Tetratricopeptide repeat domain 8

Overview
NameTetratricopeptide repeat domain 8
Smed IDSMED30011766
Length (bp)1613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat domain 8 (SMED30011766) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat domain 8 (SMED30011766) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat domain 8 (SMED30011766) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat domain 8 (SMED30011766) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011766SMESG000047940.1 SMESG000044097.1 SmedASXL_013438SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011766SMESG000047940.1 SMESG000044097.1 dd_Smed_v6_15780_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011766SMESG000047940.1 SMESG000044097.1 dd_Smed_v4_15780_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:HGNC Symbol;Acc:HGNC:20087])

HSP 1 Score: 303.523 bits (776), Expect = 1.351e-149
Identity = 137/268 (51.12%), Postives = 197/268 (73.51%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ+AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV+ AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 272          

HSP 2 Score: 247.669 bits (631), Expect = 1.351e-149
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  268 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 503          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:HGNC Symbol;Acc:HGNC:20087])

HSP 1 Score: 295.434 bits (755), Expect = 3.332e-147
Identity = 137/278 (49.28%), Postives = 197/278 (70.86%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ          +AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV+ AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 282          

HSP 2 Score: 248.054 bits (632), Expect = 3.332e-147
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  278 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 513          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:HGNC Symbol;Acc:HGNC:20087])

HSP 1 Score: 295.434 bits (755), Expect = 3.332e-147
Identity = 137/278 (49.28%), Postives = 197/278 (70.86%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ          +AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV+ AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 282          

HSP 2 Score: 248.054 bits (632), Expect = 3.332e-147
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  278 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 513          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:HGNC Symbol;Acc:HGNC:20087])

HSP 1 Score: 289.656 bits (740), Expect = 2.031e-145
Identity = 137/294 (46.60%), Postives = 198/294 (67.35%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDV--------------------------RHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ+AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV                          ++AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 298          

HSP 2 Score: 247.669 bits (631), Expect = 2.031e-145
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  294 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 529          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:HGNC Symbol;Acc:HGNC:20087])

HSP 1 Score: 289.656 bits (740), Expect = 2.031e-145
Identity = 137/294 (46.60%), Postives = 198/294 (67.35%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDV--------------------------RHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ+AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV                          ++AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 298          

HSP 2 Score: 247.669 bits (631), Expect = 2.031e-145
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  294 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 529          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Celegans
Match: bbs-8 (Tetratricopeptide repeat protein 8 [Source:UniProtKB/Swiss-Prot;Acc:Q23049])

HSP 1 Score: 216.083 bits (549), Expect = 3.946e-103
Identity = 103/263 (39.16%), Postives = 166/263 (63.12%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFY 882
             +KA   F+ +++ E    C   L KN  DQ+ W LKM+      YVD+L+N+  G+ E  L+ N I+  A+PGTSF +   + + +N  +RP + +GRP+SG +R  +     S  + +V++AR A TAR +S+ S R +R+GTASM +   G F+NL RLN+ KYA+ P +N+ LFEY++Y+ ND+R A ++A  A++   F+D +WK QL KCY RL + +DA +Q +S+L  + ++E +  L K + ++DQP+ +L+ Y
Sbjct:   12 FIKACRLFRENRLAEAEAVCTNLLRKNPLDQATWALKMQCLSDSTYVDELENEDMGLAETFLDQNVIAPNARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGS-MDQAVRTARTAKTARAVSSTSARNMRLGTASMAAGADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLIETFALLSKAYNRVDQPMAALKTY 273          

HSP 2 Score: 179.104 bits (453), Expect = 3.946e-103
Identity = 86/237 (36.29%), Postives = 144/237 (60.76%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L+    GL+ FP N+++L   +R+ E L + ++  +L++ +L+ ++ NIE IA +A+ Y+Y  + ++A+++YRR+ QMGV + EL  N+ LCC  +QQFD  ++    A +  T    A+V+YNIG I + IGD   A ++FR+ALSHD +HSES  NLG+L+ ++  ID A++   ++ + N  +FE ++N GL++   G        I+K+L  FP H     I   L  L+ S+
Sbjct:  270 LKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEAIACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIEKALAAFPEHEHCKKILNHLKPLYESI 506          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Fly
Match: BBS8 (gene:FBgn0031255 transcript:FBtr0078058)

HSP 1 Score: 130.954 bits (328), Expect = 3.442e-32
Identity = 67/211 (31.75%), Postives = 121/211 (57.35%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSN-VAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQAS---------ITTNSCLFESHFNF 1448
            +I+     L ++   +D  P +++  L ++RI++ + Q E   +L++   +   +N+E +ASIA  YFY++  ++AL +YRR+  +G Q+ EL  N+ALCC Y  Q D+ + CF  AL  AT+    ++++YN+  +A++ GD +LA +  +L L+ D ++  + NNL VL  Q  +I  AK++L A+         +TTN    + H+  
Sbjct:  339 RIKQPERALLVIGEVVDSRPFDVTYRLEQARIHQAMEQQEDALQLYRLAAKLHPINVESLASIAVGYFYDNNPEMALMYYRRILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQKSDIWYNLSFVAVTSGDFNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDVMPDAAEVTTNLQFMDVHYKL 549          

