GLTP domain-containing protein

Overview
NameGLTP domain-containing protein
Smed IDSMED30011768
Length (bp)788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GLTP domain-containing protein (SMED30011768) t-SNE clustered cells

Violin plots show distribution of expression levels for GLTP domain-containing protein (SMED30011768) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GLTP domain-containing protein (SMED30011768) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GLTP domain-containing protein (SMED30011768) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011768

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011768SMESG000032798.1 SMESG000032786.1 dd_Smed_v6_13523_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30011768SMESG000032798.1 SMESG000032786.1 dd_Smed_v4_13523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011768SMESG000032798.1 SMESG000032786.1 dd_Smed_v4_13523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GLTP domain-containing protein vs. Ensembl Human
Match: CPTP (ceramide-1-phosphate transfer protein [Source:HGNC Symbol;Acc:HGNC:28116])

HSP 1 Score: 58.5362 bits (140), Expect = 1.056e-9
Identity = 47/208 (22.60%), Postives = 94/208 (45.19%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCN--ELLKA---QEHSKDDSILFLKDA--LLYDTQFNGNFLTYS--SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENEN 693
            F+L  VL  FK+C+  +  +++L+ PY  +++ + RF + +   FSF+  +V S     E L+     EH +    +   +    L D +   +       +++ LHR L ++    E   T  +D+   S +  DSY  ++  +H W +++   + F TLP  ++   +       Q   ++ E +   + +Y    N+ QK   E+
Sbjct:    8 FNLKVVLVSFKQCL--DEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDAR-TSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVY----NVSQKLYAEH 208          
BLAST of GLTP domain-containing protein vs. Ensembl Celegans
Match: tag-296 (pep chromosome:WBcel235:I:10933810:10935553:-1 gene:WBGene00018632.1 transcript:F49D11.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-296)

HSP 1 Score: 63.1586 bits (152), Expect = 9.243e-12
Identity = 48/178 (26.97%), Postives = 89/178 (50.00%), Query Frame = 1
Query:  148 NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYD---TQFNGNFLTYSSIIWLHRPLEFILR-LFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWK----ILRTSTMQTDKIQTDDLMKEIIFIGKIIYEK 657
             PDD+ +  + E + E+ +F   +   F FV  +V+   + LLK + H+ +        AL++     + NG      +I+ L+R LEFI+  ++ A +   DDS P  +I  + Y  T+ + H W I+   K+  YTLP  +     L+  ++ TD+     L+ +++  GKI++ +
Sbjct:   40 TPDDVELLTFVEVYEELCKFIGMLGKIFEFVEKDVREKID-LLK-ELHTANPEGYKTVVALVHSEKPMEKNGKESGAVAILHLNRALEFIVEFMYAAVAATNDDSIP--KICKECYDGTLAKHHPWIIRTAVKVAVYTLPTREKMLDYLKAGSV-TDESLIRVLIDDVVSHGKIVHSR 212          
BLAST of GLTP domain-containing protein vs. Ensembl Celegans
Match: tag-296 (pep chromosome:WBcel235:I:10933810:10935553:-1 gene:WBGene00018632.1 transcript:F49D11.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-296)

HSP 1 Score: 62.7734 bits (151), Expect = 1.225e-11
Identity = 49/178 (27.53%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  148 NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYD---TQFNGNFLTYSSIIWLHRPLEFILR-LFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWK----ILRTSTMQTDKIQTDDLMKEIIFIGKIIYEK 657
             PDD+ +  + E + E+ +F   +   F FV  +V+   + LLK + H+ +        AL++     + NG      +I+ L+R LEFI+  ++ A +   DDS P  +I  + Y  T+ + H W I+   K+  YTLP  +     L+ S   TD+     L+ +++  GKI++ +
Sbjct:   40 TPDDVELLTFVEVYEELCKFIGMLGKIFEFVEKDVREKID-LLK-ELHTANPEGYKTVVALVHSEKPMEKNGKESGAVAILHLNRALEFIVEFMYAAVAATNDDSIP--KICKECYDGTLAKHHPWIIRTAVKVAVYTLPTREKMLDYLKGSV--TDESLIRVLIDDVVSHGKIVHSR 211          
BLAST of GLTP domain-containing protein vs. Ensembl Celegans
Match: K08E4.2 (pep chromosome:WBcel235:IV:12055670:12056464:-1 gene:WBGene00010666.1 transcript:K08E4.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08E4.2)

