T-complex protein 1 subunit theta

Overview
NameT-complex protein 1 subunit theta
Smed IDSMED30011774
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein 1 subunit theta (SMED30011774) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein 1 subunit theta (SMED30011774) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011774

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30011774SMESG000009544.1 dd_Smed_v6_31121_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testisSMED30011774SMESG000009544.1 MF669571.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30011774SMESG000009544.1 MF669571.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30011774SMESG000009544.1 MF669571.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30011774SMESG000009544.1 MF669571.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30011774SMESG000009544.1 MF669571.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
reproductive organSMED30011774SMESG000009544.1 Contig38023newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011774SMESG000009544.1 Contig38023uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30011774SMESG000009544.1 Contig4315_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30011774SMESG000009544.1 PL08002A1A02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30011774SMESG000009544.1 PL08002A1A02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30011774SMESG000009544.1 PL08002A1A02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30011774SMESG000009544.1 SMED_06864_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011774SMESG000009544.1 SMED_06864_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Match: CCT8 (chaperonin containing TCP1 subunit 8 [Source:HGNC Symbol;Acc:HGNC:1623])

HSP 1 Score: 464.151 bits (1193), Expect = 1.408e-157
Identity = 259/544 (47.61%), Postives = 379/544 (69.67%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Match: CCT8 (chaperonin containing TCP1 subunit 8 [Source:HGNC Symbol;Acc:HGNC:1623])

HSP 1 Score: 434.491 bits (1116), Expect = 3.215e-146
Identity = 246/524 (46.95%), Postives = 362/524 (69.08%), Query Frame = 3
Query:  111 YFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            +F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    2 HFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 517          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Match: CCT8 (chaperonin containing TCP1 subunit 8 [Source:HGNC Symbol;Acc:HGNC:1623])

HSP 1 Score: 347.436 bits (890), Expect = 4.270e-113
Identity = 205/467 (43.90%), Postives = 315/467 (67.45%), Query Frame = 3
Query:  282 VAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            V HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    5 VQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 463          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Match: CCT8 (chaperonin containing TCP1 subunit 8 [Source:HGNC Symbol;Acc:HGNC:1623])

HSP 1 Score: 240.736 bits (613), Expect = 6.676e-74
Identity = 159/373 (42.63%), Postives = 224/373 (60.05%), Query Frame = 3
Query:   78 GYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVV 1178
            G+  MLK+GA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KIL                                              GT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+
Sbjct:    2 GFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKIL----------------------------------------------GTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVL 323          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Match: CCT4 (chaperonin containing TCP1 subunit 4 [Source:HGNC Symbol;Acc:HGNC:1617])

HSP 1 Score: 189.119 bits (479), Expect = 3.246e-52
Identity = 153/522 (29.31%), Postives = 264/522 (50.57%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-----EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAIN----AKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTD-----ELGKRVVVIFEQKGLK-------GNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            NI A KA+   + TS GP GM+KM+ +      +T D ATIL++++V HPAA+++V  ++ Q+ E G+GT  V+++  SLL+   +L++ G+    I+E ++ A +  ++ L  M    +++ ++E +      ++ SK+    QY S L      ++M+          D  +++IVK LGG + + +LV+G+V    TQ +    I     AK+ +        +T+    I+++  A++     EE   I   +K++ K       I+  I    + DL LH+ NK K++V+K   + D+  +    G              + HID+   D     EL + V +    K LK       G   +IVVRGS   +++EAER++ DA+   +CL K+ A++AGGGA EI+L+ +LTE +   S ++ Y +R F  + +++   L +N G+  I  VTEL  RH QG+K  G+        + N++E  +     V    +  A +   SILK+D V+  R
Sbjct:   37 NISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMS-RPVELSDRETLLNSATTSLNSKVVS--QYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVL---TQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGT-----------KPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGI--NVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Match: cct-8 (T-complex protein 1 subunit theta [Source:UniProtKB/Swiss-Prot;Acc:Q9N358])

HSP 1 Score: 423.705 bits (1088), Expect = 3.773e-142
Identity = 240/546 (43.96%), Postives = 361/546 (66.12%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVL-ENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKK-EFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA  IPK+ GY   +K+GA++F+G +E+V RNI AC  L   + +++GP GMNKMVINHIEK FVT DAATIL+ELE+ HPAA+I+++A + QE++ G+ TN V++L  +LLE A  LI MG++   +  GYE AA+  L+ L  +V+ E  D+ N E++ Q +   I SK  D++  ++ LVA  CV+        F+ DN+RI KI+G GV  S ++ GMVF R  +G ++EA +A++ +Y+CPFD+ QTETKGT+LI  A EL  FS  EE ++E ++K +   G+KVV++ GK GD+ LH+ NKYK++ +++ SKFDLRRL    GA   + +  P  + +GH D V   E+G   VV+F++K   G +A+I++RGS    +D+ ERAV+DA+NTYK LTK+  +LAG GA EI+L++++     K   L+QYAI++F  + + + KA+ +N GM   + +T+L+  H  G+K  G+   +   +  + +  NIFDLY+ +   IK A DAA +ILKVDQ+IM++ A G  KP+ P A +E+
Sbjct:    1 MAMKIPKS-GYNRFMKEGAQHFKGTDEAVQRNIEACTELASQIRSAYGPNGMNKMVINHIEKLFVTNDAATILKELEIQHPAARIIIMATEMQEKQIGDNTNTVVILAAALLEHAANLIHMGMTPQEVAAGYEQAAEKALEILPTLVVKEATDMKNIEEVRQYIRSAITSKQYDNEDIIADLVAKACVTTCPANSFNFNVDNIRICKIIGSGVHTSTVMNGMVFKRGAEGEIREARDARIAVYTCPFDLTQTETKGTVLIENADELRNFSKGEEAEVEEQVKAIADNGVKVVVAAGKFGDMYLHFLNKYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVAVQEIGDENVVVFDKKSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIELAKEIESFGAKAPGLEQYAIKKFAHALETLPKAIAENAGMPTTETLTKLYAEHVAGKKNAGIDIWKR--ETMDAVVNNIFDLYAGKRLAIKLATDAASTILKVDQIIMSKQATGGPKPRGPKAQDED 543          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Match: cct-8 (T-complex protein 1 subunit theta [Source:UniProtKB/Swiss-Prot;Acc:Q9N358])

HSP 1 Score: 306.22 bits (783), Expect = 3.725e-98
Identity = 173/419 (41.29%), Postives = 267/419 (63.72%), Query Frame = 3
Query:  432 ITEGYEVAAKFCLKQLKGMVL-ENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKK-EFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            +  GYE AA+  L+ L  +V+ E  D+ N E++ Q +   I SK  D++  ++ LVA  CV+        F+ DN+RI KI+G GV  S ++ GMVF R  +G ++EA +A++ +Y+CPFD+ QTETKGT+LI  A EL  FS  EE ++E ++K +   G+KVV++ GK GD+ LH+ NKYK++ +++ SKFDLRRL    GA   + +  P  + +GH D V   E+G   VV+F++K   G +A+I++RGS    +D+ ERAV+DA+NTYK LTK+  +LAG GA EI+L++++     K   L+QYAI++F  + + + KA+ +N GM   + +T+L+  H  G+K  G+   +   +  + +  NIFDLY+ +   IK A DAA +ILKVDQ+IM++ A G  KP+ P A +E+
Sbjct:    6 VAAGYEQAAEKALEILPTLVVKEATDMKNIEEVRQYIRSAITSKQYDNEDIIADLVAKACVTTCPANSFNFNVDNIRICKIIGSGVHTSTVMNGMVFKRGAEGEIREARDARIAVYTCPFDLTQTETKGTVLIENADELRNFSKGEEAEVEEQVKAIADNGVKVVVAAGKFGDMYLHFLNKYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVAVQEIGDENVVVFDKKSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIELAKEIESFGAKAPGLEQYAIKKFAHALETLPKAIAENAGMPTTETLTKLYAEHVAGKKNAGIDIWKR--ETMDAVVNNIFDLYAGKRLAIKLATDAASTILKVDQIIMSKQATGGPKPRGPKAQDED 422          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Match: cct-1 (T-complex protein 1 subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P41988])

HSP 1 Score: 172.94 bits (437), Expect = 1.029e-46
Identity = 153/525 (29.14%), Postives = 265/525 (50.48%), Query Frame = 3
Query:  141 RNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSK-IQDDDQYLSKLVADGCVSIMRE---KKEFDTDNMRIVKILGGGVINSQLVKGMVF-CR-DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHE------IGHIDRVYTDELGKRVVVIFEQKGLKGNIA-SIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ--------KFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI---MARPAGG 1643
            +N+ A  A+   V +S GP+G++KM+++ +    VT D ATIL++LEV HPA K++V  AQ Q++E G+GT  V+++   LL++A+EL++  +    I  GY +A K  +K +   +    D   ++ +      ++ SK I  D  +  +LV D   ++  E   K  +  + + ++K  G     S LVKG    C   +Q +     NAK+          +     ++++   A+L A   EE +  + +I +++K G  VV++ G + DL L    +   + ++   K DL+R++  TGAT+  +L      E      +GH D +  + +    +++   KG K   A SI++RG+ D +LDE ER+V D++   + + +   ++AGGGA E  LS  L   A   S  +Q A+ +F S+  ++ K L  N    + D VT+L   H++ Q        K+ GL    E   + +  EA I +    +   +KFA +AAI+IL++D +I      P GG
Sbjct:   24 QNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGYRLACKEAVKYISENISFTSDSIGRQSVVNAAKTSMSSKIIGPDADFFGELVVDAAEAVRVENNGKVTYPINAVNVLKAHGKSARESVLVKGYALNCTVASQAMPLRVQNAKIACLDFSLMKAKMHLGISVVVEDPAKLEAIRREEFDITKRRIDKILKAGANVVLTTGGIDDLCLKQFVESGAMAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQERISDDELILI--KGPKSRTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLFLETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTKLRAYHSKAQLIPQLQHLKWAGLDL--EEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLIKLDKQEPLGG 544          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 168.703 bits (426), Expect = 2.907e-45
Identity = 143/506 (28.26%), Postives = 261/506 (51.58%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDD-QYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIA-SIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQK----FDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            E+V  +I A +A+  T+ TS GP G++KM+++      +T D ATI+ +++V H  AK+MV  ++ Q+ E G+GT  V++L  +LLE+AE+LI+ G+  + I +G+++A K  L+ L   + +   V N+E++ +    ++ SKI +   +  +++  D  +S+   E K+ + + +++   +GG + ++ LVKG+V  +      + KE  NAKV I +CPF+  + +TK  + I +  +  A  + E E  E  I+++ + G  + I      D   H      L  ++     ++  L+  T A I+         ++G    V     G     +   +    N A +I VRG    ++DEA+RA+ DA+   + L +++ I+ GGG+ E+  + ++ +EA++   ++QYA R F  + + +  AL +N+G+  IDA+++L  +  +  K     D +  G    K   VIE     L S R   I  A      ILK+D V
Sbjct:   33 EAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDS-ISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIET----LLSKREQ-ISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 168.703 bits (426), Expect = 2.907e-45
Identity = 143/506 (28.26%), Postives = 261/506 (51.58%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDD-QYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIA-SIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQK----FDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            E+V  +I A +A+  T+ TS GP G++KM+++      +T D ATI+ +++V H  AK+MV  ++ Q+ E G+GT  V++L  +LLE+AE+LI+ G+  + I +G+++A K  L+ L   + +   V N+E++ +    ++ SKI +   +  +++  D  +S+   E K+ + + +++   +GG + ++ LVKG+V  +      + KE  NAKV I +CPF+  + +TK  + I +  +  A  + E E  E  I+++ + G  + I      D   H      L  ++     ++  L+  T A I+         ++G    V     G     +   +    N A +I VRG    ++DEA+RA+ DA+   + L +++ I+ GGG+ E+  + ++ +EA++   ++QYA R F  + + +  AL +N+G+  IDA+++L  +  +  K     D +  G    K   VIE     L S R   I  A      ILK+D V
Sbjct:   33 EAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDS-ISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIET----LLSKREQ-ISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Match: CCT8 (gene:FBgn0284436 transcript:FBtr0088683)

HSP 1 Score: 481.485 bits (1238), Expect = 1.085e-164
Identity = 259/546 (47.44%), Postives = 376/546 (68.86%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH-NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA  +PKAPG   MLKDGAR + GLEE+V RNI ACK   +T+ +++GP GMNKM+INHIEK+FVT DA TI+REL+V HPAAK++V+A+Q Q+ E G+GTN+V++L  +LLE AEEL+ +G++   I++GYE A +  L+ L  +V   I D  N EK+ +VL  +I SK    + +L+ LV+  CVSI+ ++  F+ DN+RI KILG G+  S++V+GMVF R  +G V  A  AK+VI+SCP DI+QTETKGT+LI +A EL +FS+ EE  +E +IK +   G+KVV++GGKVGD+ LH+ NKY L+ +++NSKFDLRRLS    AT++  +  P   E+G+ D+V  +ELG   +V F  +G    IA++V+RG+ D  +D+ ERA++DAIN +KCLT++   L G GATEI+L+ +L+  A+    L QYA+R+F ++ ++  KAL +N+G+   + V +L+  H N+  K  G     E A   +  +A +FDLY  + WG+K+A  AA +ILKVDQ+IMA+ AGG  K +Q    ++E
Sbjct:    1 MALSVPKAPGVSQMLKDGARMYSGLEEAVFRNISACKEFAQTMRSAYGPNGMNKMIINHIEKQFVTSDAGTIMRELDVEHPAAKLIVMASQMQDAEVGDGTNFVVVLAGALLESAEELLRLGITTAEISDGYEKALEKALEILPNLVSHKIEDYRNVEKVKEVLRTSIMSKQYGQEDFLNDLVSKACVSILPDEGTFNVDNIRICKILGSGLTKSEVVRGMVFKRFVEGDVTYAEKAKIVIFSCPVDIIQTETKGTVLIKSADELLSFSSGEESLLESQIKAIADAGVKVVVAGGKVGDMALHFLNKYGLMAVRLNSKFDLRRLSRSVNATVLPRITTPSQEELGYCDKVCIEELGDTTIVAFRNEGKDSRIATVVIRGATDNFMDDIERALDDAINNFKCLTRDGRYLPGAGATEIELATQLSAYADTLPGLDQYAVRKFANALEVFPKALAENSGINGTEIVNQLYLAHNNEAGKTIGFDIEAEKASTIDTTKAKLFDLYQSKFWGLKYAVGAAATILKVDQIIMAKRAGG-PKVRQAAGSDDE 545          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087987)