HSP 2 Score: 108.612 bits (270), Expect = 9.765e-25
Identity = 79/252 (31.35%), Postives = 120/252 (47.62%), Query Frame = 1
Query:  184 QSAWLLKMKASFFKIYVDDLDNDQSG--ITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYT-ARPISTASGRFVRIGTASMISSPGGSFINL----------PRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFK-----DC----WWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSL 873
            +  W LKM+A   ++YVDDLD D  G   TE  +    I+  A+PG+S K     +   +Q     ++  R     +  S+D  + S+   S   AR   + +RP S+   R    GTAS I +   +  N+           RLN   YA R TL K+LF+++YYHE DV+ A  L     E  + K      C    WW+ Q+G+C   L   R AE   + +L + P  + YL L +++Q++ QP  +L
Sbjct:  104 EGVWQLKMRALTQRVYVDDLDEDDGGNEATE-EVEFERIATAARPGSSIKTAFQPRPLTSQ----RAQQARSRGAGVAHSSDGRLNSSRPGSAAVARPGTSLSRPGSSLGSR---CGTASRIRATSAAAFNVGDATSKLYQASRLNPTIYAERETLVKALFQFLYYHEADVQKAHSLCQAVLEVERQKPSGSTGCTLSWWWQQQMGRCLLALHYPRRAEPFLQQSLTSFPHPDTYLLLSRVYQRIKQPERAL 347          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Zebrafish
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:678551])

HSP 1 Score: 270.781 bits (691), Expect = 4.402e-87
Identity = 127/266 (47.74%), Postives = 180/266 (67.67%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ---------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENL-NQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKI 840
            +T+ M+ L  A    +  +   C   C   L ++ YDQ         + W LK +A    +Y+D+++ +Q GI +M L+++SI+ VA+PGTS ++   +Q      A+RPM++SGRPI+GF+R S  +      E ++++ R A TARP+S+ASGRFVR+GTASM++ P G FINL RLNL KYA RP L K+LFEYI++HENDV+ AL+LAA ATE  QFKD WWK+QLGKCY+RL L R+AE+QFRSAL  Q  ++ +L+L K+
Sbjct:    3 VTVSMDPLFLAWSSCRRRRFQRCADICSTLLAESPYDQVRDAERLALAVWSLKTRALTEMVYIDEVEVEQEGIADMMLDESSIAQVARPGTSLRRPATSQAGAPTPAVRPMTQSGRPITGFVRPSTLSGRPETMEQAIRTPRTASTARPVSSASGRFVRLGTASMLTHPDGPFINLSRLNLAKYAKRPNLCKTLFEYIFHHENDVKTALDLAALATEHAQFKDWWWKVQLGKCYYRLGLLREAEKQFRSALAQQEFVDTHLYLAKV 268          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Zebrafish
Match: bbs4 (Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-060126-2])

HSP 1 Score: 40.817 bits (94), Expect = 5.655e-6
Identity = 44/197 (22.34%), Postives = 82/197 (41.62%), Query Frame = 3
Query:  903 PLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYL 1493
            P N  LL     +Y  L + +K  E     L  D  N + I +  S        D+A+  YR       ++  L NN+ +C F  +++   I+C   A  L+      ++ YN+G++ L++   + AF     A++     SE Y  L V     ++ + A+   + ++  +      + NF +     GD + + L
Sbjct:  199 PENTELLTTLGLLYMQLGKYQKAFEHLGNALTYDPNNFKAILAAGSMMQTHGDYDVAMNKYRVAAYAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLSPFD--WKILYNLGLVHLTMQQFASAFHFLSAAINLRPRMSELYMLLAVALTNLDDAENARRSYEQAVQIDESSPLVNLNFAVFLYNQGDKKAALL 393          

HSP 2 Score: 29.261 bits (64), Expect = 5.655e-6
Identity = 28/79 (35.44%), Postives = 40/79 (50.63%), Query Frame = 1
Query:  658 RHALELAAFATECNQFKDCWWKIQ--LGKCYFRLCLYRDAEQQFRSAL-VNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            + A+E+   A   NQ KD  W+I   LG CY     +R AE+Q   AL +N+  L  Y+ LGKI         +++ YK
Sbjct:  118 KAAIEVYNEAARLNQ-KD--WEISHNLGVCYIYTKDFRSAEEQLNLALQLNKHDL-TYMMLGKIHLLQGDTEKAIDVYK 192          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:733857])

HSP 1 Score: 291.967 bits (746), Expect = 7.620e-148
Identity = 137/272 (50.37%), Postives = 194/272 (71.32%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQ-ENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRH-------ALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            LL+A  YF+  K + C   C + L +  YDQ AW LK +A    +YVD++D DQ GI EM L++N+I+ VA+PGTS K+ V  + +  + A+RP+++SGRPISGF+R S  +      E ++K+ R A TARPI++ SGR+VR+GTASM+++P G FINL RLNL  Y   P L K+LFEYI++HEND ++       ALELAA ATE + FKD WWK+QLGKCY+RL LYR+AE+QF+SAL  Q +++ +L+LGK++ ++DQP+T+L  +K
Sbjct:    8 LLQAWSYFRRRKFELCSQTCSRILEQEPYDQVAWSLKTRALTEMVYVDEIDVDQEGIAEMMLDENAIAQVARPGTSLKQAVGKKFDGPSPAVRPVTQSGRPISGFVRPSTQSGRPGTMEQAIKTPRTASTARPITSTSGRYVRLGTASMLTNPDGPFINLSRLNLANYVQHPYLAKTLFEYIFHHENDAKNVSISICSALELAALATEESNFKDWWWKVQLGKCYYRLGLYREAEKQFKSALTQQNMVDIFLYLGKVYIRMDQPLTALTVFK 279          