HSP 1 Score: 46.2098 bits (108), Expect = 3.735e-6
Identity = 32/105 (30.48%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  376 IIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFI--GKIIYEKTENMIQKFE 684
            ++ L+R LEF++ L +   T  D++   S IA  SY   + + HSWPI+       YTLP  K      ++ D  + DD     IF   G+ I  +   +++ FE
Sbjct:   62 LMVLNRALEFVIDLLDGVFTSNDEN--VSTIARSSYDKHLSQLHSWPIRTAVAAALYTLP-RKPEFLCRLRGDMPEDDDNQFHDIFNRDGRDIVRRVNKLVENFE 163          
BLAST of GLTP domain-containing protein vs. Ensembl Celegans
Match: K08E4.2 (pep chromosome:WBcel235:IV:12055674:12056656:-1 gene:WBGene00010666.1 transcript:K08E4.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08E4.2)

HSP 1 Score: 45.8246 bits (107), Expect = 8.267e-6
Identity = 32/105 (30.48%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  376 IIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFI--GKIIYEKTENMIQKFE 684
            ++ L+R LEF++ L +   T  D++   S IA  SY   + + HSWPI+       YTLP  K      ++ D  + DD     IF   G+ I  +   +++ FE
Sbjct:  104 LMVLNRALEFVIDLLDGVFTSNDEN--VSTIARSSYDKHLSQLHSWPIRTAVAAALYTLPR-KPEFLCRLRGDMPEDDDNQFHDIFNRDGRDIVRRVNKLVENFE 205          
BLAST of GLTP domain-containing protein vs. Ensembl Fly
Match: CG30392 (gene:FBgn0050392 transcript:FBtr0071618)

HSP 1 Score: 60.4622 bits (145), Expect = 1.286e-10
Identity = 36/143 (25.17%), Postives = 69/143 (48.25%), Query Frame = 1
Query:  148 NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNEL--LKAQEHSKDDSILFLKDALLYDTQFN-----GNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLP 555
            + DD+ +  Y  A+ EI +FF  +   FSFV  +V+S  + L  L+A++  + +     +  L Y+ +       G      +++ LHR L+F+         + DD      +  ++Y  T+G+ HS+ I++  +L  Y +P
Sbjct:   35 DEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVD-VCKEAYDDTLGKHHSFLIRKGARLAMYAMP 176          
BLAST of GLTP domain-containing protein vs. Ensembl Fly
Match: CG30392 (gene:FBgn0050392 transcript:FBtr0342889)

HSP 1 Score: 60.4622 bits (145), Expect = 1.286e-10
Identity = 36/143 (25.17%), Postives = 69/143 (48.25%), Query Frame = 1
Query:  148 NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNEL--LKAQEHSKDDSILFLKDALLYDTQFN-----GNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLP 555
            + DD+ +  Y  A+ EI +FF  +   FSFV  +V+S  + L  L+A++  + +     +  L Y+ +       G      +++ LHR L+F+         + DD      +  ++Y  T+G+ HS+ I++  +L  Y +P
Sbjct:   35 DEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVD-VCKEAYDDTLGKHHSFLIRKGARLAMYAMP 176          
BLAST of GLTP domain-containing protein vs. Ensembl Zebrafish
Match: cptp (ceramide-1-phosphate transfer protein [Source:NCBI gene;Acc:791641])

HSP 1 Score: 46.595 bits (109), Expect = 9.071e-6
Identity = 46/207 (22.22%), Postives = 86/207 (41.55%), Query Frame = 1
Query:   88 MGD-FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS---------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQK 678
            M D F L  VL  F+  +  N   ++ I+ Y   ++E+  F + +   FSF+  +V S    L            + ++  + Y+ + +   LT           +++ LHR L ++    E   T  +DS   S +  D+Y  ++   H W I++   + F  LP  +         D  Q   L+ E + +   +Y+ TE++  K
Sbjct:    1 MADAFSLQRVLETFRSSLSENK--EVYIKYYIAGWQELVSFMNSLGNVFSFISKDVVSKIQILENFLSGENGSHYVTIQSMVKYELENDLVDLTKRGSHPESGCRTLLRLHRALRWLELFLERLRTSTEDS-KTSVMCSDAYNESLANHHPWLIRKAVGVAFCALPGRETFFDVMNAGDHTQVVALLGESLPLIAEVYQITEDLYAK 204          
BLAST of GLTP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019781.1 (glycolipid transfer protein domain containing 2 [Source:NCBI gene;Acc:100490446])