HSP 1 Score: 177.178 bits (448), Expect = 3.168e-48
Identity = 149/509 (29.27%), Postives = 270/509 (53.05%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLE-NIDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQK----FDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            +++  +I A + +  T+ TS GP G++K++++      VT D ATI++ +EV H  AK+MV  +Q Q+ E G+GT  V++L  +LLE+AE LI+ G+  + I +G+E+AA+  +KQL  +     +D  NKE + Q+   T+ SKI +   + ++++  D  +++   EKK+ + + ++I   +GG + +S LVKG++  +      + KE  N K+ I +CPF+  + +TK  + + +A +  A    E+E     +K++   G  + I      D   H   + +L  ++     ++  ++  TG  I+         ++G    V     G    +++VI E K  K    +I +RG    ++ EA+R++ DAI   + L K++ I+ GGGA EI  S  + +EA++ S L+QYA R F  + + +  AL +N+G+  I+ ++EL  R    +K     D ++ G+   K  NV+E+    L+S +   I  +      ILK+D V
Sbjct:   33 DAIKTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWGFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKA--VTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVES----LHSKKQQ-ILLSTQLVKMILKIDDV 534          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087988)

HSP 1 Score: 176.022 bits (445), Expect = 4.690e-48
Identity = 149/504 (29.56%), Postives = 267/504 (52.98%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLE-NIDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQK----FDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            +I A + +  T+ TS GP G++K++++      VT D ATI++ +EV H  AK+MV  +Q Q+ E G+GT  V++L  +LLE+AE LI+ G+  + I +G+E+AA+  +KQL  +     +D  NKE + Q+   T+ SKI +   + ++++  D  +++   EKK+ + + ++I   +GG + +S LVKG++  +      + KE  N K+ I +CPF+  + +TK  + + +A +  A    E+E     +K++   G  + I      D   H   + +L  ++     ++  ++  TG  I+         ++G    V     G    +++VI E K  K    +I +RG    ++ EA+R++ DAI   + L K++ I+ GGGA EI  S  + +EA++ S L+QYA R F  + + +  AL +N+G+  I+ ++EL  R    +K     D ++ G+   K  NV+E+    L+S +   I  +      ILK+D V
Sbjct:    8 HIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWGFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKA--VTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVES----LHSKKQQ-ILLSTQLVKMILKIDDV 504          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Match: CCT4 (gene:FBgn0032444 transcript:FBtr0080411)

HSP 1 Score: 169.088 bits (427), Expect = 2.332e-45
Identity = 143/532 (26.88%), Postives = 253/532 (47.56%), Query Frame = 3
Query:   66 PKAPGYYSMLKDGARYFQGLEESV---VRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSK-IQDDDQYLSKLVADGCVSIMREKKEFDTD--NMRIVKILGGGVINSQLVKGMVF-CRDTQGIVKEAI-NAKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI 1622
            PKA      +K  A+ F+   +     + NI A KA+   + TS GP GM+KM+     +  +T D ATIL+++ V HPAAK++V  ++ Q+   G+GT  V+++  +LLE  E+L++ GL    I++ ++  +   ++ LK M    I++ ++E + +    ++ SK +      L+ +  D  + +    KE   D  N++++  LGG V +++LV G+VF CR       + I  AK+ +        +T+    ++++  A +        S       ++K        ++  I    V DL  H+ +K K +V+K   + D+  +        +++L    A  +   D V     G    V        G   SI+ RGS   +L+EA R++ DA+   +CL K  A + GGGA EI+++ +L   A     +  Y  R F  + +++   L +N G+  I  VTEL  RH QG+K  G+   + A  + ++   N+     V    I  A +   SILK+D ++
Sbjct:    3 PKAAAVN--IKPTAKAFKDKSKPTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMSTP-IELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTNKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGA--ITDIFAENVVQPLLVSISSITLATETIRSILKIDDIV 529          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 166.392 bits (420), Expect = 2.838e-44
Identity = 155/526 (29.47%), Postives = 258/526 (49.05%), Query Frame = 3
Query:  141 RNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSK-IQDDDQYLSKLVADGCVSI----MREKKEFDTDNMRIVKILGGGVINSQLVKGMVF-CR-DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNL------------IVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGN-IASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ--------KFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARP 1634
            +N+ A  ++   V +S GP+G++KM+++ I    VT D ATILR LEV HPAAK++V  AQ Q++E G+GT  V++L   LL+ A+EL++  +   +I  GY +A K   K +   +   +D   ++ +  +   ++ SK I  D ++ S +V D   S+     R +  +    + ++K  G     S L+ G    C   +Q + K+ +NAK+          + +    +LIN   +L A    E +  + +I  ++  G+ VV+  G V DL + Y  +   + ++   K DL+ ++  TGA  +++L            +V  A E+   +R+  DEL    ++I   KG K    ASI++RG  D   DE ER+V DA+   K + +   ++AGGG  E  LS  L   A   +  +Q AI +F  S  ++ K L  N    A D V +L   HN  Q        K+ GL   E   +     +A + +    +   +KFA +AAI+IL++D +I   P
Sbjct:   23 QNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQ-ERICDDEL----ILI---KGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNK--KAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNP 538          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Match: cct8 (chaperonin containing TCP1, subunit 8 (theta) [Source:ZFIN;Acc:ZDB-GENE-040426-876])

HSP 1 Score: 476.093 bits (1224), Expect = 2.947e-162
Identity = 255/540 (47.22%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            MA H+PKAPG+  MLKDGA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE+A K  L+ L   V  +  ++ + E+   ++   + SK   ++ +L+ L+A  CVSI  E   F+ DN+R+ KILG G+ +S ++ GMVF ++ +G V    +AK+ ++SCPFD   TETKGT+LI  A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKYKL+V+++NSK+DLRRL    GAT +  L  P   E+G  D VY  E+G   VV+F+     G I+++V+RGS D L+D+ ERA++D +NT+K L ++  +  G GATEI+L++ +T     C  L+QYAI+++  +F+ + +AL +N+G+K  + +++L+  H++G K  G     E   + +++EA I D Y V++WGIK A +AAI++L+VDQ+IMA+PAGG   PKQ G
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEMACKKALEILPDCVCSSAKNLHDLEEATAMIRSAVMSKQYGNEDFLANLIAQACVSIFPESGSFNVDNVRVCKILGCGLNSSTMLHGMVFKKEAEGDVTSVKDAKIAVFSCPFDCTVTETKGTVLIKNADELMNFSKGEEDLMEAQVKAIADSGASVVVTGGKVADMALHYANKYKLMVVRLNSKWDLRRLCKTVGATALPRLTSPTPEEMGRCDSVYLSEVGDTQVVVFKHDKEDGAISTLVIRGSTDNLMDDIERAIDDGVNTFKVLVRDARLCPGAGATEIELAKHITSYGESCPGLEQYAIKKYAEAFEALPRALAENSGVKGNELISKLYATHHEGNKNSGFDIEGEGPAVRDMMEAGILDPYLVKYWGIKLATNAAITVLRVDQIIMAKPAGGPKAPKQQG 540          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Match: cct8 (chaperonin containing TCP1, subunit 8 (theta) [Source:ZFIN;Acc:ZDB-GENE-040426-876])

HSP 1 Score: 472.241 bits (1214), Expect = 6.826e-161
Identity = 254/539 (47.12%), Postives = 371/539 (68.83%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLKDGA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE+A K  L+ L   V  +  ++ + E+   ++   + SK   ++ +L+ L+A  CVSI  E   F+ DN+R+ KILG G+ +S ++ GMVF ++ +G V    +AK+ ++SCPFD   TETKGT+LI  A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKYKL+V+++NSK+DLRRL    GAT +  L  P   E+G  D VY  E+G   VV+F+     G I+++V+RGS D L+D+ ERA++D +NT+K L ++  +  G GATEI+L++ +T     C  L+QYAI+++  +F+ + +AL +N+G+K  + +++L+  H++G K  G     E   + +++EA I D Y V++WGIK A +AAI++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEMACKKALEILPDCVCSSAKNLHDLEEATAMIRSAVMSKQYGNEDFLANLIAQACVSIFPESGSFNVDNVRVCKILGCGLNSSTMLHGMVFKKEAEGDVTSVKDAKIAVFSCPFDCTVTETKGTVLIKNADELMNFSKGEEDLMEAQVKAIADSGASVVVTGGKVADMALHYANKYKLMVVRLNSKWDLRRLCKTVGATALPRLTSPTPEEMGRCDSVYLSEVGDTQVVVFKHDKEDGAISTLVIRGSTDNLMDDIERAIDDGVNTFKVLVRDARLCPGAGATEIELAKHITSYGESCPGLEQYAIKKYAEAFEALPRALAENSGVKGNELISKLYATHHEGNKNSGFDIEGEGPAVRDMMEAGILDPYLVKYWGIKLATNAAITVLRVDQIIMAKPAGG---PKAP 536          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 176.407 bits (446), Expect = 6.853e-48
Identity = 147/552 (26.63%), Postives = 270/552 (48.91%), Query Frame = 3
Query:   63 IPKAPGYYSMLKD-GARYFQGLEESVVR--NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKI-QDDDQYLSKLVADGCVSIMREKKEFDTD--NMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAIN----AKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGN--------------IASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            +P+A    S +K+ G+ Y    + + +R  NI+A KA+   + TS GP GM+KM+ +      +T D ATIL++++V HPAAK+MV  ++ Q+ E G+GT  V+++  +LL+   +L++ G+    I+E ++ A    ++ L  +    + + ++E +      ++ SK+   +   L+ +  D  + ++        D  ++ +VK LGG + + +LV GMV    TQ +    ++    AK+ +        +T+    I+++  A++        +       ++K        I+  I    + DL LH+ NK K++V+K   + ++  +    G              I HID+   + LG   +V  E+  L G+                SIVVRGS   +++EAER++ DA+   +CL K+ A++AGGGA EI+L+ +L E A     ++ Y +R +  + +++   L +N G+  I  VTEL  RH QG+   G+        + N++E  +     V    +  A +   SILK+D ++  R
Sbjct:    1 MPEAVVAASGIKNKGSAYVDRDKPAQIRYSNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPLL-LSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKVIDPATATSVDLRDINVVKKLGGTIDDCELVDGMVL---TQRVASTGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGT-----------KPIAHIDQFTPEMLGSAELV--EEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGETTAGI--NVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDLVNTR 533          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 171.785 bits (434), Expect = 3.382e-46
Identity = 147/540 (27.22%), Postives = 276/540 (51.11%), Query Frame = 3
Query:   96 KDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLE-NIDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRD--TQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQR----HNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNE 1679
            +D      GLE ++  +I A KA+  T+ TS GP G++KM+++   +  VT D ATIL  ++V H  AK+MV  ++ Q+ E G+GT  V++L  +LLE+AE+L++ G+  + I +GY+ AAK  ++QL  +     +D  N E + Q    T+ SK+ +   + ++++  +  +++   E+K+ D + +++   +GG + ++QL+KG++  ++     + K   + K+ I +CPF+  + +TK  + + +  +  A    E++  +  I+++ + G  + I      D   H   + +L  ++     ++  ++  TG  I+         ++G    V     G    R++VI E K  +    +I +RG    +++EA+RA+ DA+   + L ++N I+ GGGA+EI  +  + E A+KC  L+QYA+R F  + +++  AL +N+G+  I  +TE+  R    +N     D L       K  +VIE  I      +   I  A      ILK+D +            + PG P +
Sbjct:   22 QDKKSRLTGLE-ALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEECKNSRA--VTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLSTNDMKQQHVIETLIG-----KKQQISLATQVVKMILKIDDI------------RGPGEPED 541          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 164.851 bits (416), Expect = 1.334e-43
Identity = 149/527 (28.27%), Postives = 265/527 (50.28%), Query Frame = 3
Query:  141 RNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQD-DDQYLSKLVADGCVSIM----REKKEFDTDNMRIVKILGGGVINSQLVKGMVF-CR-DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNL------------IVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ--------KFDG--LVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARP 1634
            +N+ A  ++   V +S GP+G++KM+++ I    +T D ATIL+ LEV HPAAK++   A+ Q++E G+GT  V+++   LL+ A+EL++  +   +I  GY +A K  ++ +   +    D   +E +      ++ SKI   D ++ + +V D  V++     +    +  +++ ++K  G     S LV G    C   +QG+VK   NAK+          + +    ++IN   +L      E +  + ++++++  G  VV++ G + D+ L Y      + ++   K DL+R++  TGAT+ S+L            ++  A E+   +RV  DEL    ++I   K      ASI++RG+ D + DE ER++ DA+   K + +  +++ GGGA E  LS  L   A      +Q AI +F  S  ++ K L  N    + D V +L   HN+ Q        K+ G  LV G    K  +  +A +++   V+   +KFA +AAI+IL++D +I   P
Sbjct:   21 QNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQ-ERVCDDEL----ILIKNTKARTS--ASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNG----KPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFP 536          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:493260])

HSP 1 Score: 488.419 bits (1256), Expect = 4.525e-167
Identity = 260/540 (48.15%), Postives = 382/540 (70.74%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            MA H+PKAPG+  MLK+GA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATI+RELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L  +V  +  ++ + +++  +L  +I SK   ++ +LSKL+A  CVSI+ E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    +AK+ IYSCPFD + TETKGT+LIN+A EL  FS  EE  +E ++K + + G  V+++GGKV D+ LHYANKY L+V+++NSK+DLRRL      T +  L  P A E+G  D VY  E+G   VV+F+ +   G IA++V+RGS D L+D+ ERAV+DA+NT+K LT++  ++ GGGATE++L++++T     C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     E+A + +++E+NI D Y  ++WGIK A +AAI++L+VDQ+IMA+ AGG   PKQ G
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATIIRELEVQHPAAKMVVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEKACKKALEILPDLVCSSAKNLRDIDEVASLLQTSIMSKQYGNELFLSKLIAQACVSILPESGHFNVDNIRVCKILGSGICASSVLHGMVFKKEAEGNISSVKDAKIAIYSCPFDGMITETKGTVLINSAQELMNFSKGEENLMEEQVKAIAEAGATVLVTGGKVADMALHYANKYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDTQVVVFKHEKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTRDKRLVPGGGATEVELAKQITSYGETCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAESAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKAAGGPRAPKQQG 540          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:493260])