HSP 2 Score: 253.832 bits (647), Expect = 7.620e-148
Identity = 116/238 (48.74%), Postives = 171/238 (71.85%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L + + GLD+FP  +S+L A +RI+E +N      E ++ +L+QDN NIE IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL +CCFY+QQ+DM +T F  AL+LA  + +VAEV+YN+G +A+ IGD +LA+Q F+L LS++N+H+E+YNNL VLEM+K +++ A+A LQ S +    ++E H NF  L+EK GDLQ+SY++ +KS   FP+H +T  + + L + F+ +
Sbjct:  275 LTVFKQGLDRFPKEVSILCAVARIHEEMNNMSSATEYYKEVLKQDNTNIEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLFNNLGMCCFYAQQYDMILTSFERALSLAENEGDVAEVWYNLGHVAVGIGDLNLAYQCFKLTLSNNNDHAEAYNNLAVLEMRKNHVEQARALLQTSSSLAPHMYEPHVNFAFLSEKIGDLQSSYVAAQKSAAAFPDHVETQQLIEKLRQHFAVI 512          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:733857])

HSP 1 Score: 290.812 bits (743), Expect = 1.376e-147
Identity = 137/276 (49.64%), Postives = 194/276 (70.29%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQS-----------AWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQ-ENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            LL+A  YF+  K + C   C + L +  YDQ            AW LK +A    +YVD++D DQ GI EM L++N+I+ VA+PGTS K+ V  + +  + A+RP+++SGRPISGF+R S  +      E ++K+ R A TARPI++ SGR+VR+GTASM+++P G FINL RLNL  Y   P L K+LFEYI++HEND ++ALELAA ATE + FKD WWK+QLGKCY+RL LYR+AE+QF+SAL  Q +++ +L+LGK++ ++DQP+T+L  +K
Sbjct:    8 LLQAWSYFRRRKFELCSQTCSRILEQEPYDQHCLDTPHPSLSVAWSLKTRALTEMVYVDEIDVDQEGIAEMMLDENAIAQVARPGTSLKQAVGKKFDGPSPAVRPVTQSGRPISGFVRPSTQSGRPGTMEQAIKTPRTASTARPITSTSGRYVRLGTASMLTNPDGPFINLSRLNLANYVQHPYLAKTLFEYIFHHENDAKNALELAALATEESNFKDWWWKVQLGKCYYRLGLYREAEKQFKSALTQQNMVDIFLYLGKVYIRMDQPLTALTVFK 283          

HSP 2 Score: 253.832 bits (647), Expect = 1.376e-147
Identity = 116/238 (48.74%), Postives = 171/238 (71.85%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L + + GLD+FP  +S+L A +RI+E +N      E ++ +L+QDN NIE IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL +CCFY+QQ+DM +T F  AL+LA  + +VAEV+YN+G +A+ IGD +LA+Q F+L LS++N+H+E+YNNL VLEM+K +++ A+A LQ S +    ++E H NF  L+EK GDLQ+SY++ +KS   FP+H +T  + + L + F+ +
Sbjct:  279 LTVFKQGLDRFPKEVSILCAVARIHEEMNNMSSATEYYKEVLKQDNTNIEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLFNNLGMCCFYAQQYDMILTSFERALSLAENEGDVAEVWYNLGHVAVGIGDLNLAYQCFKLTLSNNNDHAEAYNNLAVLEMRKNHVEQARALLQTSSSLAPHMYEPHVNFAFLSEKIGDLQSSYVAAQKSAAAFPDHVETQQLIEKLRQHFAVI 516          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:733857])

HSP 1 Score: 298.516 bits (763), Expect = 1.768e-138
Identity = 137/265 (51.70%), Postives = 194/265 (73.21%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQ-ENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            LL+A  YF+  K + C   C + L +  YDQ AW LK +A    +YVD++D DQ GI EM L++N+I+ VA+PGTS K+ V  + +  + A+RP+++SGRPISGF+R S  +      E ++K+ R A TARPI++ SGR+VR+GTASM+++P G FINL RLNL  Y   P L K+LFEYI++HEND ++ALELAA ATE + FKD WWK+QLGKCY+RL LYR+AE+QF+SAL  Q +++ +L+LGK++ ++DQP+T+L  +K
Sbjct:    8 LLQAWSYFRRRKFELCSQTCSRILEQEPYDQVAWSLKTRALTEMVYVDEIDVDQEGIAEMMLDENAIAQVARPGTSLKQAVGKKFDGPSPAVRPVTQSGRPISGFVRPSTQSGRPGTMEQAIKTPRTASTARPITSTSGRYVRLGTASMLTNPDGPFINLSRLNLANYVQHPYLAKTLFEYIFHHENDAKNALELAALATEESNFKDWWWKVQLGKCYYRLGLYREAEKQFKSALTQQNMVDIFLYLGKVYIRMDQPLTALTVFK 272          