HSP 1 Score: 55.4546 bits (132), Expect = 2.002e-8
Identity = 51/209 (24.40%), Postives = 99/209 (47.37%), Query Frame = 1
Query:   85 KMGDFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLK--AQEHSKDDSILF------LKDALLYDTQFNGNFLTYS--SIIWLHRPLEFI-LRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPD----WKILRTSTMQTDKI---QTDDLMKEIIFIGKIIYEK 657
            K  +F +  ++  F+ C+      DIL++ Y  A+R++ +F   +   F+F+     +  N L      EH KD   +       L++ ++   +   N +     +++ LHR L+F+ + L+    ++  D T  SQ+  D+Y  T+   HSW I+Q+ ++ F  LP     +K++  S  +  KI    T D + ++  I + +Y K
Sbjct:   86 KQHEFQIGRMVEAFRYCM--TEKKDILLEEYLIAWRQLIKFMDALGTVFTFISSETMTKVNILQGYLNGEHGKDYRTVTSMVKYELENEVVNFKELPPNRVPSGCRTLLRLHRALKFLEVFLYNLGMSVGKDKT--SQMCADAYHKTLSHHHSWFIRQVAEVAFLALPPIEDMYKVVCVSNHKDAKIVLLTTVDAIVKVYNITQEVYTK 290          
BLAST of GLTP domain-containing protein vs. Ensembl Xenopus
Match: mxd3 (MAX dimerization protein 3 [Source:Xenbase;Acc:XB-GENE-867571])

HSP 1 Score: 50.0618 bits (118), Expect = 8.441e-7
Identity = 37/162 (22.84%), Postives = 71/162 (43.83%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS---------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLP 555
            F L  VL  FK C+  ++  DI+++ Y   ++ + RF + +   FSFV  +  +    +      +  +    L+  + ++   +   LT           +I+ LHR L ++    E   T  +DS   S +  ++Y  ++  FH W I++   + F  LP
Sbjct:    8 FSLKEVLVSFKSCLV-DDDQDIIVEQYLNGWKGLVRFMNSLGTIFSFVSKDAVTKIQIMENYLAGTNGERYRTLQSMVEHELSSDLVDLTKRCNNPDSGCRTILRLHRALRWLQLFLEKLRTSNEDS-KTSTLCTEAYNDSLANFHPWIIRKTATVAFLALP 167          
BLAST of GLTP domain-containing protein vs. Ensembl Mouse
Match: Cptp (ceramide-1-phosphate transfer protein [Source:MGI Symbol;Acc:MGI:1933107])

HSP 1 Score: 60.4622 bits (145), Expect = 1.242e-10
Identity = 44/199 (22.11%), Postives = 90/199 (45.23%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSS-----------IIWLHRPLEFILRLFEAFSTLEDD---STPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKI-LRTSTMQTDKIQTDDLMKEIIFIGKI 645
            DF+L  VL  FK+C+   +  ++L+  Y   ++ + RF + +   FSF+  +V +    + + +   + +    L+  + Y+       + + S           ++ LHR L ++    +   T  +D   ST CS+    +Y  T+  +HSW ++Q   + F  LP  K+ L    M++ +   + L + + FI  +
Sbjct:    7 DFNLKVVLVSFKQCL--TDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSE----AYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHV 199          
BLAST of GLTP domain-containing protein vs. Ensembl Mouse
Match: Cptp (ceramide-1-phosphate transfer protein [Source:MGI Symbol;Acc:MGI:1933107])