HSP 1 Score: 460.685 bits (1184), Expect = 1.937e-156
Identity = 252/539 (46.75%), Postives = 372/539 (69.02%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATI+RELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L  +V  +  ++ + +++  +L  +I SK   ++ +LSKL+A  CVSI+ E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    +AK+ IYSCPFD + TETKGT+LIN+A EL  FS  EE  +E ++K + + G  V+++GGKV D+ LHYANKY L+V+++NSK+DLRRL      T +  L  P A E+G  D VY  E+G   VV+F+ +   G IA++V+RGS D L+D+ ERAV+DA+NT+K LT+          +++  +    ++ + C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     E+A + +++E+NI D Y  ++WGIK A +AAI++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATIIRELEVQHPAAKMVVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEKACKKALEILPDLVCSSAKNLRDIDEVASLLQTSIMSKQYGNELFLSKLIAQACVSILPESGHFNVDNIRVCKILGSGICASSVLHGMVFKKEAEGNISSVKDAKIAIYSCPFDGMITETKGTVLINSAQELMNFSKGEENLMEEQVKAIAEAGATVLVTGGKVADMALHYANKYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDTQVVVFKHEKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTR---------VSDVSSALAAHKQYSTCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAESAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKPAGG---PKAP 527          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:493260])

HSP 1 Score: 457.988 bits (1177), Expect = 4.397e-155
Identity = 256/547 (46.80%), Postives = 374/547 (68.37%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEAN--------KCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATI+RELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L  +V  +  ++ + +++  +L  +I SK   ++ +LSKL+A  CVSI+ E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    +AK+ IYSCPFD + TETKGT+LIN+A EL  FS  EE  +E ++K + + G  V+++GGKV D+ LHYANKY L+V+++NSK+DLRRL      T +  L  P A E+G  D VY  E+G   VV+F+ +   G IA++V+RGS D L+D+ ERAV+DA+NT+K LT+ + + +   A +  L  +  E  N         C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     E+A + +++E+NI D Y  ++WGIK A +AAI++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATIIRELEVQHPAAKMVVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEKACKKALEILPDLVCSSAKNLRDIDEVASLLQTSIMSKQYGNELFLSKLIAQACVSILPESGHFNVDNIRVCKILGSGICASSVLHGMVFKKEAEGNISSVKDAKIAIYSCPFDGMITETKGTVLINSAQELMNFSKGEENLMEEQVKAIAEAGATVLVTGGKVADMALHYANKYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDTQVVVFKHEKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTRVSDVSSALAAHKHALCLE-AEPLNLSPVCSLQTCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAESAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKPAGG---PKAP 543          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:493260])

HSP 1 Score: 449.129 bits (1154), Expect = 7.605e-152
Identity = 248/539 (46.01%), Postives = 367/539 (68.09%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATI+RELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L  +V  +  ++ + +++  +L  +I SK   ++ +LSKL+A  C   M +                  +  S ++ GMVF ++ +G +    +AK+ IYSCPFD + TETKGT+LIN+A EL  FS  EE  +E ++K + + G  V+++GGKV D+ LHYANKY L+V+++NSK+DLRRL      T +  L  P A E+G  D VY  E+G   VV+F+ +   G IA++V+RGS D L+D+ ERAV+DA+NT+K LT++  ++ GGGATE++L++++T     C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     E+A + +++E+NI D Y  ++WGIK A +AAI++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATIIRELEVQHPAAKMVVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEKACKKALEILPDLVCSSAKNLRDIDEVASLLQTSIMSKQYGNELFLSKLIAQACGKYMSQG-------------FTVCICASSVLHGMVFKKEAEGNISSVKDAKIAIYSCPFDGMITETKGTVLINSAQELMNFSKGEENLMEEQVKAIAEAGATVLVTGGKVADMALHYANKYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDTQVVVFKHEKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTRDKRLVPGGGATEVELAKQITSYGETCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAESAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKPAGG---PKAP 523          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:493260])

HSP 1 Score: 373.629 bits (958), Expect = 2.762e-123
Identity = 208/462 (45.02%), Postives = 318/462 (68.83%), Query Frame = 3
Query:  282 VAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            V HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L  +V  +  ++ + +++  +L  +I SK   ++ +LSKL+A  CVSI+ E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    +AK+ IYSCPFD + TETKGT+LIN+A EL  FS  EE  +E ++K + + G  V+++GGKV D+ LHYANKY L+V+++NSK+DLRRL      T +  L  P A E+G  D VY  E+G   VV+F+ +   G IA++V+RGS D L+D+ ERAV+DA+NT+K LT++  ++ GGGATE++L++++T     C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     E+A + +++E+NI D Y  ++WGIK A +AAI++L+VDQ+IMA+PAGG   PK P
Sbjct:    5 VQHPAAKMVVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEKACKKALEILPDLVCSSAKNLRDIDEVASLLQTSIMSKQYGNELFLSKLIAQACVSILPESGHFNVDNIRVCKILGSGICASSVLHGMVFKKEAEGNISSVKDAKIAIYSCPFDGMITETKGTVLINSAQELMNFSKGEENLMEEQVKAIAEAGATVLVTGGKVADMALHYANKYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDTQVVVFKHEKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTRDKRLVPGGGATEVELAKQITSYGETCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAESAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKPAGG---PKAP 463          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Match: Cct8 (chaperonin containing Tcp1, subunit 8 (theta) [Source:MGI Symbol;Acc:MGI:107183])

HSP 1 Score: 476.863 bits (1226), Expect = 9.108e-163
Identity = 257/544 (47.24%), Postives = 377/544 (69.30%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLKDGA++F GLEE+V RNI ACK L +T  T++GP GMNKMVIN +EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  +  GYE+A K   + L  +V      L ++D     ++  +L  +I SK    + +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  V+++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA+I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVISGYEIACKKAHEILPELVCCSAKNLRDVD-----EVSSLLRTSIMSKQYGSETFLAKLIAQACVSIFPDSGNFNVDNIRVCKILGSGIYSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Match: Cct8 (chaperonin containing Tcp1, subunit 8 (theta) [Source:MGI Symbol;Acc:MGI:107183])

HSP 1 Score: 371.703 bits (953), Expect = 2.078e-122
Identity = 227/538 (42.19%), Postives = 333/538 (61.90%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLKDGA++F GLEE+V RNI ACK L +T  T++GP GMNKMVIN +EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+      +  +  F           N+D     ++ ++L   I           S  V  G V   +++ E D  +++  KI     + S    GM+                            TETKGT+LI TA EL  FS  EE  ++ ++K +   G  V+++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA+I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEAISIFPDSGNF-----------NVDNI---RVCKILGSGI----------YSSSVLHGMV--FKKETEGDVTSVKDAKI----AVYSCPFDGMI----------------------------TETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 477          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Match: Cct8 (chaperonin containing Tcp1, subunit 8 (theta) [Source:MGI Symbol;Acc:MGI:107183])

HSP 1 Score: 196.823 bits (499), Expect = 1.823e-58
Identity = 106/238 (44.54%), Postives = 163/238 (68.49%), Query Frame = 3
Query:  774 SCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGL 1487
            SCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  V+++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T          +YAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL
Sbjct:    2 SCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQIT-------SYGEYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGL 232          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 191.045 bits (484), Expect = 3.644e-53
Identity = 152/522 (29.12%), Postives = 262/522 (50.19%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-----EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAIN----AKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVV----------IFEQKGL--KGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            NI A KA+   + TS GP GM+KM+ +      +T D ATIL++++V HPAA+++V  ++ Q+ E G+GT  V+++  SLL+   +L++ G+    I+E ++ A +  L+ L  M    + + ++E +      ++ SK+    QY S L      ++M+          D  +++IVK LGG + + +LV+G+V    TQ +    I     AK+ +        +T+    I+++  A++     EE   I   +K++ K       I+  I    + DL LH+ NK K++V+K   + D+  +    G              + HID+   D LG   +           +F+  G    G   +IVVRGS   +++EAER++ DA+   +CL K+ A++AGGGA EI+L+ +LTE +   S ++ Y +R F  + +++   L +N G+  I  VTEL  RH QG+K  G+        + N++E  +     V    +  A +   SILK+D V+  R
Sbjct:   37 NISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMS-RPVQLSDRETLLNSATTSLNSKVVS--QYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVL---TQKVANSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGT-----------KPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGI--NVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Match: Cct8l1 (chaperonin containing TCP1, subunit 8 (theta)-like 1 [Source:MGI Symbol;Acc:MGI:2685289])

HSP 1 Score: 176.792 bits (447), Expect = 8.055e-48
Identity = 138/512 (26.95%), Postives = 239/512 (46.68%), Query Frame = 3
Query:  117 QGLEES-VVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAI-NAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKF-----DGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            QG E S ++R   A + L   + + +GP G  K ++    +   T  AA IL+ L++ HPAA+ +   AQ Q +  G+GT +V+LL  +LLE+A  L+  GL+   + E +  A    L  L  + + ++     E     L+  I +    +  YL+KLVA  C         F  +++ +  + GG + +S++  G+       G   E + +A+V +++CPF      T  T  ++   EL  F  + E+  +   +  +      V+ G      V   AN   ++V++  S+ ++  LS   G  ++  ++ P   E G   +VY  E G   VV+FE +       S+V+RG     L  AE+AV   I+ +  L ++  +L G GATE+ L++ L ++ ++ S     A + F  +   + K L +N G+ A   + EL   H  G  F     DGLV         NV    I+D+   +  G++  A+    ++ VDQ+I+AR
Sbjct:   35 QGEEPSYILRATAAAQTLASIIRSCYGPFGRQKFLVTAKGETVCTGHAAAILKALDLEHPAAQFVQELAQTQVENAGDGTVFVVLLTEALLEQAHYLLWAGLTPTQLREAFATATAEVLTALPSLAIRSLGPL--EDPSWALYSVISTHTLSNSDYLTKLVAQACWVSREPNGSFKPESIVVCVLQGGKLTDSRIFPGVAIAGKLCGQKTEVLGDARVALFNCPFGPTNPFTLATPRLSNPEELLRFRKQTEQVEKEIAQLAIMDINVAVVLGEVNEKSV-DQANYCGIMVIQAKSRKEIVYLSEKLGTPLLGRVLPPL--EPGKCHKVYRKEFGDTAVVMFEWEHEIAPFLSVVLRGPTIQGLRVAEQAVYYGIDAFSQLCQDPRLLPGAGATEMALAKMLVDKGSRLSGPNGLAFQAFAQALSSLPKTLAENAGLAAQSVMAELSGFHQAGNFFVGVGTDGLV---------NVTHEGIWDILRTKAQGLQAVAELVQQLVTVDQIIVAR 532          
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Match: sp|Q6EE31|TCPQ_CHICK (T-complex protein 1 subunit theta OS=Gallus gallus OX=9031 GN=CCT8 PE=1 SV=3)

HSP 1 Score: 498.819 bits (1283), Expect = 2.034e-170
Identity = 261/544 (47.98%), Postives = 379/544 (69.67%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++    LLE AE+L+ MGLS+  + EGYE A K  L+ L  +V      L ++D     ++  +LH ++ SK   ++ +LSKL+A  CVSI+ +   F+ DN+R+ KI+G GV  S ++ GMVF ++T+G V    +AK  +YSCPFD + TETKGT+LI  A EL  FS  EE  ++L++K +   G  VV++GGKV D+ LHYANKY L+++++NSK+DLRRL    GAT +  L  P   E+GH + VY  E+G   VV+F+ +   G I++I++RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  G     EAA + +++EA I D Y  ++WGIK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHYSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMLVMASHMQEQEVGDGTNFVLVFAGVLLELAEDLLRMGLSVSEVIEGYEKACKKALEILPDLVCCSAKNLRDVD-----EVASLLHTSVMSKQYGNESFLSKLIAQACVSILPDSGHFNVDNIRVCKIVGAGVSASSVLHGMVFNKETEGDVTSVKDAKXAVYSCPFDGMITETKGTVLIKNAEELMNFSKGEENLMDLQVKAIADSGANVVVTGGKVADMALHYANKYNLMIVRLNSKWDLRRLCKTVGATALPRLTPPTLEEMGHCNSVYLSEVGDTQVVVFKHEKEDGAISTILIRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLDQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGFDIEAEAAAVKDMLEAGILDTYLGKYWGIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Match: sp|P42932|TCPQ_MOUSE (T-complex protein 1 subunit theta OS=Mus musculus OX=10090 GN=Cct8 PE=1 SV=3)

HSP 1 Score: 476.863 bits (1226), Expect = 6.371e-162
Identity = 257/544 (47.24%), Postives = 377/544 (69.30%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLKDGA++F GLEE+V RNI ACK L +T  T++GP GMNKMVIN +EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  +  GYE+A K   + L  +V      L ++D     ++  +L  +I SK    + +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  V+++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA+I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVISGYEIACKKAHEILPELVCCSAKNLRDVD-----EVSSLLRTSIMSKQYGSETFLAKLIAQACVSIFPDSGNFNVDNIRVCKILGSGIYSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Match: sp|Q3ZCI9|TCPQ_BOVIN (T-complex protein 1 subunit theta OS=Bos taurus OX=9913 GN=CCT8 PE=1 SV=3)

HSP 1 Score: 473.781 bits (1218), Expect = 1.117e-160
Identity = 257/544 (47.24%), Postives = 380/544 (69.85%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A K   + L  +V      L ++D     ++  +LH ++ SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG GV +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI +A EL  FS  EE  ++ ++K +   G  VV++GG+V D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA + D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRLGLSVSEVIEGYEIACKKAHEILPDLVCCSAKNLRDVD-----EVSSLLHTSVMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGVHSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKSAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGRVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLNPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGVLDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Match: sp|Q5RAP1|TCPQ_PONAB (T-complex protein 1 subunit theta OS=Pongo abelii OX=9601 GN=CCT8 PE=2 SV=3)