HSP 2 Score: 216.083 bits (549), Expect = 1.768e-138
Identity = 105/238 (44.12%), Postives = 155/238 (65.13%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L + + GLD+FP  +S+L A +RI+E +N      E ++ +L+QDN NIE IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL +CCFY+QQ+DM +T F  AL+LA  + +VAEV+YN+G +A+ IGD +LA+Q F+L LS++N+H+E+YNNL VLEM+K ++                            E+ GDLQ+SY++ +KS   FP+H +T  + + L + F+ +
Sbjct:  268 LTVFKQGLDRFPKEVSILCAVARIHEEMNNMSSATEYYKEVLKQDNTNIEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLFNNLGMCCFYAQQYDMILTSFERALSLAENEGDVAEVWYNLGHVAVGIGDLNLAYQCFKLTLSNNNDHAEAYNNLAVLEMRKNHV----------------------------EQIGDLQSSYVAAQKSAAAFPDHVETQQLIEKLRQHFAVI 477          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:733857])

HSP 1 Score: 254.218 bits (648), Expect = 3.574e-135
Identity = 116/238 (48.74%), Postives = 171/238 (71.85%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L + + GLD+FP  +S+L A +RI+E +N      E ++ +L+QDN NIE IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL +CCFY+QQ+DM +T F  AL+LA  + +VAEV+YN+G +A+ IGD +LA+Q F+L LS++N+H+E+YNNL VLEM+K +++ A+A LQ S +    ++E H NF  L+EK GDLQ+SY++ +KS   FP+H +T  + + L + F+ +
Sbjct:  238 LTVFKQGLDRFPKEVSILCAVARIHEEMNNMSSATEYYKEVLKQDNTNIEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLFNNLGMCCFYAQQYDMILTSFERALSLAENEGDVAEVWYNLGHVAVGIGDLNLAYQCFKLTLSNNNDHAEAYNNLAVLEMRKNHVEQARALLQTSSSLAPHMYEPHVNFAFLSEKIGDLQSSYVAAQKSAAAFPDHVETQQLIEKLRQHFAVI 475          

HSP 2 Score: 249.21 bits (635), Expect = 3.574e-135
Identity = 120/265 (45.28%), Postives = 174/265 (65.66%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQ-ENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            LL+A  YF+  K + C   C + L +  YDQ AW LK +A    +YVD++D DQ GI EM L++N+I+ VA+PGTS K+ V  + +  + A+RP+++SGRPISGF+R S  +      E ++K+ R A TARPI++ SGR+VR+GT                              +LFEYI++HEND ++ALELAA ATE + FKD WWK+QLGKCY+RL LYR+AE+QF+SAL  Q +++ +L+LGK++ ++DQP+T+L  +K
Sbjct:    8 LLQAWSYFRRRKFELCSQTCSRILEQEPYDQVAWSLKTRALTEMVYVDEIDVDQEGIAEMMLDENAIAQVARPGTSLKQAVGKKFDGPSPAVRPVTQSGRPISGFVRPSTQSGRPGTMEQAIKTPRTASTARPITSTSGRYVRLGT------------------------------TLFEYIFHHENDAKNALELAALATEESNFKDWWWKVQLGKCYYRLGLYREAEKQFKSALTQQNMVDIFLYLGKVYIRMDQPLTALTVFK 242          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Match: TTC8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:733857])

HSP 1 Score: 299.671 bits (766), Expect = 1.069e-130
Identity = 137/265 (51.70%), Postives = 194/265 (73.21%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQ-ENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            LL+A  YF+  K + C   C + L +  YDQ AW LK +A    +YVD++D DQ GI EM L++N+I+ VA+PGTS K+ V  + +  + A+RP+++SGRPISGF+R S  +      E ++K+ R A TARPI++ SGR+VR+GTASM+++P G FINL RLNL  Y   P L K+LFEYI++HEND ++ALELAA ATE + FKD WWK+QLGKCY+RL LYR+AE+QF+SAL  Q +++ +L+LGK++ ++DQP+T+L  +K
Sbjct:    8 LLQAWSYFRRRKFELCSQTCSRILEQEPYDQVAWSLKTRALTEMVYVDEIDVDQEGIAEMMLDENAIAQVARPGTSLKQAVGKKFDGPSPAVRPVTQSGRPISGFVRPSTQSGRPGTMEQAIKTPRTASTARPITSTSGRYVRLGTASMLTNPDGPFINLSRLNLANYVQHPYLAKTLFEYIFHHENDAKNALELAALATEESNFKDWWWKVQLGKCYYRLGLYREAEKQFKSALTQQNMVDIFLYLGKVYIRMDQPLTALTVFK 272          

HSP 2 Score: 188.734 bits (478), Expect = 1.069e-130
Identity = 99/238 (41.60%), Postives = 152/238 (63.87%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L + + GLD+FP  +S+L A +RI+E    S       + +L +D +      SI  +Y +E           RL QMGV   +L NNL +CCFY+QQ+DM +T F  AL+LA  + +VAEV+YN+G +A+ IGD +LA+Q F+L LS++N+H+E+YNNL VLEM+K +++ A+A LQ S +    ++E H NF  L+EK GDLQ+SY++ +KS   FP+H +T  + + L + F+ +
Sbjct:  268 LTVFKQGLDRFPKEVSILCAVARIHE---VSVFFFFFTKFVL-RDRVQTRFPNSI--HYHHE-----------RLLQMGVYNCQLFNNLGMCCFYAQQYDMILTSFERALSLAENEGDVAEVWYNLGHVAVGIGDLNLAYQCFKLTLSNNNDHAEAYNNLAVLEMRKNHVEQARALLQTSSSLAPHMYEPHVNFAFLSEKIGDLQSSYVAAQKSAAAFPDHVETQQLIEKLRQHFAVI 488          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Match: Ttc8 (tetratricopeptide repeat domain 8 [Source:MGI Symbol;Acc:MGI:1923510])