HSP 1 Score: 60.4622 bits (145), Expect = 1.262e-10
Identity = 44/199 (22.11%), Postives = 90/199 (45.23%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSS-----------IIWLHRPLEFILRLFEAFSTLEDD---STPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKI-LRTSTMQTDKIQTDDLMKEIIFIGKI 645
            DF+L  VL  FK+C+   +  ++L+  Y   ++ + RF + +   FSF+  +V +    + + +   + +    L+  + Y+       + + S           ++ LHR L ++    +   T  +D   ST CS+    +Y  T+  +HSW ++Q   + F  LP  K+ L    M++ +   + L + + FI  +
Sbjct:    7 DFNLKVVLVSFKQCL--TDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSE----AYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHV 199          
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VCQ0|CPTP_BOVIN (Ceramide-1-phosphate transfer protein OS=Bos taurus OX=9913 GN=CPTP PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.641e-10
Identity = 50/213 (23.47%), Postives = 96/213 (45.07%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLT------------YSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEII-FIGKIIYEKTENMIQKFENEN 693
            +F+L  VL  FK+C+  N  +++L++ Y   +R + RF + +   FSF+  +V +    + + +   + +    L+  + Y+    GN L               +++ LHR L ++    E   T  +D+   S +  DSY  ++  +H W I++   + F  LP  K+   S       Q  +++ E + FI     E+  N+ QK   E+
Sbjct:    7 EFNLKVVLVSFKQCL--NEKEEVLLEYYLAGWRGLVRFLNSLGTIFSFISKDVVTKLQIMDQLRSGPQQEHYSSLQAMVAYEV---GNQLVDLERRSRHPDSGCRTVLRLHRALRWLQLFLEGVRTSPEDAR-TSVLCTDSYNASLATYHPWIIRRAVTVAFCALPTRKVFLESMNVGSSEQAVEMLNEALPFI-----ERVYNISQKLYAEH 208          
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XIS2|CPTP_RAT (Ceramide-1-phosphate transfer protein OS=Rattus norvegicus OX=10116 GN=Cptp PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.417e-10
Identity = 47/202 (23.27%), Postives = 92/202 (45.54%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLT--------------YSSIIWLHRPLEFILRLFEAFSTLEDD---STPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKI-LRTSTMQTDKIQTDDLMKEIIFIGKI 645
            DF+L  VL  FK+C+   +  ++L+  Y  +++ + RF + +   FSF+  +V S    +   +   + +  + L+  + Y+     N L                 +++ LHR L ++    E   T  +D   ST CS    ++Y  T+  +HSW ++Q   + F+ LP  K+ L    M + +   + L + + FI ++
Sbjct:    7 DFNLKVVLISFKKCL--TDKGEVLLDHYTASWKGLVRFLNSLGAVFSFISKDVVSKLQIMEHLRSGPQSEHYISLQSMVAYEV---SNKLVDRDSRSRPRHPNSGCRTVLRLHRALHWLQLFLEGLRTSSEDARTSTLCS----EAYNATLAAYHSWIVRQAVNVAFHALPPRKVFLEAMNMGSSEQAVEMLGEALPFIEQV 199          
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BS40|CPTP_MOUSE (Ceramide-1-phosphate transfer protein OS=Mus musculus OX=10090 GN=Cptp PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 8.829e-10
Identity = 44/199 (22.11%), Postives = 90/199 (45.23%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSS-----------IIWLHRPLEFILRLFEAFSTLEDD---STPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKI-LRTSTMQTDKIQTDDLMKEIIFIGKI 645
            DF+L  VL  FK+C+   +  ++L+  Y   ++ + RF + +   FSF+  +V +    + + +   + +    L+  + Y+       + + S           ++ LHR L ++    +   T  +D   ST CS+    +Y  T+  +HSW ++Q   + F  LP  K+ L    M++ +   + L + + FI  +
Sbjct:    7 DFNLKVVLVSFKQCL--TDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSE----AYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHV 199          
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5TA50|CPTP_HUMAN (Ceramide-1-phosphate transfer protein OS=Homo sapiens OX=9606 GN=CPTP PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 5.071e-9
Identity = 47/208 (22.60%), Postives = 94/208 (45.19%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCN--ELLKA---QEHSKDDSILFLKDA--LLYDTQFNGNFLTYS--SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENEN 693
            F+L  VL  FK+C+  +  +++L+ PY  +++ + RF + +   FSF+  +V S     E L+     EH +    +   +    L D +   +       +++ LHR L ++    E   T  +D+   S +  DSY  ++  +H W +++   + F TLP  ++   +       Q   ++ E +   + +Y    N+ QK   E+
Sbjct:    8 FNLKVVLVSFKQCL--DEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDAR-TSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVY----NVSQKLYAEH 208          
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66JG2|CPTP_XENTR (Ceramide-1-phosphate transfer protein OS=Xenopus tropicalis OX=8364 GN=cptp PE=2 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.472e-6
Identity = 37/162 (22.84%), Postives = 71/162 (43.83%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS---------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLP 555
            F L  VL  FK C+  ++  DI+++ Y   ++ + RF + +   FSFV  +  +    +      +  +    L+  + ++   +   LT           +I+ LHR L ++    E   T  +DS   S +  ++Y  ++  FH W I++   + F  LP