HSP 1 Score: 464.151 bits (1193), Expect = 6.762e-157
Identity = 259/544 (47.61%), Postives = 379/544 (69.67%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Match: sp|P50990|TCPQ_HUMAN (T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4)

HSP 1 Score: 464.151 bits (1193), Expect = 6.762e-157
Identity = 259/544 (47.61%), Postives = 379/544 (69.67%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMV------LENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            MA H+PKAPG+  MLK+GA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ +GLS+  + EGYE+A +   + L  +V      L +ID     ++  +L  +I SK   ++ +L+KL+A  CVSI  +   F+ DN+R+ KILG G+ +S ++ GMVF ++T+G V    +AK+ +YSCPFD + TETKGT+LI TA EL  FS  EE  ++ ++K +   G  VV++GGKV D+ LHYANKY ++++++NSK+DLRRL    GAT +  L  P   E+GH D VY  E+G   VV+F+ +   G I++IV+RGS D L+D+ ERAV+D +NT+K LT++  ++ GGGATEI+L++++T     C  L+QYAI++F  +F+ + +AL +N+G+KA + +++L+  H +G K  GL    E   + +++EA I D Y  ++W IK A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    1 MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDID-----EVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGG---PKPP 536          
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Match: A0A183B1P8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13133 PE=3 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 1.573e-179
Identity = 275/548 (50.18%), Postives = 399/548 (72.81%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVC---GEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA H+PKAPG  SMLKDGARYF+GLEE+V RNI AC AL KT  T+ GP G NK+VINHI K+F+T DAATIL+ELEVAHPAAK++V+A+QQQEQE G+GTN V  L  SLLE+A +L+ MGLS+  +TEGYE+  +  ++ L  +V+E++ D+ N + + +V+  +I SK  +   +LS L+   C+SI+ +K  F+ DN+R++K+LG GV +S++V+GMVF R+T+G VKEA + K+ I+SCP D +QTETKGT+L+ TA ELT FS  EE  +E  ++ +   G++VV+SGGKVG+L LHYANK  L+V++++SKFD+RRL   TGA  +  L  P   E+GH+  V TDE+    VVIFEQ    G++ +I+VRGS + ++D+ ERA++D +NT+KCLT+   ++AG GATEI+L+++L   A+  + L+QY++R+F  +F++VV+AL +N G KA + +  L+ +H  GQ   GL+    GE   ++ + ++  I D++ V+ W I+FA DAA ++L+VDQ+IMARPAGG  KP+QPGAP+E+
Sbjct:    1 MAMHVPKAPGLMSMLKDGARYFEGLEEAVFRNIEACLALSKTTRTTLGPAGQNKIVINHIGKQFITNDAATILKELEVAHPAAKLLVMASQQQEQEAGDGTNIVFQLAGSLLEQARDLLRMGLSVAQVTEGYELGREKAMEILDDLVVESVSDLRNHDSVRRVIKTSIMSKQVELADFLSDLITKACISILPQKSHFNVDNVRVLKVLGAGVSSSKIVRGMVFRRETEGEVKEAKDCKIAIFSCPIDTLQTETKGTVLLTTADELTQFSKGEENLMEKHMRAIADAGVRVVVSGGKVGELALHYANKLGLMVVRLSSKFDIRRLCQATGAVALPRLTTPSPEELGHVAHVRTDEVADASVVIFEQ----GSVVTILVRGSTENIMDDVERAIDDGVNTFKCLTRSPKLVAGAGATEIELARRLLAYADTLTGLEQYSVREFARAFEVVVRALAENAGEKATEIIAMLYAKHLSGQVHTGLITKPGGE--VEVNDAVKFEILDIHMVKRWAIRFATDAACTVLRVDQIIMARPAGG-PKPRQPGAPDED 541          
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Match: A0A1S3HX70 (T-complex protein 1 subunit theta OS=Lingula unguis OX=7574 GN=LOC106159013 PE=3 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 5.003e-179
Identity = 272/532 (51.13%), Postives = 391/532 (73.50%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGG 1643
            MA HIPK PG+  MLK+GAR++ GLEE+V RNI AC  L KT  +++GP G NKMVINH+EK FVT DAATILRELEV HPAAK++VLA+QQQEQECG+GTN+V++   +LLE AEEL+++GLS+  + EGYE+A +  L+ +  +V+ ++ D+ NK ++ + +  ++ SK   ++ +L+ L+AD C+S+M+ K  F  DN+R+ KILG G+ +S +V GMVF R+ +G V +A +AKV ++SCP DI+QTETKGT+LI TA EL  F+  EE  IE +IK + + G KV++SGGKVG+L LHYANKYK++V+++ SK+DLRRL    GAT +  L  P A E GH D VY DE+G+  VVIF+Q   +  +++IV+RGS D ++D+ ERA++D +NTYK LTK++ +L G GATEI+L+++LT     C  L+QYAI++F  + ++V KAL +NTG+K  + +++L+  H +G K  G   G E A + + +EANI DLY+ ++WG+KFA +AA ++LKVDQ+IMA+ AGG
Sbjct:    1 MAMHIPKPPGFAQMLKEGARHYSGLEEAVYRNIEACGELAKTTRSAYGPHGQNKMVINHLEKLFVTNDAATILRELEVQHPAAKMLVLASQQQEQECGDGTNFVLVFAGALLESAEELLKLGLSVTEVVEGYELACQKALEIIPDLVVGSVKDMKNKSEVIKAIRTSVMSKQYGNEDFLADLIADACISVMKNKLSFSVDNIRVCKILGSGIHSSSVVSGMVFKREAEGEVTKASDAKVAVFSCPLDIIQTETKGTVLIKTAKELMDFNKGEENQIEEQIKAIAETGCKVIVSGGKVGELALHYANKYKMMVVRLLSKWDLRRLCRAIGATPLPRLTAPTAEEAGHCDHVYIDEIGETPVVIFKQDTAESTVSTIVIRGSTDNIMDDIERAIDDGVNTYKALTKDDRLLPGAGATEIELAKQLTSYGETCPGLEQYAIKKFAEALEVVPKALSENTGVKGTEVISKLYAAHQEGGKNMGFDIGGEGAAIRDALEANILDLYTTKYWGLKFATNAANTVLKVDQIIMAKAAGG 532          
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Match: A0A4E0RZX0 (T-complex protein subunit theta OS=Fasciola hepatica OX=6192 GN=D915_004022 PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 2.369e-173
Identity = 275/548 (50.18%), Postives = 394/548 (71.90%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVC---GEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA H+PKAPG+ SMLKDGARYF+GLEE+V RNI AC AL KT  ++ GP G NK+VINHI K+F+T DAATIL+ELEVAHPAAKI+V+A+QQQEQE G+GTN V  L  SLLE+A +L+ M + + +    Y          +  +V+E+I D+ N E + +V+  +I SK  +   +LS L+   C+SI+ +K  F+ DN+R++K+LG GV +S++V+GMVF R+++G VKEA + K+ I+SCP D +QTETKGT+L+ TA ELT FS  EE  +E  +K +   G++VV+SGGKVG+L LHYANK  L+V++++SKFD+RRL   TGA  +  L  P   E+GH+  V TDE+    VVIFEQ   +G++ +I+VRGS + ++D+ ERA++D +NT+KCLT+   ++AG GATEI+L+++L E A+  + L+QYA+R+F  SF++VV+AL +NTG KA + +  L+ +H  G+   GL+    GE   ++ + ++ NI DL+ V+ W IKFA DAA ++L+VDQ+IMARPAGG  KP+QPGAP+E+
Sbjct:    1 MALHVPKAPGFMSMLKDGARYFEGLEEAVFRNIEACLALSKTTRSTMGPSGQNKIVINHIGKQFITNDAATILKELEVAHPAAKILVMASQQQEQEAGDGTNIVFQLAGSLLEQARDLLRMMVGLWH--HAY----------VSELVVESISDLRNHESVKKVIRTSIMSKQVELADFLSDLITKACISILPQKSHFNVDNVRVLKVLGAGVNSSRIVRGMVFRRESEGEVKEAKDCKIAIFSCPIDTLQTETKGTVLLTTADELTQFSKGEESLMEKHMKAIADAGVRVVVSGGKVGELALHYANKLGLMVVRLSSKFDIRRLCQATGAVALPRLTAPSPEELGHVTHVRTDEIADANVVIFEQDVHEGSVVTILVRGSTENIMDDVERAIDDGVNTFKCLTRSPKLVAGAGATEIELARRLLEYADTLTGLEQYAVREFARSFEVVVRALAENTGEKATEIIAMLYAKHLSGETHTGLITKPGGE--IEVNDAVKFNILDLHMVKRWAIKFATDAACTVLRVDQIIMARPAGG-PKPRQPGAPDED 533          
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Match: G4VPS5 (Putative chaperonin containing t-complex protein 1, theta subunit, tcpq OS=Schistosoma mansoni OX=6183 GN=Smp_046090.2 PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 4.180e-173
Identity = 269/546 (49.27%), Postives = 389/546 (71.25%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEA-AKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA HIPKAPG+ SMLK+GARYF+GLEESV RNI AC AL K++ ++FGP G NK+VINH+ + FVT DAATIL+ELEVAHPAAKI+V+A+QQQEQE G+GTN V  L  +LLE+A +L+ MGLS+  +T G+E+  K  L+ L  +V+E++ D+   + + +V+   + SK      +LSKL+   C+  + +K  F+ DN+R++KILG GV  S+++KGMVF R+T+G VKE  N KV I+SCP D +QTETKGT+L+ +A ELT FS  EE+ +E  ++ L   G+KV++SGGKVG+L LHYANK  ++V+K++SKFD+RRL   TGA+ +  L+ P   E+G I  VY+DE+    VVIFEQ   +G + ++++RGS + ++D+ ERA++D +NT+KCLT+   ++AG GATEI+L+++L   A     L+QYAIR+F  +F++ VK L +N+G K  + V  L+ +H  GQ   GLV        + + ++  + DL+ ++HW I+ A +AA +IL+VDQ+IMARPAGG  KP+QPGA +E+
Sbjct:    1 MALHIPKAPGFMSMLKEGARYFEGLEESVYRNIEACLALSKSIRSTFGPSGQNKIVINHVGRLFVTNDAATILKELEVAHPAAKILVMASQQQEQEAGDGTNVVFQLAGALLEQARDLLRMGLSVAQVTSGFEMGCKKALEILNELVVEDLSDIRCYKSVLRVIKTAVMSKQVGLADFLSKLITKACIETLPQKSYFNVDNIRVLKILGAGVNQSKMIKGMVFRRETEGEVKEVFNGKVAIFSCPLDALQTETKGTVLLTSADELTKFSKGEEDLMEKHMRSLSDAGVKVIVSGGKVGELALHYANKLNMMVVKLSSKFDVRRLCQATGASALPQLVTPTPEELGTISHVYSDEIADASVVIFEQDTHEGTVVTLLIRGSTENIMDDVERAIDDGVNTFKCLTRSPKLVAGAGATEIELARRLLSYAGTVPGLEQYAIREFARAFEVAVKVLAENSGQKITEIVAVLYAKHESGQIHTGLVTQPNGEVSVNDSVKFEVLDLHLLKHWAIRLATNAANTILRVDQIIMARPAGG-PKPRQPGAMDED 545          
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Match: A0A0X3PRR8 (T-complex protein 1 subunit theta OS=Schistocephalus solidus OX=70667 GN=TCPQ PE=3 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 4.524e-171
Identity = 266/546 (48.72%), Postives = 390/546 (71.43%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVC-GEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA H+PK P Y SMLK+G R+++GLEE+V RNI AC A+ +T  +++GP G NK+VINHI K+FVT DAATILRELEV HPAAK+++LA QQQEQE G+GTN V  L  +LL+ A +L++MGLS+  I EGYE+A+K  L+ L  +V++ I +  +K ++  ++  +I SK  D  Q+LS L+A  C+SIM +  +F+ DN+R++K+LG GV +S LVKGMVF RD +G VKE   +K+ IYSCP + +QTETKGT+L++TA EL  FS  EE  +E  +  +   G+KV++SGGK+ +L LHYANK  ++++++ SKFD+RRL   TGAT + +L VP A E+G I+ V  DE+    VVIFE+ G  G + ++V+RGS D +LD+ ERAV+D +NTYK LT+ N ++AG GA EI+L+++L   A+    L+QYAIR+F  SF+++VKAL +N G KA + + +L+ +H  G+   G V   ++   + + ++A + DLY+ + W I+FA++AA ++L+VDQ+IM+RPAGG  KP+ P A +E+
Sbjct:    1 MALHVPKVPNYVSMLKEGTRHYEGLEEAVFRNIEACVAIARTTRSTYGPSGQNKIVINHIGKQFVTNDAATILRELEVQHPAAKMLILATQQQEQEAGDGTNVVFQLAGALLDNARDLLKMGLSVSQIIEGYEMASKKALEFLDEIVVKEIKNCKDKSEVAPLIKTSIMSKQIDISQFLSDLIASACISIMPDDGDFNVDNVRVLKVLGSGVASSSLVKGMVFRRDVEGDVKEVNQSKIAIYSCPLEALQTETKGTVLLHTAEELKQFSEGEENQMEKLLTAIANSGVKVIVSGGKISELALHYANKLGIMLVRLVSKFDVRRLCKSTGATPLPSLTVPTAEELGFIEHVKIDEIADTNVVIFERGGKDGVMVTLVLRGSTDNILDDTERAVDDGVNTYKALTRSNKVVAGAGACEIELARRLFSYADTIPGLEQYAIREFARSFEIIVKALAENAGEKATEIIADLYAKHQAGEINTGFVTMPKKDPSICDAVKAEVLDLYNTKRWAIRFASNAACTVLRVDQIIMSRPAGG-PKPRDPRAADED 545          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:103039692])

