ccnt11.575e-1734.67cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363][more]
back to top
BLAST of Cyclin t1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TQK0|CCNT2_MOUSE1.866e-3033.78Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 S... [more]
sp|Q8HXN7|CCNT1_PANTR1.875e-3034.39Cyclin-T1 OS=Pan troglodytes OX=9598 GN=CCNT1 PE=2... [more]
sp|O60563|CCNT1_HUMAN1.968e-3034.39Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV... [more]
sp|Q9XT26|CCNT1_HORSE2.355e-3034.39Cyclin-T1 OS=Equus caballus OX=9796 GN=CCNT1 PE=1 ... [more]
sp|Q9QWV9|CCNT1_MOUSE5.614e-3033.94Cyclin-T1 OS=Mus musculus OX=10090 GN=Ccnt1 PE=1 S... [more]
back to top
BLAST of Cyclin t1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SRN33.057e-5040.18Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3VT482.068e-4939.48Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3TRC35.957e-4940.18Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A068WQI06.315e-4839.06Cyclin t1 OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
A0A087VXE47.160e-4839.06Cyclin t1 OS=Echinococcus multilocularis OX=6211 G... [more]
back to top
BLAST of Cyclin t1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnt2a7.336e-3130.42cyclin T2 [Source:NCBI gene;Acc:103023729][more]
ccnt2a8.349e-3130.42cyclin T2 [Source:NCBI gene;Acc:103023729][more]
ccnt2b4.278e-3032.39cyclin-T2-like [Source:NCBI gene;Acc:103028284][more]
ccnt2b4.117e-2932.42cyclin-T2-like [Source:NCBI gene;Acc:103028284][more]
ccnt12.826e-2434.23cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397][more]
back to top
BLAST of Cyclin t1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003616.12.665e-3333.63pep scaffold:Pmarinus_7.0:GL476475:418210:425326:1... [more]
ENSPMAT00000007549.14.455e-1130.23pep scaffold:Pmarinus_7.0:GL483420:1071:10573:1 ge... [more]
ENSPMAT00000003411.16.742e-825.39pep scaffold:Pmarinus_7.0:GL483875:8648:11677:-1 g... [more]
back to top
BLAST of Cyclin t1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclin t1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO429052.208e-2931.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456446.246e-1422.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin t1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnt2a1.131e-3133.94cyclin T2 [Source:NCBI gene;Acc:101159477][more]
ccnt2a1.756e-3133.94cyclin T2 [Source:NCBI gene;Acc:101159477][more]
ccnt2b5.614e-3133.94cyclin-T2 [Source:NCBI gene;Acc:101157196][more]
ccnt12.164e-2230.37cyclin T1 [Source:NCBI gene;Acc:101175653][more]
ccnq4.394e-1123.01cyclin Q [Source:NCBI gene;Acc:101174665][more]
back to top
BLAST of Cyclin t1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066586.10.000e+098.71SMESG000066586.1[more]
SMESG000066586.10.000e+093.54SMESG000066586.1[more]
SMESG000066582.17.827e-3532.72SMESG000066582.1[more]
SMESG000066582.11.586e-2329.57SMESG000066582.1[more]
SMESG000004055.11.852e-1225.55SMESG000004055.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011777 ID=SMED30011777|Name=Cyclin t1|organism=Schmidtea mediterranea sexual|type=transcript|length=1353bp
TGTTTAAATATTAAGCTTGCTAATAGTAAGCAATGACTTCAGCTGATGAT
CCTATTACATTAGACTTAAAATATCGACAAATTTGTGCTACATTAATTCA
GGATTTAGGATTGGTGCATAATGTATCACAGTTATTAATTAATACCGCAA