Sbjct:    8 FSLKEVLVSFKSCLV-DDDQDIIVEQYLNGWKGLVRFMNSLGTIFSFVSKDAVTKIQIMENYLAGTNGERYRTLQSMVEHELSSDLVDLTKRCNNPDSGCRTILRLHRALRWLQLFLEKLRTSNEDS-KTSTLCTEAYNDSLANFHPWIIRKTATVAFLALP 167          
BLAST of GLTP domain-containing protein vs. TrEMBL
Match: R7UWU3 (GLTP domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_174770 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.512e-21
Identity = 67/213 (31.46%), Postives = 100/213 (46.95%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNEL------LKAQEHSK-DDSILFLKDALLYDTQFNGNFLT-YSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSP 708
            DFDL  VL+ FK C   +    ++++ Y +AFRE+ RFF      F FV  +++   N +       KA  +S   D + F     L D + N        +++ LHR  +FIL+     S  ED+S+  + IA D Y  T+ R H W IQ+M  L  Y LP  K L     +    Q   L+ E++  G+ IY  T+ +   +E  NL   P
Sbjct:    9 DFDLERVLTCFKRCTSASADGSLVMRDYIDAFRELCRFFELTGRLFGFVARDLQGKINVMEHHLNSKKAHHYSTIQDMVAFETATCLTDHKHNNKIPNGCRTLLRLHRSFQFILQFMHELSLSEDESS-VAAIAGDVYRETLARHHPWVIQKMAALALYALPCRKDLIDIMCRQPHDQVLKLLGEVVEAGQPIYSATDEL---YEQANLLNLP 217          
BLAST of GLTP domain-containing protein vs. TrEMBL
Match: A0A023EIM1 (Putative cytoplasm OS=Aedes albopictus OX=7160 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.721e-19
Identity = 57/208 (27.40%), Postives = 100/208 (48.08%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTN-NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS-------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENL 696
            FDL  V   F+ C+  N N DD+ + PY EAF+E+ +FFS +   F FV  +VK     L K ++H+ D    F     + D + +GN L          +++ LHR L+FI    +    LE  +     +   +Y  T+ +FH W I++   +  Y +P+   L    +  D      L+ E++ + + +Y++T+N+   ++   L
Sbjct:    6 FDLQKVHGSFERCLAGNDNEDDVFLDPYLEAFKELYKFFSLMGTVFGFVSSDVKEKVEILEKLRKHA-DHGERFETVRSMMDYERDGNLLAKKDYVSGSRTLLRLHRGLDFIYLFLKRLGELESANANTCAVCQTAYNETLAQFHPWLIRKGVVMAMYAMPNRDQL-LEKVCLDASLAIKLLPEMLGVARQVYDRTQNLYTVYDMHGL 211          
BLAST of GLTP domain-containing protein vs. TrEMBL
Match: A0A182HB98 (GLTP domain-containing protein OS=Aedes albopictus OX=7160 GN=109417267 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.458e-19
Identity = 57/208 (27.40%), Postives = 100/208 (48.08%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTN-NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS-------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENL 696
            FDL  V   F+ C+  N N DD+ + PY EAF+E+ +FFS +   F FV  +VK     L K ++H+ D    F     + D + +GN L          +++ LHR L+FI    +    LE  +     +   +Y  T+ +FH W I++   +  Y +P+   L    +  D      L+ E++ + + +Y++T+N+   ++   L
Sbjct:    6 FDLQKVHGSFERCLAGNDNEDDVFLDPYLEAFKELYKFFSLMGTVFGFVSSDVKEKVEILEKLRKHA-DHGERFETVRSMMDYERDGNLLAKKDYVSGSRTLLRLHRGLDFIYLFLKRLGELESANANTCAVCQTAYNETLAQFHPWLIRKGAVMAMYAMPNRDQL-LEKVCLDASLAIKLLPEMLGVARQVYDRTQNLYTLYDMHGL 211          
BLAST of GLTP domain-containing protein vs. TrEMBL
Match: A0A182H8G5 (GLTP domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG024032 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.207e-18
Identity = 56/210 (26.67%), Postives = 100/210 (47.62%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICT---NNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS-------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENL 696
            FDL  V   F+ C+     +N DD+ + PY EAF+E+ +FFS +   F FV  +VK     L K ++H+ D    F     + D + +GN L          +++ LHR L+FI    +    LE  +     +   +Y  T+ +FH W I++   +  Y +P+   L    +  D      L+ E++ + + +Y++T+N+   ++   L
Sbjct:    6 FDLQKVHGSFERCLAVTGNDNEDDVFLDPYLEAFKELYKFFSLMGTVFGFVSSDVKEKVEILEKLRKHA-DHGERFETVRSMMDYERDGNLLAKKDYVSGSRTLLRLHRGLDFIYLFLKRLGELESANANTCAVCQTAYNETLAQFHPWLIRKGAVMAMYAMPNRDQL-LEKVCLDASLAIKLLPEMLGVARQVYDRTQNLYTLYDMHGL 213          
BLAST of GLTP domain-containing protein vs. TrEMBL
Match: A0A182P5K4 (GLTP domain-containing protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.733e-18
Identity = 58/210 (27.62%), Postives = 105/210 (50.00%), Query Frame = 1
Query:   97 FDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFN----GNFLTYS-SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTD-----DLMKEIIFIGKIIYEKTENMIQKFENENL 696
            FDL  V +KF E +  +  DD+ + PY EAF+E+ +FF  +   F FV  +VK     L K +     DS L ++  + Y+ + N     ++++ S +++ LHR L+FI    +    LE D    + +   +Y  T+ +FH W I++   +  Y LP      T     DK+  D      L+ E++ + + +Y++T+N+  +++   L
Sbjct:    6 FDLEKVHAKFTESL--HGEDDVYVDPYLEAFKELYKFFQLMGTVFGFVSSDVKEKVEILEKLRGKENADSFLTIRTMMEYEQESNLLNKKDYVSGSRTLLRLHRGLDFIQEFLKRLGELEGDG-KTNGVCQAAYNDTLAQFHPWLIRKGATVAMYALP------TRDQLLDKVCADVAGAMKLLPEMLSVTRNVYDRTQNLYTRYDLHGL 206          
BLAST of GLTP domain-containing protein vs. Ensembl Cavefish
Match: cptp (ceramide-1-phosphate transfer protein [Source:NCBI gene;Acc:103046412])