HSP 1 Score: 300.827 bits (769), Expect = 7.994e-151
Identity = 136/268 (50.75%), Postives = 196/268 (73.13%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL+A  YF+  K   C   C + L K+ YDQ+AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N      QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI +HENDV+ AL+LA+ +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFK 272          

HSP 2 Score: 254.218 bits (648), Expect = 7.994e-151
Identity = 117/236 (49.58%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N S    E ++ +L+QDN ++E IA I SN+FY DQ ++AL+FYRRL QMGV   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G IA+ IGD +LA Q FRLAL H+N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP H DT  + K L + F+
Sbjct:  268 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFA 503          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Match: Ttc8 (tetratricopeptide repeat domain 8 [Source:MGI Symbol;Acc:MGI:1923510])

HSP 1 Score: 292.738 bits (748), Expect = 1.785e-148
Identity = 136/278 (48.92%), Postives = 196/278 (70.50%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL+A  YF+  K   C   C + L K+ YDQ          +AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N      QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI +HENDV+ AL+LA+ +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFK 282          

HSP 2 Score: 254.218 bits (648), Expect = 1.785e-148
Identity = 117/236 (49.58%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLAT-KSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N S    E ++ +L+QDN ++E IA I SN+FY DQ ++AL+FYRRL QMGV   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G IA+ IGD +LA Q FRLAL H+N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP H DT  + K L + F+
Sbjct:  278 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFA 513          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Match: Ttc8 (tetratricopeptide repeat domain 8 [Source:MGI Symbol;Acc:MGI:1923510])

HSP 1 Score: 253.447 bits (646), Expect = 2.666e-81
Identity = 109/206 (52.91%), Postives = 159/206 (77.18%), Query Frame = 1
Query:  226 IYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKI 840
            +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N      QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI +HENDV+ AL+LA+ +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K+
Sbjct:    2 VYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKV 207          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Match: Tmtc4 (transmembrane and tetratricopeptide repeat containing 4 [Source:MGI Symbol;Acc:MGI:1921050])

HSP 1 Score: 51.9878 bits (123), Expect = 1.555e-6
Identity = 43/186 (23.12%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  972 KELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQ-KENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPN 1526
            ++LF++ L    +N ++  +I  N   +     A+K+YR   ++  + V  MNNL        +        +LA+ +  + + A  + N+GI+  S+     A Q++R A+ H  ++ + Y NLG L      ++D   A+  A++         + N  +L + TG+L  +    +++L + PN
Sbjct:  468 EQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAVQI--QPDFAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWN-NMIILLDNTGNLAQAEAVGREALQLIPN 650          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Match: Tmtc4 (transmembrane and tetratricopeptide repeat containing 4 [Source:MGI Symbol;Acc:MGI:1921050])

HSP 1 Score: 51.9878 bits (123), Expect = 1.555e-6
Identity = 43/186 (23.12%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  972 KELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQ-KENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPN 1526
            ++LF++ L    +N ++  +I  N   +     A+K+YR   ++  + V  MNNL        +        +LA+ +  + + A  + N+GI+  S+     A Q++R A+ H  ++ + Y NLG L      ++D   A+  A++         + N  +L + TG+L  +    +++L + PN
Sbjct:  468 EQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAVQI--QPDFAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWN-NMIILLDNTGNLAQAEAVGREALQLIPN 650          
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Match: sp|Q8VD72|TTC8_MOUSE (Tetratricopeptide repeat protein 8 OS=Mus musculus OX=10090 GN=Ttc8 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.077e-147
Identity = 136/278 (48.92%), Postives = 196/278 (70.50%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL+A  YF+  K   C   C + L K+ YDQ          +AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N      QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI +HENDV+ AL+LA+ +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFK 282          

HSP 2 Score: 254.218 bits (648), Expect = 1.077e-147
Identity = 117/236 (49.58%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLAT-KSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N S    E ++ +L+QDN ++E IA I SN+FY DQ ++AL+FYRRL QMGV   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G IA+ IGD +LA Q FRLAL H+N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP H DT  + K L + F+
Sbjct:  278 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFA 513          
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Match: sp|Q8TAM2|TTC8_HUMAN (Tetratricopeptide repeat protein 8 OS=Homo sapiens OX=9606 GN=TTC8 PE=1 SV=2)

HSP 1 Score: 281.567 bits (719), Expect = 3.052e-142
Identity = 137/304 (45.07%), Postives = 198/304 (65.13%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFK-KVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDV--------------------------RHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M  LL A  YF+  K   C   C + L K+ YDQ          +AW+LK +A    +Y+D++D DQ GI EM L++N+I+ V +PGTS K    N     +QA+RP++++GRPI+GF+R S  +      E ++++ R AYTARPI+++SGRFVR+GTASM++SP G FINL RLNL KY+ +P L K+LFEYI++HENDV                          ++AL+LAA +TE +Q+KD WWK+Q+GKCY+RL +YR+AE+QF+SAL  Q +++ +L+L K++  LDQPVT+L  +K
Sbjct:    5 MEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFK 308          