HSP 1 Score: 471.085 bits (1211), Expect = 2.507e-160
Identity = 252/540 (46.67%), Postives = 371/540 (68.70%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            MA H+PKAPG+  MLKDGA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE+A K  L  L  +V  +  ++ +  +   ++   + SK   ++ +L+ L+A  CVSI  E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    + K+ ++SCPFD + TETKGT+LI  A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKY+L+V+++NSK+DLRRL    GA  +  + VP   E+GH D VY  E+G   VV+F+ +   G I+++V+RGS D L+D+ ERA++D +NT+K L ++  +  G GATEI+L++++      C  L+QYAI++F  +F+ V +AL +N+G+K  + +++L+  H+ G K  G     E   + +++EA I D Y V++WGIK A +AAI++L+VDQ+IMA+PAGG   PKQ G
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEMACKKALDILPDLVCSSAKNLHDLAEATAMIRTAVMSKQYGNEDFLADLIAQACVSIFPESGSFNVDNVRVCKILGCGLNASSMLHGMVFKKEVEGDITAVKDTKIAVFSCPFDCMVTETKGTVLIKNAEELMNFSKGEEDLMEAQVKAIADAGANVVVTGGKVADMALHYANKYQLMVVRLNSKWDLRRLCKTVGAVALPRMTVPTPEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTLVIRGSTDNLMDDIERAIDDGVNTFKVLVRDKRLCPGAGATEIELAKQIMSYGESCPGLEQYAIKKFAEAFEAVPRALAENSGVKGNELISKLYAVHHDGNKNMGFDIEGEGPVVKDMLEAGILDPYLVKYWGIKLATNAAITVLRVDQIIMAKPAGGPKAPKQQG 540          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:103039692])

HSP 1 Score: 466.848 bits (1200), Expect = 5.873e-159
Identity = 249/538 (46.28%), Postives = 369/538 (68.59%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQ 1661
            MA H+PKAPG+  MLKDGA+++ GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE+A K  L  L  +V  +  ++ +  +   ++   + SK   ++ +L+ L+A  CVSI  E   F+ DN+R+ KILG G+  S ++ GMVF ++ +G +    + K+ ++SCPFD + TETKGT+LI  A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKY+L+V+++NSK+DLRRL    GA  +  + VP   E+GH D VY  E+G   VV+F+ +   G I+++V+RGS D L+D+ ERA++D +NT+K L ++  +  G GATEI+L++++      C  L+QYAI++F  +F+ V +AL +N+G+K  + +++L+  H+ G K  G     E   + +++EA I D Y V++WGIK A +AAI++L+VDQ+IMA+PAGG   P +
Sbjct:    1 MALHVPKAPGFAQMLKDGAKHYSGLEEAVFRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRMGLSVSEVIEGYEMACKKALDILPDLVCSSAKNLHDLAEATAMIRTAVMSKQYGNEDFLADLIAQACVSIFPESGSFNVDNVRVCKILGCGLNASSMLHGMVFKKEVEGDITAVKDTKIAVFSCPFDCMVTETKGTVLIKNAEELMNFSKGEEDLMEAQVKAIADAGANVVVTGGKVADMALHYANKYQLMVVRLNSKWDLRRLCKTVGAVALPRMTVPTPEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTLVIRGSTDNLMDDIERAIDDGVNTFKVLVRDKRLCPGAGATEIELAKQIMSYGESCPGLEQYAIKKFAEAFEAVPRALAENSGVKGNELISKLYAVHHDGNKNMGFDIEGEGPVVKDMLEAGILDPYLVKYWGIKLATNAAITVLRVDQIIMAKPAGGPRAPPE 538          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 176.792 bits (447), Expect = 1.123e-47
Identity = 143/521 (27.45%), Postives = 257/521 (49.33%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-----EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAIN----AKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGN--------------IASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI 1622
            NI A KA+   + TS GP GM+KM+ +      +T D ATIL++++V HPAAK++V  ++ Q+ E G+GT  V+++  +LL+   +L++ G+    I+E ++ A    ++ L   + + +++ ++E +      ++ SK+    QY S L      ++MR          D  ++ IVK LGG + + +LV G+V    TQ +V   ++    AK+ +        +T+    I+++  A++        +       ++K        I+  I    + DL +H+ NK K++V+K   + ++             N+       I HID+   + LG  +  + E+  L G+                SIVVRGS   +++EAER++ DA+   +CL K+ A++AGGGA EI+L+ +L E A     ++ Y +R +  + +++   L +N G+  I  VTEL  RH QG+K  G+        + N++E  +     V    +  A +   SILK+D V+
Sbjct:   31 NISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTS-ISQPVELSDRETLLNSATTSLCSKVVS--QYSSLLAPMSVDAVMRVIDPATATSVDLRDIHIVKKLGGTIDDCELVDGLVL---TQRVVNTGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEE---------QLNICTIGTKPIAHIDQFTPEMLG--LAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGI--NVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDVV 532          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 170.244 bits (430), Expect = 1.173e-45
Identity = 144/526 (27.38%), Postives = 275/526 (52.28%), Query Frame = 3
Query:   84 YSMLKDGARYFQ--GLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLE-NIDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRD--TQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH----NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            + ++KD  + F+  GL+ ++  +I A KA+  T+ TS GP G++KM+++   +  VT D ATIL  ++V H  AK+MV  ++ Q+ E G+GT  V++L  +LLE+AE+L++ G+  + I +GY+ AA+  ++ L  +     +D  N E + Q    T+ SK+ +   + ++++  +  +++   E+K+ D + +++   +GG + ++QL+KG++  ++     + K   + K+ I +CPF+  + +TK  + I +  +  A    E+E  +  I+++ + G  + I      D   H   + +L  ++     ++  ++  TG  I+         ++G    V     G    R+++I E K  +    +I +RG    +++EA+RA+ DA+   + L ++N I+ GGGA+EI  +  + E A+KC  L+QYA+R F  + +++  AL +N+G+  I  +TE+  R     N     D L       K  +VIE  I      +   I  A      ILK+D +
Sbjct:   16 FIIIKDQDKKFRLTGLD-ALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRA--VTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIG-----KKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 157.147 bits (396), Expect = 6.542e-41
Identity = 150/532 (28.20%), Postives = 264/532 (49.62%), Query Frame = 3
Query:  129 ESV-VRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQD-DDQYLSKLVADGCVSIM----REKKEFDTDNMRIVKILGGGVINSQLVKGMVF-CR-DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATI---MSNL---------IVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ--------KFDG--LVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARP 1634
            ESV  +N+ A  ++   V +S GP+G++KM+++ I    +T D ATIL+ LEV HPAAK++   A  Q++E G+GT  V+++   LL+ A+EL++  +   +I  GY +A K  ++ +   +    D   +E +      ++ SKI   D  + + +V D  +++     +    +  +++ ++K  G     S LV G    C   +QG++K   NAK+          + +    ++I+   +L      E +  + +I++++  G  VV++ G + D+ L Y      + ++     DL+R++  TGATI   +SNL         ++  A E+   +RV  DEL      I  +       ASI++RG+ D + DE ER++ DA+   K + +  +++ GGGA E  LS  L   A      +Q AI +F  S  ++ K L  N    + D V +L   HN+ Q        K+ G  LV G    K  +  +A +++   V+   +KFA +AAI+IL++D +I   P
Sbjct:   18 ESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQ-ERVCDDEL------ILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNG----KPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFP 538          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 189.504 bits (480), Expect = 2.725e-53
Identity = 144/526 (27.38%), Postives = 271/526 (51.52%), Query Frame = 3
Query:   96 KDGARYFQGLEESVVR--NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-----EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            K G  Y    + +++R  NI A KA+   + TS GP GM+KM+ +      +T D ATIL++++V HPAAK++V  ++ Q+ E G+GT  V+++  +LL+ + +L++ G+    I+E ++ A +   + L+ M L  +++ +++ +       + SK+    QY S L      ++M+          D +++++++ LGG + + +LV+G+V  +     GI++    AK+ +        +T+ +  I+++   ++        +       ++K        I+  I    + DL LH+ NK K++V+K   + D+  +    G   ++++    A  +   + V    +G   VV        G   SI+VRGS   +L+EAER++ DA+   +CL K+ A++AGGGA EI+LS +LTE A   S ++ Y +R +G + +++   L +N G+  I  VTEL  RH QG+K  G+        + N++E  +     V    +  + +   SILK+D ++ A+
Sbjct:   26 KMGGAYQDREKPAMIRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMSLP-LELSDRQSLLNSATTALNSKVVS--QYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRISNTGIIR-VEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQGEKTAGI--NVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIVNAK 545          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 188.348 bits (477), Expect = 7.760e-53
Identity = 143/516 (27.71%), Postives = 277/516 (53.68%), Query Frame = 3
Query:   96 KDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLE-NIDVFNKEKIGQVLHCTIQSKIQDDDQ-YLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRD--TQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG--KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH-NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQV 1619
            +D      GL+ ++  +I A K++  T+ TS GP G++KM+++      VT D ATIL  ++V H  AK+MV  ++ Q+ E G+GT  V++L  +LLE+AE+L++ G+  + I++GYE AA+  +  L  +     +D  N E +      T+ SKI +  Q  ++++  +  +S+   E+K+ D + +++   +GG + ++ L+KG+V  +D     + KE INAK+ I +CPF+  + +TK  + +    +  A    E+E     ++++ + G  + I      D   H   + +L  ++     ++  ++  TG  I+       A ++GH   V     G  K  +++ EQ        +I +RG    +++EA+R++ DA+   + L ++N ++ GGG+ EI  S  ++E A+KC+ L+QYA+R F  + +++  AL +N+G+ +I A+ E+  R   + + + G+ C + ++K G++ E ++ +    +   I  A      ILK+D +
Sbjct:   22 QDRKSRLSGLD-ALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKDVDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKDHMLVIEQ-CHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSK-GDMKEQHVIETLIGKKQQISLATQMVKMILKIDDI 534          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 115.931 bits (289), Expect = 5.386e-28
Identity = 115/462 (24.89%), Postives = 218/462 (47.19%), Query Frame = 3
Query:   90 MLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQ----VLHC---TIQSK-IQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCR--DTQGI---VKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGL-KGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAID 1433
            +LK+G    QG+ + ++ NI AC  +   V T+ GP GM+K++I+   K  ++ D ATIL+ LEV HPA K +V  A+ Q+ E G+GT  V LL   LL++  + +E G+    IT  +  A    ++++K + +       KE  G+    ++ C    + SK +     + + +V D  VS++ E    +   M+  K+ GGG+ +S LV G+ F +     G     K     K+ + +   ++        + +    +  A  + E   +  K+ ++   G +VV+S   +GD+   Y     +       + DL+R     G +I +++       +G  +     ++G      F  KG  +    +I++RG  +  +DE ER++ DAI   +   K ++++ GGGA E+++S+ L + +      +Q  +  +  + ++  + L  N G  A +
Sbjct:    7 LLKEGTDTSQGIPQ-LLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIKEISVP----VKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVD-AVSMLDELMPLNMIGMK--KVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGRCELFEEVQIGGDRYNFF--KGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFDATN 458          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 3.817e-18
Identity = 80/310 (25.81%), Postives = 155/310 (50.00%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVA-DGCVSIMRE---KKEFDTDN-MRIVKILGGGVINSQLVKGMVFCRD-TQGIVKEAI-NAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSN 1052
            NI A K +   + T  GP  M KM+++ +    +T D   ILRE++V HPAAK M+  ++ Q++E G+GT  VI+L   +L  AE+ +E  +    I   Y  A +  L  LK +    +DV ++  + +++   I +K       L+  +A D  +++ RE   ++E D  N  +I K+ GG +  S +++G++  +D T   ++  I   ++++  C  +  + E++  I ++   +       EE+ I+    ++V+    ++ +   + DL  H+  K  +  ++   K D  R++   GA I+S 
Sbjct:   28 NISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSR 337          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 6.384e-11
Identity = 54/190 (28.42%), Postives = 98/190 (51.58%), Query Frame = 3
Query:  165 LGKTVSTSFGPMGMNKMVINHIEKK----FVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIG----QVLHCTIQSK-IQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKG 707
            +G  V ++ GP GM+K+++           VT D ATIL+ + V +PAAKI+V  ++ Q+ E G+GT  V +L   LL +AE LI   +    I  G+  +     K L+   +++    +KEK       +   T+ SK +     + +KL  +   +++R + +   + + ++K LGG +++S L +G
Sbjct:   33 IGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDH--GHDKEKFHVDLLNISRTTLSSKLLTHHKDHFAKLAVE---AVLRLRGKGTLEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Match: CCT8 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003545])