HSP 1 Score: 47.3654 bits (111), Expect = 4.211e-6
Identity = 40/163 (24.54%), Postives = 70/163 (42.94%), Query Frame = 1
Query:   94 DFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSS---------IIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLP 555
             F L  VL  FK  +  N   +I IQ Y   ++E+  F + +   FSF+  +  +    L   Q        L ++  + Y+ +     LT  S         ++ LHR L ++    E   T  ++S   S +  D+Y  ++ + H+W I++ T + F  LP
Sbjct:    4 SFSLQNVLDTFKSSLSENK--EIYIQYYIAGWKELVSFMNSLGTVFSFISKDAVNKIQILENLQAGESGSHYLTVQSMVKYELENELVDLTKRSSHPESGCRTLLRLHRALLWLELFLERLRTSTEES-KTSVMCSDAYNESLAQHHAWIIRKATGVAFCALP 163          
BLAST of GLTP domain-containing protein vs. Ensembl Nematostella
Match: EDO47801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL48])

HSP 1 Score: 50.8322 bits (120), Expect = 7.896e-8
Identity = 45/191 (23.56%), Postives = 83/191 (43.46%), Query Frame = 1
Query:  160 ILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS---------SIIWLHRPLEFILRLFEAFS-TLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWK--ILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENL 696
            I++  Y   + E+  FF  +   F F+  +V+     L   +E    D    +K    ++ +   N LT +         +++ LHR L F +   +  S + E DS+  S +A +SY  T+  +H W I++   L  YTL      I + S    D+     L+ E +   + +Y+ TE +  +++   L
Sbjct:    1 IIVDEYVRGYDELCIFFDSLGSVFGFITSDVRDKIGILQHHREAENGDEYTDVKAMFEFEIE---NKLTDAKTQPLSGSRTLLRLHRALAFTMLFMKRLSESHEGDSS--SALASESYNKTLAAYHPWLIRKAALLAMYTLASVGDMIKKASAESADQESAQKLLCEAVEAIQPVYDTTEELYTEYDLHGL 186          
BLAST of GLTP domain-containing protein vs. Ensembl Nematostella
Match: EDO28656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5V4])

HSP 1 Score: 45.8246 bits (107), Expect = 4.029e-6
Identity = 43/191 (22.51%), Postives = 81/191 (42.41%), Query Frame = 1
Query:  160 ILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS---------SIIWLHRPLEFILRLFEAFS-TLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWK--ILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENL 696
            I++  Y   + E+  FF  +   F F+  +V+     L   +          +K    ++ +   N LT +         +++ LHR L F +   +  S + E DS+  S +A +SY  T+  +H W I++   L  YTL      I + S    D+     L+ E +   + +Y+ TE +  +++   L
Sbjct:    1 IIVDEYVRGYDELCIFFDSLGSVFGFITSDVRDKIGILQHHRGAENGGEYTDVKAMFEFEIE---NKLTDAKTQPLSGSRTLLRLHRALAFTMLFMKRLSESHEGDSS--SALASESYNKTLAAYHPWLIRKAALLAMYTLASVGDMIKKASAESADQESAQKLLCEAVEAIQPVYDTTEELYTEYDLHGL 186          
BLAST of GLTP domain-containing protein vs. Planmine SMEST
Match: SMESG000032798.1 (SMESG000032798.1)