HSP 2 Score: 247.669 bits (631), Expect = 3.052e-142
Identity = 114/236 (48.31%), Postives = 165/236 (69.92%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GLDKFP  ++LL   +RIYE +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMG+   +L NNL LCCFY+QQ+DM +T F  AL+LA  +   A+V+YN+G +A+ IGD +LA Q FRLAL ++N H+E+YNNL VLEM+K +++ A+A LQ + +    ++E HFNF  +++K GDLQ SY++ +KS   FP+H DT  + K L + F+
Sbjct:  304 LNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFA 539          
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Match: sp|Q23049|TTC8_CAEEL (Tetratricopeptide repeat protein 8 OS=Caenorhabditis elegans OX=6239 GN=bbs-8 PE=2 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 4.089e-102
Identity = 103/263 (39.16%), Postives = 166/263 (63.12%), Query Frame = 1
Query:   94 LLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFY 882
             +KA   F+ +++ E    C   L KN  DQ+ W LKM+      YVD+L+N+  G+ E  L+ N I+  A+PGTSF +   + + +N  +RP + +GRP+SG +R  +     S  + +V++AR A TAR +S+ S R +R+GTASM +   G F+NL RLN+ KYA+ P +N+ LFEY++Y+ ND+R A ++A  A++   F+D +WK QL KCY RL + +DA +Q +S+L  + ++E +  L K + ++DQP+ +L+ Y
Sbjct:   12 FIKACRLFRENRLAEAEAVCTNLLRKNPLDQATWALKMQCLSDSTYVDELENEDMGLAETFLDQNVIAPNARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGS-MDQAVRTARTAKTARAVSSTSARNMRLGTASMAAGADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLIETFALLSKAYNRVDQPMAALKTY 273          

HSP 2 Score: 179.104 bits (453), Expect = 4.089e-102
Identity = 86/237 (36.29%), Postives = 144/237 (60.76%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            L+    GL+ FP N+++L   +R+ E L + ++  +L++ +L+ ++ NIE IA +A+ Y+Y  + ++A+++YRR+ QMGV + EL  N+ LCC  +QQFD  ++    A +  T    A+V+YNIG I + IGD   A ++FR+ALSHD +HSES  NLG+L+ ++  ID A++   ++ + N  +FE ++N GL++   G        I+K+L  FP H     I   L  L+ S+
Sbjct:  270 LKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEAIACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIEKALAAFPEHEHCKKILNHLKPLYESI 506          
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Match: sp|Q6YZI0|SPY_ORYSJ (Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.130e-7
Identity = 42/158 (26.58%), Postives = 76/158 (48.10%), Query Frame = 3
Query: 1059 QSDI--ALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPN 1526
            + DI   + +Y++         + M NL +       F+M I  + LAL    +   AE   N+G+I     +   A + +++ALS     S+S NNLGV+   +  +D A + +Q +I  NS   E++ N G+L    G + ++  + +K L + P+
Sbjct:  265 EGDINQGVAYYKKALFYNWHYADAMYNLGVAYGEMLNFEMAIVFYELALHFNPR--CAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAASSMIQKAIFANSTYAEAYNNLGVLYRDAGSITSAVQAYEKCLQIDPD 420          
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Match: sp|Q8RVB2|SPY_SOLLC (Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.439e-6
Identity = 40/158 (25.32%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1059 QSDI--ALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPN 1526
            + DI   + +Y++         + M NL +      +FDM I  + LA       + AE   N+G+I     +   A + ++LALS     S+S NNLGV+   +  +D A + ++ +I  N    E++ N G+L    G++  +  + ++ L + P+
Sbjct:  279 EGDINQGVAYYKKALCYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHF--NPHCAEACNNLGVIYKDRDNLDKAVECYQLALSIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPD 434          
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Match: R7TJS4 (TPR_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_163723 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 6.521e-152
Identity = 141/267 (52.81%), Postives = 202/267 (75.66%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M+ L  A  YF+  K ++C+  C + L KN YDQ+AW LK +A   ++Y+D++D D+ GI E+ ++DNSI+ VA+PGTS K     Q   +Q +RPMS+SGRP++GF+R    +      E ++++ R A+TARP+++ASGR+VR+GTASM+SSP G FINL RLN+ KY++RP L KSLFEYI++HENDVR+AL+LA+ ATE  QF+D WWK+QLGKCY+RL +YRDAE+QF+SAL  Q +++ YL+L K++ +LDQP+T++E YK
Sbjct:    1 MDPLFLAYSYFRRRKYEQCVELCSQLLDKNPYDQAAWSLKTRALTEQVYIDEVDVDEEGIAELIMDDNSIAQVARPGTSLKVPGTGQGAPSQGVRPMSQSGRPLTGFVRPGTQSTRPGTMEQAIRTPRTAHTARPVTSASGRYVRLGTASMLSSPDGPFINLARLNMPKYSARPNLAKSLFEYIFHHENDVRNALDLASGATEACQFQDWWWKVQLGKCYYRLGMYRDAEKQFKSALKQQDMVDTYLYLCKVYVRLDQPLTAVEVYK 267          