HSP 1 Score: 341.273 bits (874), Expect = 1.198e-110
Identity = 211/564 (37.41%), Postives = 340/564 (60.28%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR------EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVK---EAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQ-KGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENA--ILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ----KFDGL-----VCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPN 1676
            M+  +P+ P    + K G   +   +  ++++I A + L +   TS GP G NK+++NH+ K  +T DAAT+LREL++ HPA K++V+A +QQ+ + G+GTN V++L   LL  +E+LI MGLS V I +GY +A KF LK+L  MV+  I D  +K ++ +++   I SK    +  LS+LV++    ++       E   F+ D++R+VKI+GG + NS ++KGMVF R+ +G VK   E    KV +++CP DI  TETKGT+L++ A E+  FS  EE+ I+  +KE+   G++ +++G  VG+L LHY N+Y +LVLK+ SKF+LRRL  V GAT +  L  P   E+G ++ V T E+G   V +F+Q +G     ++I++RG+    LD+ ERA++D +   K L K +   +L G GATEI+L  ++T+   +   L Q AI+QF  +F++V + L +  G+   + +  L+  HN  +    K D L     + GE    + ++ E NI+D+ + + + I  A +AA ++L +DQ+IMA+ AGG   P+ P   N
Sbjct:    1 MSLRLPQNPNA-GLFKQGYNSYSNADGQIIKSIAAIRELHQMCLTSMGPCGRNKIIVNHLGKIIITNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDGTNLVMILAGELLNVSEKLISMGLSAVEIIQGYNMARKFTLKELDEMVVGEITDKNDKNELLKMIKPVISSKKYGSEDILSELVSEAVSHVLPVAQQAGEIPYFNVDSIRVVKIMGGSLSNSTVIKGMVFNREPEGHVKSLSEDKKHKVAVFTCPLDIANTETKGTVLLHNAQEMLDFSKGEEKQIDAMMKEIADMGVECIVAGAGVGELALHYLNRYGILVLKVPSKFELRRLCRVCGATPLPRLGAPTPEELGLVETVKTMEIGGDRVTVFKQEQGEISRTSTIILRGATQNNLDDIERAIDDGVAAVKGLMKPSGGKLLPGAGATEIELISRITKYGERTPGLLQLAIKQFAVAFEVVPRTLAETAGLDVNEVLPNLYAAHNVTEPGAVKTDHLYKGVDIDGESDEGVKDIREENIYDMLATKKFAINVATEAATTVLSIDQIIMAKKAGGPRAPQGPRPGN 563          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 185.267 bits (469), Expect = 4.599e-52
Identity = 138/514 (26.85%), Postives = 264/514 (51.36%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMRE-KKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEA------INAKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYT-DELGKRVVVIFEQKGLKGNIA----SIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            NI A +++   + TS GP GM+KM+     +  ++ D  TIL+++ + HP A+++V  +  Q+ E G+GT  V++L  +LL  AE L+  G+    I + ++ AAK  +  L  M    + + ++E++ +    ++ SKI      +L+ L  D  + I  E  K  D +++R+VK +GG + +++++ G+V    TQ  +K A        AK+ +        + +T+  I++N   ++        +       ++K  +     I+  I    V DL LH+ +K  ++V+K   + ++  LS   G   ++++ +     +G  D V   D  G ++V +    G++ N A    S+V+RG+ + ++DE ER++ DA+   +CL KE  ++AGGGA EI++S++L++EA     ++ +  ++F S+ +++   L +N G+ +I  VTEL  +H  G+  DG+          N  E +I     V    I  A++   SIL++D +  +R
Sbjct:   24 NIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMC-HKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVL---TQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRV---TGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTT--NTYEEHILQPVLVSTSAITLASECVKSILRIDDIAFSR 528          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 158.303 bits (399), Expect = 3.867e-42
Identity = 126/462 (27.27%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVL----HCTIQSKI--QDDDQYLSKLVADGCVSIM-REKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQG-------IVKEAINA-KVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH 1460
            E+   +I A +++   + TS GP G++K++I+   +  +T D ATIL ++E+ +  AK++V  ++ Q+ E G+GT  V++L ++LL++A ELI+ G+  + I  G++ AAK  + +L+    ++I   N E     L      ++ SKI  +D D++ +++  +  +++M +++K+ D D +++   +GG + +S+L+ G++  +D          + KE  +  K+ I +CPF+  + +TK  + I++  E       E++  +  I ++ K G  VVI      D   H   +  L  ++     +L  ++  T   I+         ++G   R+Y  E G    R+++I + K  K    +  VRGS   ++DEAERA+ D++   + L K++ ++ GGGA E+ +S  ++EEA+K   + QYA R F  + D +   L +N+G+  I  ++ L  + 
Sbjct:   45 EAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLE-ETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF-AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETK--TVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQ 502          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 156.762 bits (395), Expect = 8.135e-42
Identity = 136/512 (26.56%), Postives = 265/512 (51.76%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEK-AEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSK-IQDDDQYLSKLVADGCVSIMRE-------KKEFDTD---NMRIVKILGGGVINSQLVKGMVFCRDT--QGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI 1622
            ++ + NI A KA+   + T  GP  M KM+++ +    +T D   ILRE++VAHPAAK M+  ++ Q++E G+GT  VI+L   +L + A  LIE  +  V I +  + A    L+ +K  V + +DV N   + +++  +I +K +    + + +L  D   ++ ++       +  F+ D    +R+ KI GG V++S+++KG++  +D     + +   N +VV+  CP +  + E++  I I    +       EEE ++L  ++++     +VI+   V DL  HY  K    VL+   K D  R++ VTGATI++ +      ++G    ++  E+       F     +    +I++RG    +L+E +R ++DA+   + +    ++  GGGATE+ +S KL E+A +   ++Q+  +    + + + + LIQN G   I  +++L  +H QG    G+    +  K+ +++   I++   ++   +K A ++A  +L+VD ++
Sbjct:   19 QAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIK-QVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGNFTTGI--DGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIV 527          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 141.354 bits (355), Expect = 1.903e-36
Identity = 148/505 (29.31%), Postives = 255/505 (50.50%), Query Frame = 3
Query:  162 ALGKTVSTSFGPMGMNKMVINHIEKK-FVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMG-LSIVNITEGYEVAAKFCLKQLKGMVLENI--DVFNKEKIGQVLHCTIQSKI--QDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRD-TQGIVKEAINAKVVIYSCPFDIVQTETKGTIL-INTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINS----KFD-LRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLK-GNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARP 1634
            A+G  V ++ GP GM+K++ +       VT D ATIL+ + + +PAAK++V  ++ Q+ E G+GT  V +L   LL +AE+LI+   +    I EGY +A+   L  L    ++N       +E +  +   T+ SKI  QD D + ++L  +   +I+R K   + ++++I+KILGG + +S L +G +  +       K   NAK++I +   D  + +  GT   +++ A+L      E E ++ KI ++ K+GI   I+      L+  Y  +     L INS     F+ + RL+ VTG  ++S    P   ++G  D +    LG++  + F   G K G   +IV+RG+ D  LDEAER++ DA++     TKE   + GGG  E+ +S+ +  EA      K  A+  F  +   +   L  N G  + + V++L      G    GL        + ++ +  I + Y ++   +  A++AA  +L+VD +I ARP
Sbjct:   28 AVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHF-AELATN---AILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQ----LIYDYPEQL-FTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFS--GCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNN--GTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARP 519          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Match: EDO38829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU6])

HSP 1 Score: 458.373 bits (1178), Expect = 4.191e-156
Identity = 239/534 (44.76%), Postives = 370/534 (69.29%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGL--VCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGG 1643
            MA H+P++     M+KDGA+ F GLEE+V RNI AC+ L K   +S GP GMNKMV+NH+EK FVT DAATI++ELEV HPAAK++VLA Q QEQE G+GTN+VI+   +LL  AE+L+ MGLS   + +GYE+A K  L+ L  M    + ++ +++++ + +   + SK   ++ +LS+L+A  CVSI+ EK  F+ DN+R+ KILG G+ NS++V+GMVF +  +G +    + K+ ++SCP D++QTETKGT+LI  A EL +FS  EE+ +E++IK + + G  V++SGGKV D+ LH+ NKY+++V+++ SK+DLRRL     AT +  +  P   ++GH D VY  E+G+  V IF+Q+  +  +A++V+RGS + ++D+ ERA++D +N++K LT++   + G GA+EI+L++KLT  A   + L+QYAI +F  S + V +AL  N G+KA + +++L+  H +G+   G    CG  +A + + +EA I D+Y  +HWG+K A DAA+++L+VDQ+IMA+ AGG
Sbjct:    1 MALHVPQS-NLQRMMKDGAKMFNGLEEAVYRNIEACRQLAKVTQSSLGPNGMNKMVVNHLEKLFVTNDAATIIKELEVEHPAAKMLVLALQMQEQEVGDGTNFVIVFAGALLSAAEDLLRMGLSPPEVIQGYELACKKALELLPEMSCSKLTNIRDEKEVTKAIKTAVSSKQYGNEDFLSELIAHACVSILPEKATFNVDNVRVAKILGSGIHNSEVVQGMVFKKGVEGDITSKKDCKIAVFSCPLDLMQTETKGTVLIKNAEELKSFSKGEEDLLEMQIKSIKEKGADVIVSGGKVADMALHFCNKYQIMVVRLTSKWDLRRLCRAISATALPKVTTPTTEDLGHCDLVYLSEIGETPVTIFKQEREETAVATVVIRGSTENIMDDIERAIDDGVNSFKALTRDPRFVPGAGASEIELARKLTSHAETFAGLEQYAIAKFAESLECVPRALADNAGVKATELISKLYAAHQEGKMNAGFDNECG--SADIKDAVEAGILDVYLTKHWGLKLATDAAVTVLRVDQIIMAKQAGG 531          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Match: EDO29932 (T-complex protein 1 subunit delta [Source:UniProtKB/TrEMBL;Acc:A7T288])

HSP 1 Score: 167.933 bits (424), Expect = 1.146e-45
Identity = 131/476 (27.52%), Postives = 250/476 (52.52%), Query Frame = 3
Query:  243 VTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQY---LSKLVADGCVSIMREK--KEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQ---GIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            +T D ATIL++++V HPAA+++V  ++ Q+ E G+GT  V+++  SLL  A +L+E G+    ++E +E+A++  ++ L GM    + + ++E + +    ++ SK+    QY   L+ +  D  + ++        D  ++RIVK LGG V +++LV+G+V  +      G + +   AK+ +        +T+ +  ++++  A++     EE + I    K++ K       I+  I    V DL LH+ +K K+LV++   + ++  +    G   +++L       +   + V    +G   VV        GN  S++VRGS   +L+EA+R++ DA+   +CL K+ A++AGGGA EI+++ +L E +   + +  Y +R F  + +++   L +N G+  I  VTEL  RH QG+   G+        + N++E N+     V    ++ A++   SILK+D ++  R
Sbjct:   16 ITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTTVVVIAGSLLNAAAKLLERGIHPTTVSESFELASRKAVEILSGMSTP-LALNDRESLLKSATTSLNSKVVS--QYSNLLAPISVDAVLKVINPSVVDNVDLRDIRIVKKLGGTVEDTELVEGLVLQQKISHLAGGISQVEKAKIGLLQFCISPPKTDMENQVIVSDYAQMDRVLREERQYILEICKKIKKAGCNVLLIQKSILRDAVNDLALHFLSKMKILVVRDIERDEIEFICKSIGCKPIASLDHFNPDMLASAELVEEVSVGTSKVVKITGVSNPGNTVSVLVRGSNKLVLEEADRSLHDALCVIRCLVKKRALIAGGGAPEIEVALRLAEYSQTLTSMDAYCVRAFAEALEIIPYTLAENAGLNPIATVTELRNRHAQGEVTAGI--NVRKGTVTNILEENVLQPLLVSTSAVQLASETVRSILKIDDIVNTR 486          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 165.236 bits (417), Expect = 3.050e-44
Identity = 149/523 (28.49%), Postives = 264/523 (50.48%), Query Frame = 3
Query:  108 RYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLEN--IDVFNKEKIGQVLHCTIQSKIQDD-DQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDT--QGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH----NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPA 1637
            +   GLE +   +I A +A+   + TS GP GM+KM+++   +  VT D ATIL  +EV H  AK+MV  ++ Q+ E G+GT  V++L  +LLE AE+L++ G+  + I +GYE+AAK  L+ +   + +N  +D  NKE + Q    T+ SKI     + L+++  D  +S+   E+K+ D + +++    GG + ++ LVKG+V  +D     + K   +AK+ I +CPF+  + +TK  + + T  +       E E     IK++   G  + I      D   H   +  L  ++     ++  ++  TG  I+       + ++G    V     G    +++VI E    +    +I +RG    ++ EA+R++ DA+   + L +++ ++ GGGATE+  S  + +EA+K S ++QYA+R +  + D +  AL +N+G+  I  V ++  R     N     D +  G    K  +VIE  I      +   I  A      ILK+D + +  P+
Sbjct:   32 KRLTGLE-AQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDS-IADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRA--VTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIG-----KKQQISLATQLVKMILKIDDIRIKAPS 545          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 160.614 bits (405), Expect = 1.013e-42
Identity = 136/524 (25.95%), Postives = 268/524 (51.15%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLS---KLVADGCVSIMR-EKKEFDTDNM-RIVKILGGGVINSQLVKGMVFCRD-TQGIVKEAI-NAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVY-TDELGKR-VVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH----NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMA-RPAGGVAKPKQPGAP 1673
            N+ A K +   + T  GP  M KM+++ +    +T D   ILRE++V HPAAK M+  ++ Q++E G+GT  VI+L    +  AE  +E  +    I   Y +A    +  LK  +   +D+ N+E++ +++  ++ +K  +    L+    L A   V++ R ++KE D  N  ++ K+ GG + +S+++ G++  +D T G +K  I N ++++  C  +  + E++ ++ +++  + +     EEE I+    E++     +VI+   + DL  H+  K  +  ++   K D  R++   GATI++        +IG    ++  ++ G      I E    K    +I++RG+   +L+E ER ++DA+N  + +  +  ++ GGGA E+ L+  LTE+A   + ++Q+  +      +++ + LIQN G   I  +T L  +H    N     DG     E+ ++ ++ E  ++D Y+V+    K A + A+ +L++D ++   + A G    +  GAP
Sbjct:   22 NVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECNNPKA--CTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGNTSWGIDG-----ESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIVSGTKKATGAEGSESGGAP 538          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 153.295 bits (386), Expect = 2.740e-40
Identity = 140/513 (27.29%), Postives = 251/513 (48.93%), Query Frame = 3
Query:  129 ESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDT--QGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELG---KRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRH----NQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPA 1637
            E+   +I A +A+   + TS GP GM+KM+++   +  VT D ATIL  +EV H  AK+MV  ++ Q+ E G+GT  V++L  +LLE AE+L++ G+  + I +GYE+AAK  L+ +  +     D F       V  C          + L+++  D  +S+   E+K+ D + +++    GG + ++ LVKG+V  +D     + K   +AK+ I +CPF+  + +TK  + + T  +       E E     IK++   G  + I      D   H   +  L  ++     ++  ++  TG  I+       + ++G    V     G    +++VI E    +    +I +RG    ++ EA+R++ DA+   + L +++ ++ GGGATE+  S  + +EA+K + ++QYA+R +  + D +  AL +N+G+  I  V ++  R     N     D +  G    K  +VIE  I      +   I  A      ILK+D + +  P+
Sbjct:   26 EAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIA----DNFPLPLGYSVSRC---------HRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRA--VTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIG-----KKQQISLATQLVKMILKIDDIRIKAPS 518          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:101173570])