HSP 1 Score: 431.409 bits (1108), Expect = 1.877e-155
Identity = 209/210 (99.52%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   88 MGDFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPLSD 717
            MGDFDLSYVLSKFKECICTNNPDDIL+QPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPLSD
Sbjct:    1 MGDFDLSYVLSKFKECICTNNPDDILLQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPLSD 210          
BLAST of GLTP domain-containing protein vs. Planmine SMEST
Match: SMESG000032786.1 (SMESG000032786.1)

HSP 1 Score: 332.413 bits (851), Expect = 2.036e-116
Identity = 161/162 (99.38%), Postives = 162/162 (100.00%), Query Frame = 1
Query:  232 SFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPLSD 717
            SFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPL+D
Sbjct:   41 SFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFENENLKTSPLND 202          

HSP 2 Score: 65.0846 bits (157), Expect = 1.684e-12
Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2
Query:  110 MFSVSSKNAFALTIRTIF*YNLIVKLSEKLQDFF 211
            MFSVSSKNAFALTIRTIF YNLIVKLSEKLQDFF
Sbjct:    1 MFSVSSKNAFALTIRTIFYYNLIVKLSEKLQDFF 34          
BLAST of GLTP domain-containing protein vs. Planmine SMEST
Match: SMESG000071987.1 (SMESG000071987.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.355e-9
Identity = 46/169 (27.22%), Postives = 78/169 (46.15%), Query Frame = 1
Query:  148 NPDDILIQPYCEAFREIARFFSFINIGFSFVGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYS-------------SIIWLHRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKLLFYTLPDWKILRTSTMQTDKIQTDDL 615
            N  D+ I+ YCE ++E+ARF +     FSFV  +V+     L+K          L L ++  Y T   G+ + Y              + + LHR L+F+  +FE    + +D      I  +SY  T+G +H W I++  K+    LP +K     ++  ++ QTD +
Sbjct:   16 NESDVSIELYCEGYKELARFLNSFGSIFSFVVSDVELKIGILMK----------LILNNSECYKTL--GSMIEYELPNVRSHTDSGCRTFLRLHRALKFLYLIFEQI--MSNDDKSLKSIINESYDETLGVYHPWLIRKGVKVAVNFLP-YKDKFVDSVLKEQPQTDQM 169          
The following BLAST results are available for this feature:
BLAST of GLTP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CPTP1.056e-922.60ceramide-1-phosphate transfer protein [Source:HGNC... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tag-2969.243e-1226.97pep chromosome:WBcel235:I:10933810:10935553:-1 gen... [more]
tag-2961.225e-1127.53pep chromosome:WBcel235:I:10933810:10935553:-1 gen... [more]
K08E4.23.735e-630.48pep chromosome:WBcel235:IV:12055670:12056464:-1 ge... [more]
K08E4.28.267e-630.48pep chromosome:WBcel235:IV:12055674:12056656:-1 ge... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG303921.286e-1025.17gene:FBgn0050392 transcript:FBtr0071618[more]
CG303921.286e-1025.17gene:FBgn0050392 transcript:FBtr0342889[more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cptp9.071e-622.22ceramide-1-phosphate transfer protein [Source:NCBI... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000019781.12.002e-824.40glycolipid transfer protein domain containing 2 [S... [more]
mxd38.441e-722.84MAX dimerization protein 3 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cptp1.242e-1022.11ceramide-1-phosphate transfer protein [Source:MGI ... [more]
Cptp1.262e-1022.11ceramide-1-phosphate transfer protein [Source:MGI ... [more]
back to top
BLAST of GLTP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VCQ0|CPTP_BOVIN1.641e-1023.47Ceramide-1-phosphate transfer protein OS=Bos tauru... [more]
sp|Q5XIS2|CPTP_RAT3.417e-1023.27Ceramide-1-phosphate transfer protein OS=Rattus no... [more]
sp|Q8BS40|CPTP_MOUSE8.829e-1022.11Ceramide-1-phosphate transfer protein OS=Mus muscu... [more]
sp|Q5TA50|CPTP_HUMAN5.071e-922.60Ceramide-1-phosphate transfer protein OS=Homo sapi... [more]
sp|Q66JG2|CPTP_XENTR4.472e-622.84Ceramide-1-phosphate transfer protein OS=Xenopus t... [more]
back to top
BLAST of GLTP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UWU34.512e-2131.46GLTP domain-containing protein OS=Capitella teleta... [more]
A0A023EIM12.721e-1927.40Putative cytoplasm OS=Aedes albopictus OX=7160 PE=... [more]
A0A182HB983.458e-1927.40GLTP domain-containing protein OS=Aedes albopictus... [more]
A0A182H8G52.207e-1826.67GLTP domain-containing protein OS=Aedes albopictus... [more]
A0A182P5K43.733e-1827.62GLTP domain-containing protein OS=Anopheles epirot... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cptp4.211e-624.54ceramide-1-phosphate transfer protein [Source:NCBI... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO478017.896e-823.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286564.029e-622.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GLTP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLTP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032798.11.877e-15599.52SMESG000032798.1[more]
SMESG000032786.12.036e-11699.38SMESG000032786.1[more]
SMESG000071987.11.355e-927.22SMESG000071987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011768 ID=SMED30011768|Name=GLTP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=788bp
GATTTTCAAACTAACCTTATAAATTTCTTCATTTAATTTAGTTACAAGTG
ATAAATTGTACCAGATAAATCAATAGACAAATATAAAATGGGTGATTTTG
ATCTTAGTTATGTTCTCAGTAAGTTCAAAGAATGCATTTGCACTAACAAT
CCGGACGATATTTTAATACAACCTTATTGTGAAGCTTTCAGAGAAATTGC
AAGATTTTTTTCATTCATCAATATTGGATTTTCTTTTGTTGGAATGAATG
TAAAGAGCAGTTGTAATGAACTCCTCAAAGCACAAGAGCATTCCAAAGAT
GATTCTATTTTATTTCTAAAAGATGCACTCTTATATGATACCCAATTCAA
TGGAAATTTCTTAACTTATTCATCAATTATTTGGCTACATAGACCTTTAG
AATTCATACTTCGACTCTTTGAAGCATTCTCTACATTGGAAGACGATTCT
ACTCCATGTTCACAAATAGCACTTGATAGCTACTTACCAACTATGGGCAG
GTTTCATTCGTGGCCAATTCAACAAATGACCAAATTGTTGTTTTATACAT
TGCCAGATTGGAAAATCTTAAGAACAAGCACGATGCAAACCGATAAAATT
CAAACAGACGATCTTATGAAAGAAATAATTTTTATAGGGAAAATAATTTA
CGAAAAAACCGAAAACATGATTCAAAAATTTGAGAATGAAAACTTAAAGA
CATCTCCCCTGAGTGACATTGATTAGATAATACAGAAATTATTTATTTGA
ATTAAAATTAAACTTAATTAAATCATATAGATCGGAAG
back to top