HSP 2 Score: 252.292 bits (643), Expect = 6.521e-152
Identity = 112/235 (47.66%), Postives = 169/235 (71.91%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            + + + GL +F    SLL   +R+YE +N      + ++ +L QDNM+IE IA I ++YFY DQ +IALKFYRRL QMGV   EL NNL LCCFY+QQ+DM +TCF  AL+LA+  N+++V+YNIG +AL IGD +LA+Q+FRLAL+ +N+H+E+YNNLGVLEM+K  ++M++AF QA+      ++E H+NF  +++K GDLQ+S+ + +++ + F +H D+  +  SL + F+
Sbjct:  263 VEVYKQGLQRFIGEASLLTGIARVYEGMNDMSNTVQFYKDVLHQDNMSIEAIACIGTHYFYTDQPEIALKFYRRLLQMGVYNTELFNNLGLCCFYAQQYDMTLTCFERALSLASDDNMSDVWYNIGHVALGIGDLTLAYQSFRLALASNNDHAEAYNNLGVLEMKKGRLEMSRAFFQAAFNLAPHMYEPHYNFASMSDKVGDLQSSFNAARRASDAFSDHMDSKQLLSSLRKHFA 497          
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Match: A0A267E7G3 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015055g1 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 7.637e-152
Identity = 137/268 (51.12%), Postives = 196/268 (73.13%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVV--NTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFY 882
            M+ L +AL  F+  K ++CI  C + L KN YD++AWLLKM+A   ++YVDD++ND+ G+ E  L+D++I++VA+PGTS +          L QAMRP ++SGRP++GF+R     +   + E ++K+ R A  ARP++++SGR VR+GTASM+SSP G FINL RLN  KYA +P ++++LFEYI YHENDVR AL+LAA ATE +QF+D WWK+QL +CY++L L+RD EQQ RSA+  Q  LE+YL LGK++ KLDQP+ +++ Y
Sbjct:    1 MDPLFQALSLFRRRKYEKCIEKCTEILDKNSYDEAAWLLKMQALTEQVYVDDIENDEDGMAEGLLDDSAIASVARPGTSLRVATAGGGSGGLQQAMRPSTQSGRPVTGFVRPGTQGSGAGSLEQALKTPRTASNARPVTSSSGRLVRLGTASMLSSPDGPFINLSRLNFSKYAPKPQMSRALFEYILYHENDVRTALQLAAMATEAHQFQDWWWKLQLARCYYKLGLFRDCEQQLRSAMKQQECLESYLLLGKVYTKLDQPLAAIDNY 268          

HSP 2 Score: 265.774 bits (678), Expect = 7.637e-152
Identity = 116/231 (50.22%), Postives = 172/231 (74.46%), Query Frame = 3
Query:  888 GLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            GL KFP +  LL   +RI E L   EK  E ++ +L  D MN+E +ASIA+ YFY DQ ++ALK YRRL Q+G+ + EL  NLALCCFY+QQ+DMC+TCF+ A+T+A K  +A+V+YN+G +AL++GD SL++Q FRLALS++N+H+E+YNNLGVLE+++ N++MA++F QA+ T +  +FE H+N  ++AE+ GDLQ++Y S+ ++   FPNH D+ D+  +L   FS +
Sbjct:  271 GLTKFPNDRCLLTGLARIQEGLGNLEKAAECYKDVLRYDAMNVEALASIATQYFYNDQPELALKLYRRLLQLGLASAELYTNLALCCFYAQQYDMCLTCFDRAITVAKKEELADVWYNLGHVALAVGDLSLSYQAFRLALSYNNDHAEAYNNLGVLELRRNNLEMARSFFQAASTLSPSMFEPHYNVAIMAERMGDLQSAYQSVNRAQQFFPNHSDSKDMLNALKVHFSEI 501          
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Match: A0A267GHU1 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015055g2 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 8.509e-152
Identity = 137/268 (51.12%), Postives = 196/268 (73.13%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVV--NTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFY 882
            M+ L +AL  F+  K ++CI  C + L KN YD++AWLLKM+A   ++YVDD++ND+ G+ E  L+D++I++VA+PGTS +          L QAMRP ++SGRP++GF+R     +   + E ++K+ R A  ARP++++SGR VR+GTASM+SSP G FINL RLN  KYA +P ++++LFEYI YHENDVR AL+LAA ATE +QF+D WWK+QL +CY++L L+RD EQQ RSA+  Q  LE+YL LGK++ KLDQP+ +++ Y
Sbjct:   20 MDPLFQALSLFRRRKYEKCIEKCTEILDKNSYDEAAWLLKMQALTEQVYVDDIENDEDGMAEGLLDDSAIASVARPGTSLRVATAGGGSGGLQQAMRPSTQSGRPVTGFVRPGTQGSGAGSLEQALKTPRTASNARPVTSSSGRLVRLGTASMLSSPDGPFINLSRLNFAKYAPKPQMSRALFEYILYHENDVRTALQLAAMATEAHQFQDWWWKLQLARCYYKLGLFRDCEQQLRSAMKQQECLESYLLLGKVYTKLDQPLAAIDNY 287          