HSP 1 Score: 495.738 bits (1275), Expect = 3.929e-170
Identity = 255/540 (47.22%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            MA HIPKAPG+  MLKDGA++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L   V  +  ++ +  +    +   + SK   ++ + + L+A  CVSI  E   F+ DN+R+ KI G GV  S ++ GMVF ++ +G V    +AK+ ++SCPFD + TETKGT+LIN A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKYKL+V+++NSK+DLRRL    GA  +  +  P   E+GH D VY  E+G   VV+F+ +   G I+++V+RGS D L+D+ ERAV+D +NT+K L ++  ++ GGGATEI+L++++T     C  L+QY+I++F  +F+ + +AL +N+G+K  + +++L+  H++G K  G     E   + ++++A I D Y V+HWGI+ A +AA+++L+VDQ+IMA+PAGG   PKQ G
Sbjct:    1 MALHIPKAPGFAQMLKDGAKHFSGLEEAVFRNIRACKELSQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLEMAEELLRMGLSVSEVIEGYEQACKKALEILPDCVCSSAKNLHDVNEAASFIRTAVMSKQYGNEDFFANLIAQACVSIFPESGSFNVDNVRVCKIPGCGVTASSVLHGMVFKKEAEGDVTSVKDAKIAVFSCPFDCMVTETKGTVLINNAKELMNFSKGEEDLMESQVKAIKDAGASVVVTGGKVADMALHYANKYKLMVVRLNSKWDLRRLCKTVGAVALPRITAPTPDEMGHCDNVYVAEVGDTQVVVFKHEKEDGAISTVVIRGSTDNLMDDIERAVDDGVNTFKVLVRDKRLVPGGGATEIELAKQITSYGESCPGLEQYSIKKFADAFEALPRALAENSGVKGNELISKLYAAHHEGNKNTGFDIEGEGPAVKDMLKAGILDPYLVKHWGIRMATNAAVTVLRVDQIIMAKPAGGPKTPKQRG 540          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:101173570])

HSP 1 Score: 463.766 bits (1192), Expect = 1.215e-157
Identity = 240/521 (46.07%), Postives = 356/521 (68.33%), Query Frame = 3
Query:  108 RYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            ++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L   V  +  ++ +  +    +   + SK   ++ + + L+A  CVSI  E   F+ DN+R+ KI G GV  S ++ GMVF ++ +G V    +AK+ ++SCPFD + TETKGT+LIN A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKYKL+V+++NSK+DLRRL    GA  +  +  P   E+GH D VY  E+G   VV+F+ +   G I+++V+RGS D L+D+ ERAV+D +NT+K L ++  ++ GGGATEI+L++++T     C  L+QY+I++F  +F+ + +AL +N+G+K  + +++L+  H++G K  G     E   + ++++A I D Y V+HWGI+ A +AA+++L+VDQ+IMA+PAGG   PKQ G
Sbjct:    9 QHFSGLEEAVFRNIRACKELSQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLEMAEELLRMGLSVSEVIEGYEQACKKALEILPDCVCSSAKNLHDVNEAASFIRTAVMSKQYGNEDFFANLIAQACVSIFPESGSFNVDNVRVCKIPGCGVTASSVLHGMVFKKEAEGDVTSVKDAKIAVFSCPFDCMVTETKGTVLINNAKELMNFSKGEEDLMESQVKAIKDAGASVVVTGGKVADMALHYANKYKLMVVRLNSKWDLRRLCKTVGAVALPRITAPTPDEMGHCDNVYVAEVGDTQVVVFKHEKEDGAISTVVIRGSTDNLMDDIERAVDDGVNTFKVLVRDKRLVPGGGATEIELAKQITSYGESCPGLEQYSIKKFADAFEALPRALAENSGVKGNELISKLYAAHHEGNKNTGFDIEGEGPAVKDMLKAGILDPYLVKHWGIRMATNAAVTVLRVDQIIMAKPAGGPKTPKQRG 529          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Match: cct8 (chaperonin containing TCP1 subunit 8 [Source:NCBI gene;Acc:101173570])

HSP 1 Score: 459.914 bits (1182), Expect = 2.265e-156
Identity = 239/520 (45.96%), Postives = 355/520 (68.27%), Query Frame = 3
Query:  108 RYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQP 1664
            ++F GLEE+V RNI ACK L +T  T++GP GMNKMVINH+EK FVT DAATILRELEV HPAAK++V+A+  QEQE G+GTN+V++   +LLE AEEL+ MGLS+  + EGYE A K  L+ L   V  +  ++ +  +    +   + SK   ++ + + L+A  CVSI  E   F+ DN+R+ KI G GV  S ++ GMVF ++ +G V    +AK+ ++SCPFD + TETKGT+LIN A EL  FS  EE+ +E ++K +   G  VV++GGKV D+ LHYANKYKL+V+++NSK+DLRRL    GA  +  +  P   E+GH D VY  E+G   VV+F+ +   G I+++V+RGS D L+D+ ERAV+D +NT+K L ++  ++ GGGATEI+L++++T     C  L+QY+I++F  +F+ + +AL +N+G+K  + +++L+  H++G K  G     E   + ++++A I D Y V+HWGI+ A +AA+++L+VDQ+IMA+PAGG   PK P
Sbjct:    9 QHFSGLEEAVFRNIRACKELSQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLEMAEELLRMGLSVSEVIEGYEQACKKALEILPDCVCSSAKNLHDVNEAASFIRTAVMSKQYGNEDFFANLIAQACVSIFPESGSFNVDNVRVCKIPGCGVTASSVLHGMVFKKEAEGDVTSVKDAKIAVFSCPFDCMVTETKGTVLINNAKELMNFSKGEEDLMESQVKAIKDAGASVVVTGGKVADMALHYANKYKLMVVRLNSKWDLRRLCKTVGAVALPRITAPTPDEMGHCDNVYVAEVGDTQVVVFKHEKEDGAISTVVIRGSTDNLMDDIERAVDDGVNTFKVLVRDKRLVPGGGATEIELAKQITSYGESCPGLEQYSIKKFADAFEALPRALAENSGVKGNELISKLYAAHHEGNKNTGFDIEGEGPAVKDMLKAGILDPYLVKHWGIRMATNAAVTVLRVDQIIMAKPAGG---PKPP 525          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 196.438 bits (498), Expect = 3.248e-55
Identity = 157/547 (28.70%), Postives = 274/547 (50.09%), Query Frame = 3
Query:   66 PKAPGYYSMLKDGARYFQGLEESVVR--NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMR-----EKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAIN----AKVVIYSCPFDIVQTETKGTILINTAAELTAF-----SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHI--DRVYTDELGKRVVVIFEQKGLK-------GNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMAR 1631
            P+AP       +G  Y    + + +R  NI A KA+   V TS GP GM+KM+ +      +T D ATIL++++V HP+AK++V  ++ Q+ E G+GT  V+++  +LLE   +L++ G+    I+E ++ A    ++ L GM    +++ ++E +      ++ SK+    QY S L      ++MR          D +N++I+K LGG + + +LV+G+V    TQ +    +     AK+ +        +T+    I+++  A++        S       ++K        I+  I    + DL LH+ NK K++V+K   + ++  +    G         P AH I H   + + T EL + + +    K +K       G   SIVVRGS   ++DEAER++ DA+   +CL K+ A++AGGGA EI+L+ +LTE +   + ++ Y +R +G + +++   L +N G+  I  VTEL  +H QG K  G+        + N++E  +     V    +  A +   SILK+D V+  R
Sbjct:    8 PRAPSGGK--NNGGTYVDRDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMS-RPVELSDRESLLNSATTSLCSKVVS--QYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVL---TQRVASTGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTK-------PIAH-IDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGI--NVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVVNTR 536          
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 164.081 bits (414), Expect = 2.298e-43
Identity = 147/535 (27.48%), Postives = 270/535 (50.47%), Query Frame = 3
Query:  129 ESV-VRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSK-IQDDDQYLSKLVADGCVSI----MREKKEFDTDNMRIVKILGGGVINSQLVKGMVF-CR-DTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATI---MSNLIVPCAHE---IGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQ--------KFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPG 1667
            ESV  +N+ A  ++   V +S GP G++KM+++ I    +T D ATIL+ LEV HPAAK++   A  Q++E G+GT  V++L   LL+ A+EL++  +   ++  GY +A K  ++ +   +    D   +E +      ++ SK I+ D  + + +V D  +++     +   ++  +++ ++K  G     S LV G    C   +QG+VK  +NAK+          + +    ++I+   +L      E +  + +I++++  G  VV++ G + D+ L Y      + ++   K DL+R++  TGA +   +SNL      E   +G  + V  + +    +++ +   ++ + ASI++RG+ D + DE ER+V DA+   K + +  +++ GGGA E  LS  L   A      +Q AI +F  S  ++ K L  N    + D V +L   HN+ Q        K+ GL       K  +  +A +++   V+   +KFA +AAI+IL++D +I   P     +PK+ G
Sbjct:   18 ESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTTGGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVRSS-ASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLN--GKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFP-----EPKEGG 544          
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Match: SMESG000009544.1 (SMESG000009544.1)