protein sequence of SMED30011768-orf-1

>SMED30011768-orf-1 ID=SMED30011768-orf-1|Name=SMED30011768-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MGDFDLSYVLSKFKECICTNNPDDILIQPYCEAFREIARFFSFINIGFSF
VGMNVKSSCNELLKAQEHSKDDSILFLKDALLYDTQFNGNFLTYSSIIWL
HRPLEFILRLFEAFSTLEDDSTPCSQIALDSYLPTMGRFHSWPIQQMTKL
LFYTLPDWKILRTSTMQTDKIQTDDLMKEIIFIGKIIYEKTENMIQKFEN
ENLKTSPLSDID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0120009intermembrane lipid transfer
GO:0046836glycolipid transport
Vocabulary: molecular function
TermDefinition
GO:0120013intermembrane lipid transfer activity
GO:0051861glycolipid binding
GO:0017089glycolipid transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036497GLTP_sf
IPR014830Glycolipid_transfer_prot_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014830Glycolipid transfer protein domainPFAMPF08718GLTPcoord: 25..161
e-value: 3.5E-18
score: 66.3
IPR036497Glycolipid transfer protein superfamilyGENE3DG3DSA:1.10.3520.10coord: 2..203
e-value: 1.6E-31
score: 111.5
IPR036497Glycolipid transfer protein superfamilySUPERFAMILYSSF110004Glycolipid transfer protein, GLTPcoord: 19..201
NoneNo IPR availablePANTHERPTHR10219GLYCOLIPID TRANSFER PROTEIN-RELATEDcoord: 3..190
NoneNo IPR availablePANTHERPTHR10219:SF43CERAMIDE-1-PHOSPHATE TRANSFER PROTEINcoord: 3..190