TTGTTTATATGCACAAATTATATGAAAAGTTTTCATATAATGAATTAAAG
CCAGTTTATGTTGCAATGACTTCATTTTATTTGGCATCAAAATCAGAAGA
CTGTGCAAGAAAATTAAATGATATTGTTAAAACTATGTATCAGCTATCTG
GAAAACAAATCGATTCTAATTTTGAGCGTATAGTATCGGCAGTTCATGCA
CTGGAATCTATTATGCTTATGTCAGTTGGATTTCCACGATTGGATTTTGT
TCATCCACATATTGTTATAATGGATATAGTTAAAAAATATGATATTCATA
ATGGGTTTATTGATACAGCTTATTTTATTTGTACGTCGATGTTACATTTA
ACTACATTAAGCGTAAGACATAGCACCCAAGAAATTGCAGCAGCTGCACT
GTATGTAGCCTCTAAATGGGATTATATTGAATTAAAAGATATAAATTTAC
GTCCTTGGTTTTCTTCTATTTCATCTGGTCTTACTAATTCAATATTACAA
AAAATGAGTAAAGAATTTCTCGATATTTATGTGAAAACTCCCATAAAGTT
GAAGTTGAAAGCTTTTAATTTTTTAAGGAGATTTCATAACAAAGGAGAAT
CTCAAACTGTTAATAGTACGACCTCAATTCCAAAGTCTATACAAAAACCA
TTGATAGAAACTGCACCAGTAGAATCAGAAAAACAGGAGCCTCTCGAAGA
AGGTGAAATCGATCAATCGTCTGATGAAAAAGTAAGAAGTGAGAATTTAC
ATCAAAATCGTAAGTTATCGCTCCATCAATATTATCAACGAAAAGATGCT
CCCGAAACCAGCCATAAACCAAGCCCAATTAATAAGAATAATGATTTTCC
TAAAAGTTATTCTCATTCATCAAATAATTCATCCGATAAGAAGCGCAGAC
ATGAGCATTCGATAAGCACAACAAGTTTAAACAAATATACGAAGACTGAG
TTGAATAATCGAGTTGAATCTGAGAGCAAAGAATCGTCATATTACCAGAA
TCGTCAAGAGAAAGGAGCAACTCCAAATGATTATTATATGTTTTGATAAA
TTTTAAAAAATAAAATTGTTTATTTTTAATATAATGCTATTTAATACTCG
AATGTGATTTTAAGAATAATGTTATCCAAGTCTGCGTTTAAAGAAAAGAA
CTTTGTCGTACATTGTTGTTTAGGAAATAAAATTCCATTAGCTGAAAAAA
AAA
back to top

protein sequence of SMED30011777-orf-1

>SMED30011777-orf-1 ID=SMED30011777-orf-1|Name=SMED30011777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MTSADDPITLDLKYRQICATLIQDLGLVHNVSQLLINTAIVYMHKLYEKF
SYNELKPVYVAMTSFYLASKSEDCARKLNDIVKTMYQLSGKQIDSNFERI
VSAVHALESIMLMSVGFPRLDFVHPHIVIMDIVKKYDIHNGFIDTAYFIC
TSMLHLTTLSVRHSTQEIAAAALYVASKWDYIELKDINLRPWFSSISSGL
TNSILQKMSKEFLDIYVKTPIKLKLKAFNFLRRFHNKGESQTVNSTTSIP
KSIQKPLIETAPVESEKQEPLEEGEIDQSSDEKVRSENLHQNRKLSLHQY
YQRKDAPETSHKPSPINKNNDFPKSYSHSSNNSSDKKRRHEHSISTTSLN
KYTKTELNNRVESESKESSYYQNRQEKGATPNDYYMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000079regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0016538cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901protein kinase binding
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR043198Cyclin/Ssn8
IPR036915Cyclin-like_sf
IPR013763Cyclin-like
IPR006671Cyclin_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013763Cyclin-likeSMARTSM00385cyclin_7coord: 20..102
e-value: 0.095
score: 21.2
coord: 127..214
e-value: 0.27
score: 16.6
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 15..93
e-value: 1.59395E-8
score: 49.5445
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 124..213
e-value: 9.74798E-5
score: 38.7589
IPR006671Cyclin, N-terminalPFAMPF00134Cyclin_Ncoord: 10..85
e-value: 2.1E-8
score: 34.0
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 2..118
e-value: 2.0E-21
score: 78.3
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 123..234
e-value: 1.8E-20
score: 75.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..345
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 357..371
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..311
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 312..330
NoneNo IPR availablePANTHERPTHR10026:SF51CYCLIN-Tcoord: 7..369
IPR043198Cyclin/Cyclin-like subunit Ssn8PANTHERPTHR10026CYCLINcoord: 7..369
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 9..117
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 124..221