HSP 1 Score: 1027.7 bits (2656), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLAAQQQEQECGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNEEEEDIELKIKELVKYGIKVVISGGKVGDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE
Sbjct:    1 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLAAQQQEQECGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNEEEEDIELKIKELVKYGIKVVISGGKVGDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 544          
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Match: SMESG000023665.1 (SMESG000023665.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 292/545 (53.58%), Postives = 396/545 (72.66%), Query Frame = 3
Query:   51 MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            MA HIP APGY SM+K+GA+++QGLEESV RNI AC ALG+T +++FGP GM KMVINHI KKFVTKDA TILRELEV HPAAK+MV+AAQQQEQE GE TN VI+L  SLLEKAE L+ MGLS+ ++TEG+E+AAK  L+ LK +V+  + D+ ++E +G+V+   + SKI  ++ ++S LV   C+  + E   F+ D++R+VKILG G  +S+L  GMVF R+ QG+VK    AKVV+YSCPFD +QTETKGTILIN A EL  FS  EE  +E +++E+ + G KV+++GGKVG+L LHYANKY L+V+K+ SKFD+RR+  +TGAT M     P   E+G+I  V T+E+GK   V+F+Q   +G I+SIVVRGSM  ++DE ERA++D +NT+KCLT++   LAG GATEI+L+ +L++ AN  + L QYAI+QF  +F+ +VK L  N G  A + + EL   H +G+   G+V   E  K+ + IE  I D Y+ ++WGI+FAAD AI+IL+VD +IMAR  GG A  +QPG  +E+
Sbjct:    1 MAMHIPNAPGYLSMMKEGAKFYQGLEESVFRNIQACVALGQTTASTFGPQGMKKMVINHIGKKFVTKDAGTILRELEVEHPAAKLMVMAAQQQEQESGEATNLVIILCASLLEKAEYLLRMGLSVPDVTEGFEIAAKHSLELLKDLVIGKVGDLRDEESVGKVIRTAVNSKIFGEENHISDLVTKACIRALPESSHFNVDHIRVVKILGSGTNSSKLFNGMVFVREAQGVVKACSQAKVVVYSCPFDQLQTETKGTILINNAKELMDFSRGEETQMEDRVREISETGCKVIVTGGKVGELALHYANKYNLMVVKLTSKFDVRRVCKITGATPMPKFSTPTQEELGYIANVRTEEIGKTTAVLFDQDVNEGAISSIVVRGSMHDVMDEVERAIDDGVNTFKCLTRDPQYLAGAGATEIELANRLSDFANTQTGLVQYAIKQFVLAFESIVKVLCDNAGENATERIAELKADHREGKTTYGIVSTPEGRKVADAIEEQILDTYTAKYWGIRFAADTAITILRVDNIIMARSTGGPA-ARQPGKQDED 544          
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Match: SMESG000023665.1 (SMESG000023665.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 290/542 (53.51%), Postives = 394/542 (72.69%), Query Frame = 3
Query:   60 HIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENI-DVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE 1682
            HIP APGY SM+K+GA+++QGLEESV RNI AC ALG+T +++FGP GM KMVINHI KKFVTKDA TILRELEV HPAAK+MV+AAQQQEQE GE TN VI+L  SLLEKAE L+ MGLS+ ++TEG+E+AAK  L+ LK +V+  + D+ ++E +G+V+   + SKI  ++ ++S LV   C+  + E   F+ D++R+VKILG G  +S+L  GMVF R+ QG+VK    AKVV+YSCPFD +QTETKGTILIN A EL  FS  EE  +E +++E+ + G KV+++GGKVG+L LHYANKY L+V+K+ SKFD+RR+  +TGAT M     P   E+G+I  V T+E+GK   V+F+Q   +G I+SIVVRGSM  ++DE ERA++D +NT+KCLT++   LAG GATEI+L+ +L++ AN  + L QYAI+QF  +F+ +VK L  N G  A + + EL   H +G+   G+V   E  K+ + IE  I D Y+ ++WGI+FAAD AI+IL+VD +IMAR  GG A  +QPG  +E+
Sbjct:    2 HIPNAPGYLSMMKEGAKFYQGLEESVFRNIQACVALGQTTASTFGPQGMKKMVINHIGKKFVTKDAGTILRELEVEHPAAKLMVMAAQQQEQESGEATNLVIILCASLLEKAEYLLRMGLSVPDVTEGFEIAAKHSLELLKDLVIGKVGDLRDEESVGKVIRTAVNSKIFGEENHISDLVTKACIRALPESSHFNVDHIRVVKILGSGTNSSKLFNGMVFVREAQGVVKACSQAKVVVYSCPFDQLQTETKGTILINNAKELMDFSRGEETQMEDRVREISETGCKVIVTGGKVGELALHYANKYNLMVVKLTSKFDVRRVCKITGATPMPKFSTPTQEELGYIANVRTEEIGKTTAVLFDQDVNEGAISSIVVRGSMHDVMDEVERAIDDGVNTFKCLTRDPQYLAGAGATEIELANRLSDFANTQTGLVQYAIKQFVLAFESIVKVLCDNAGENATERIAELKADHREGKTTYGIVSTPEGRKVADAIEEQILDTYTAKYWGIRFAADTAITILRVDNIIMARSTGGPA-ARQPGKQDED 542          
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.022e-48
Identity = 140/505 (27.72%), Postives = 255/505 (50.50%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQY---LSKLVADGCVSIMREKKE--FDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGI--VKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI 1622
            NI A KA+   + TS GP GM+KM+        +T D ATIL+ +++ HPAA+++V  ++ Q+ E G+GT  V++L  S L+   +L+  G+    I++ + +AA    + ++GM    +D+ ++  + ++   ++ SK+    QY   LS +  D  + I  +      + D++ IV  LGG V +++LV G++  R  + +  V    NAK+          + E + +I+++   ++     +E + I   +K++         ++  +    V DL LH+ NK  ++++K  +K  +  +    G   ++N+    A  +G   RV    +G   +V            SI++RGS   +LDEAER++ DA+   +CL K+ A++AGGGA EI++ QK+   +N  S   QY  R F  + D++   L +N G+  I+ VTEL   H  G    G+    +   + N+++ ++     V    +  AA+   SILK+D V+
Sbjct:   32 NILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCP-VDLNDRNNLLKIASTSLNSKVVS--QYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGI--NIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVV 531          
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 177.178 bits (448), Expect = 3.337e-48
Identity = 140/505 (27.72%), Postives = 255/505 (50.50%), Query Frame = 3
Query:  144 NIHACKALGKTVSTSFGPMGMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLXXXXXXXXCGEGTNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLENIDVFNKEKIGQVLHCTIQSKIQDDDQY---LSKLVADGCVSIMREKKE--FDTDNMRIVKILGGGVINSQLVKGMVFCRDTQGI--VKEAINAKVVIYSCPFDIVQTETKGTILINTAAELTAFSNXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXDLVLHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVYTDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKCLTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKALIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLYSVRHWGIKFAADAAISILKVDQVI 1622
            NI A KA+   + TS GP GM+KM+        +T D ATIL+ +++ HPAA+++V  ++ Q+ E G+GT  V++L  S L+   +L+  G+    I++ + +AA    + ++GM    +D+ ++  + ++   ++ SK+    QY   LS +  D  + I  +      + D++ IV  LGG V +++LV G++  R  + +  V    NAK+          + E + +I+++   ++     +E + I   +K++         ++  +    V DL LH+ NK  ++++K  +K  +  +    G   ++N+    A  +G   RV    +G   +V            SI++RGS   +LDEAER++ DA+   +CL K+ A++AGGGA EI++ QK+   +N  S   QY  R F  + D++   L +N G+  I+ VTEL   H  G    G+    +   + N+++ ++     V    +  AA+   SILK+D V+
Sbjct:   41 NILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCP-VDLNDRNNLLKIASTSLNSKVVS--QYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGI--NIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVV 540          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit theta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT81.408e-15747.61chaperonin containing TCP1 subunit 8 [Source:HGNC ... [more]
CCT83.215e-14646.95chaperonin containing TCP1 subunit 8 [Source:HGNC ... [more]
CCT84.270e-11343.90chaperonin containing TCP1 subunit 8 [Source:HGNC ... [more]
CCT86.676e-7442.63chaperonin containing TCP1 subunit 8 [Source:HGNC ... [more]
CCT43.246e-5229.31chaperonin containing TCP1 subunit 4 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-83.773e-14243.96T-complex protein 1 subunit theta [Source:UniProt... [more]
cct-83.725e-9841.29T-complex protein 1 subunit theta [Source:UniProt... [more]
cct-11.029e-4629.14T-complex protein 1 subunit alpha [Source:UniProt... [more]
cct-52.907e-4528.26T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-52.907e-4528.26T-complex protein 1 subunit epsilon [Source:UniPr... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT81.085e-16447.44gene:FBgn0284436 transcript:FBtr0088683[more]
CCT53.168e-4829.27gene:FBgn0010621 transcript:FBtr0087987[more]
CCT54.690e-4829.56gene:FBgn0010621 transcript:FBtr0087988[more]
CCT42.332e-4526.88gene:FBgn0032444 transcript:FBtr0080411[more]
CCT12.838e-4429.47gene:FBgn0003676 transcript:FBtr0084290[more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct82.947e-16247.22chaperonin containing TCP1, subunit 8 (theta) [Sou... [more]
cct86.826e-16147.12chaperonin containing TCP1, subunit 8 (theta) [Sou... [more]
cct46.853e-4826.63chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct53.382e-4627.22chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
tcp11.334e-4328.27t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct84.525e-16748.15chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct81.937e-15646.75chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct84.397e-15546.80chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct87.605e-15246.01chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct82.762e-12345.02chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct89.108e-16347.24chaperonin containing Tcp1, subunit 8 (theta) [Sou... [more]
Cct82.078e-12242.19chaperonin containing Tcp1, subunit 8 (theta) [Sou... [more]
Cct81.823e-5844.54chaperonin containing Tcp1, subunit 8 (theta) [Sou... [more]
Cct43.644e-5329.12chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct8l18.055e-4826.95chaperonin containing TCP1, subunit 8 (theta)-like... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6EE31|TCPQ_CHICK2.034e-17047.98T-complex protein 1 subunit theta OS=Gallus gallus... [more]
sp|P42932|TCPQ_MOUSE6.371e-16247.24T-complex protein 1 subunit theta OS=Mus musculus ... [more]
sp|Q3ZCI9|TCPQ_BOVIN1.117e-16047.24T-complex protein 1 subunit theta OS=Bos taurus OX... [more]
sp|Q5RAP1|TCPQ_PONAB6.762e-15747.61T-complex protein 1 subunit theta OS=Pongo abelii ... [more]
sp|P50990|TCPQ_HUMAN6.762e-15747.61T-complex protein 1 subunit theta OS=Homo sapiens ... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B1P81.573e-17950.18Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1S3HX705.003e-17951.13T-complex protein 1 subunit theta OS=Lingula ungui... [more]
A0A4E0RZX02.369e-17350.18T-complex protein subunit theta OS=Fasciola hepati... [more]
G4VPS54.180e-17349.27Putative chaperonin containing t-complex protein 1... [more]
A0A0X3PRR84.524e-17148.72T-complex protein 1 subunit theta OS=Schistocephal... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct82.507e-16046.67chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct85.873e-15946.28chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct41.123e-4727.45chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct51.173e-4527.38chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
tcp16.542e-4128.20t-complex 1 [Source:NCBI gene;Acc:103041096][more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct42.725e-5327.38chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct57.760e-5327.71chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct75.386e-2824.89chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002042.13.817e-1825.81pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
ENSPMAT00000002094.16.384e-1128.42pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT81.198e-11037.41Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT44.599e-5226.85Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT53.867e-4227.27Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT38.135e-4226.56Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT21.903e-3629.31Subunit beta of the cytosolic chaperonin Cct ring ... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388294.191e-15644.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299321.146e-4527.52T-complex protein 1 subunit delta [Source:UniProt... [more]
EDO495713.050e-4428.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354151.013e-4225.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274112.740e-4027.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct83.929e-17047.22chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct81.215e-15746.07chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct82.265e-15645.96chaperonin containing TCP1 subunit 8 [Source:NCBI ... [more]
cct43.248e-5528.70chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
tcp12.298e-4327.48t-complex 1 [Source:NCBI gene;Acc:101175451][more]
back to top
BLAST of T-complex protein 1 subunit theta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009544.10.000e+0100.00SMESG000009544.1[more]
SMESG000023665.10.000e+053.58SMESG000023665.1[more]
SMESG000023665.10.000e+053.51SMESG000023665.1[more]
SMESG000060610.12.022e-4827.72SMESG000060610.1[more]
SMESG000060610.13.337e-4827.72SMESG000060610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011774 ID=SMED30011774|Name=T-complex protein 1 subunit theta|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
TTTTCTTTAGTTTCCGTTGACTTAATAATTTGAAAGTTATTTCCTAGCAA
ATGGCTCATCATATACCGAAAGCTCCTGGATATTATTCCATGCTCAAAGA
TGGAGCCAGATATTTCCAAGGATTGGAAGAATCTGTAGTGAGAAATATTC
ACGCATGCAAGGCTCTCGGTAAAACTGTCTCAACAAGTTTCGGCCCGATG
GGTATGAATAAAATGGTAATTAATCACATCGAGAAAAAATTCGTAACGAA
AGACGCAGCGACTATATTAAGAGAACTAGAAGTTGCTCATCCTGCAGCTA
AAATTATGGTGCTGGCTGCTCAGCAGCAGGAACAAGAATGCGGAGAAGGT
ACAAACTATGTGATTCTTCTCATCACATCTTTACTGGAGAAAGCAGAAGA
ATTAATTGAGATGGGGCTATCTATAGTCAATATTACCGAAGGTTATGAAG
TAGCGGCGAAATTCTGTTTAAAGCAATTAAAAGGAATGGTACTGGAGAAT
ATTGATGTATTCAATAAGGAAAAGATTGGACAAGTCTTACATTGCACAAT
CCAATCTAAAATTCAGGATGATGACCAATACTTGTCCAAATTAGTTGCGG
ATGGATGTGTTAGCATTATGAGGGAAAAGAAAGAATTTGATACAGATAAC
ATGAGAATTGTCAAGATCTTGGGAGGAGGGGTTATCAACTCCCAGCTGGT
GAAAGGTATGGTATTTTGTAGAGATACTCAAGGCATTGTTAAAGAAGCTA
TAAATGCAAAGGTTGTCATATATTCCTGTCCATTTGATATTGTACAAACT
GAAACCAAGGGAACCATCCTGATCAACACTGCGGCTGAATTGACGGCCTT
CAGTAACGAGGAAGAAGAAGATATCGAATTGAAAATAAAGGAACTTGTGA
AATATGGAATAAAAGTTGTTATATCCGGTGGTAAAGTTGGAGATCTTGTA
TTACACTATGCAAACAAATATAAGTTGCTTGTCCTTAAGATAAATAGTAA
ATTCGACTTAAGAAGACTAAGTTCTGTCACTGGGGCTACGATTATGTCGA
ACTTGATTGTACCTTGTGCTCATGAAATTGGGCACATTGATCGGGTTTAC
ACTGACGAATTGGGCAAACGCGTTGTGGTTATCTTTGAACAAAAAGGCCT
GAAAGGTAATATAGCAAGTATTGTTGTTAGGGGAAGCATGGATGGACTTC
TCGATGAAGCAGAACGGGCAGTGGAAGATGCTATCAATACATATAAATGC
TTAACTAAAGAAAATGCAATCCTAGCAGGAGGTGGAGCAACGGAAATTCA
GTTGAGTCAGAAATTGACAGAAGAAGCTAACAAATGTAGTGATCTAAAAC
AGTATGCAATACGACAATTCGGTTCAAGTTTTGATTTGGTTGTAAAAGCA
CTGATTCAGAATACTGGAATGAAGGCAATTGATGCAGTGACGGAACTTCA
CCAACGGCATAATCAAGGACAGAAATTCGATGGACTGGTTTGCGGTGAAG
AAGCGGCGAAACTTGGAAATGTCATTGAAGCAAATATATTTGATTTATAT
TCAGTTCGTCATTGGGGGATAAAATTCGCGGCAGATGCGGCAATTTCAAT
TTTAAAAGTAGACCAAGTTATCATGGCTCGACCTGCTGGAGGAGTTGCCA
AACCCAAGCAGCCAGGGGCTCCAAATGAAGAATAATTTTAATTTGGTTAT
TATCATCAGAGTTTTACTGTTTTGAAAATGAGTGATTTCATTAAAGTTTA
TTGTTGAAGTTGCCATTTTTATTAATATTTTAGGAGTCATTAA
back to top

protein sequence of SMED30011774-orf-1

>SMED30011774-orf-1 ID=SMED30011774-orf-1|Name=SMED30011774-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=545bp
MAHHIPKAPGYYSMLKDGARYFQGLEESVVRNIHACKALGKTVSTSFGPM
GMNKMVINHIEKKFVTKDAATILRELEVAHPAAKIMVLAAQQQEQECGEG
TNYVILLITSLLEKAEELIEMGLSIVNITEGYEVAAKFCLKQLKGMVLEN
IDVFNKEKIGQVLHCTIQSKIQDDDQYLSKLVADGCVSIMREKKEFDTDN
MRIVKILGGGVINSQLVKGMVFCRDTQGIVKEAINAKVVIYSCPFDIVQT
ETKGTILINTAAELTAFSNEEEEDIELKIKELVKYGIKVVISGGKVGDLV
LHYANKYKLLVLKINSKFDLRRLSSVTGATIMSNLIVPCAHEIGHIDRVY
TDELGKRVVVIFEQKGLKGNIASIVVRGSMDGLLDEAERAVEDAINTYKC
LTKENAILAGGGATEIQLSQKLTEEANKCSDLKQYAIRQFGSSFDLVVKA
LIQNTGMKAIDAVTELHQRHNQGQKFDGLVCGEEAAKLGNVIEANIFDLY
SVRHWGIKFAADAAISILKVDQVIMARPAGGVAKPKQPGAPNEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR012721Chap_CCT_theta
IPR017998Chaperone_TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR002423Cpn60/TCP-1
IPR027410TCP-1-like_intermed_sf
IPR027413GROEL-like_equatorial_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
GO:0044183protein binding involved in protein folding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0006458'de novo' protein folding
GO:0061077chaperone-mediated protein folding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005832chaperonin-containing T-complex
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 384..404
NoneNo IPR availablePANTHERPTHR11353:SF19CHAPERONIN-CONTAINING TCP1, SUBUNIT 8 (THETA)coord: 12..536
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 12..536
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 41..57
score: 34.4
coord: 407..419
score: 44.21
coord: 93..112
score: 29.22
coord: 373..395
score: 33.71
coord: 63..81
score: 36.72
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 41..527
e-value: 4.3E-135
score: 451.1
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 219..369
e-value: 1.4E-138
score: 464.7
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 214..378
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 152..405
e-value: 1.4E-138
score: 464.7
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 155..405
IPR012721T-complex protein 1, theta subunitTIGRFAMTIGR02346TIGR02346coord: 12..536
e-value: 1.1E-188
score: 625.9
IPR012721T-complex protein 1, theta subunitCDDcd03341TCP1_thetacoord: 20..527
e-value: 0.0
score: 577.635
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 32..524
e-value: 1.4E-138
score: 464.7
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 26..527
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 65..81