HSP 2 Score: 265.774 bits (678), Expect = 8.509e-152
Identity = 116/231 (50.22%), Postives = 172/231 (74.46%), Query Frame = 3
Query:  888 GLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            GL KFP +  LL   +RI E L   EK  E ++ +L  D MN+E +ASIA+ YFY DQ ++ALK YRRL Q+G+ + EL  NLALCCFY+QQ+DMC+TCF+ A+T+A K  +A+V+YN+G +AL++GD SL++Q FRLALS++N+H+E+YNNLGVLE+++ N++MA++F QA+ T +  +FE H+N  ++AE+ GDLQ++Y S+ ++   FPNH D+ D+  +L   FS +
Sbjct:  290 GLTKFPNDRCLLTGLARIQEGLGNLEKAAECYKDVLRYDAMNVEALASIATQYFYNDQPELALKLYRRLLQLGLASAELYTNLALCCFYAQQYDMCLTCFDRAITVAKKEELADVWYNLGHVALAVGDLSLSYQAFRLALSYNNDHAEAYNNLGVLELRRNNLEMARSFFQAASTLSPSMFEPHYNVAIMAERMGDLQSAYQSVNRAQQFFPNHSDSKDMLNALKVHFSEI 520          
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Match: C3ZKQ7 (TPR_REGION domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_115983 PE=4 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.868e-151
Identity = 140/266 (52.63%), Postives = 196/266 (73.68%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFY 882
            M+ L  AL  F+  K ++C+  C   L KN YDQ+AW LKM+A   ++YVD++D D+ GI EM ++DN+I+ VA+PGTS KK   +    +  +RP S+SGRP+SGF+R           E ++++ R A+TARP+++ASGRFVR+GTASM+S+P G FINL RLN  KYA+R +L K LFEYI++HENDVR+ALELAA ATE  QFKD WWK+QL KCY+RL L+RDAE+Q +SALV Q +++ YL+L K++ ++DQP+T++E +
Sbjct:    8 MDPLYTALSLFRRRKFEDCVTVCTMLLEKNPYDQAAWTLKMRALTEQLYVDEVDVDEEGIAEMLMDDNAIAEVARPGTSLKKPGTSSGGPSPGVRPTSQSGRPLSGFVRPGTQGGRPGTMEQAIRTPRTAHTARPVTSASGRFVRLGTASMLSTPDGPFINLARLNFHKYAARQSLAKPLFEYIFHHENDVRNALELAALATEEAQFKDWWWKVQLAKCYYRLGLFRDAERQLKSALVQQVMVDTYLYLCKVYVRMDQPLTAIEVF 273          

HSP 2 Score: 254.218 bits (648), Expect = 2.868e-151
Identity = 112/235 (47.66%), Postives = 165/235 (70.21%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            + +   GL+ FP  +SLL   +RIY+ LN S    + ++ +L  DN ++E IA IA+++FY DQ +IAL+F+RRL QMGV   EL  N+ LCCFY+QQ+DM + CF  A+ LA+  N+A+++YNIG +AL IGD +LA+Q F+LAL+ +N+H+ESYNNLGVLE +K  ++ A+AF Q +      +FE H+NF  L+EK GDLQ+SY++ +KS+  FP H D+N + K L + F+
Sbjct:  270 IEVFSQGLEHFPGEVSLLTGIARIYDGLNDSTNAVKFYKEVLHHDNTHVEAIACIATHHFYTDQPEIALRFFRRLLQMGVYNSELFCNIGLCCFYAQQYDMTLNCFERAIALASDENMADIWYNIGHVALGIGDIALAYQCFKLALASNNDHAESYNNLGVLEWKKGRVEQARAFFQTAQMLAPIMFEPHYNFAALSEKMGDLQSSYIAARKSVESFPEHMDSNSLLKQLKDHFA 504          
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Match: K1P4M1 (Tetratricopeptide repeat protein 8 OS=Crassostrea gigas OX=29159 GN=CGI_10011809 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 3.065e-151
Identity = 138/267 (51.69%), Postives = 197/267 (73.78%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M+ L  A  Y++  K ++C   C + L KN YDQ++W LK +A   ++YVD++D D+ GI EM ++DN+I+ V++PGTS K+    +   +Q +RPMS+SGRP+SGF+R S         E ++ + R A+TARP+++ASGR+VR+GTASM+S+P G FINL RLN  KYA+RP L K+LFEYI++HENDVR+ALELAA ATE  QFKD WWK+QL KCY+RL +YRDAE+Q +S+L  Q  ++ YL+L K++ +LDQP+T++E +K
Sbjct:    1 MDPLFLAYSYYRRKKYEQCTEICTQLLEKNPYDQASWTLKTRALTGQVYVDEVDVDEEGIAEMVMDDNTIAQVSRPGTSLKQPGTGRGAPSQGVRPMSQSGRPLSGFVRPSTQGGRPGTMEKAIMTPRTAHTARPVTSASGRYVRLGTASMLSTPDGPFINLARLNFTKYAARPNLAKALFEYIFHHENDVRNALELAALATEACQFKDWWWKVQLAKCYYRLGMYRDAEKQLKSSLKQQDHVDTYLYLCKVYCRLDQPLTAIEVFK 267          

HSP 2 Score: 257.684 bits (657), Expect = 3.065e-151
Identity = 113/235 (48.09%), Postives = 172/235 (73.19%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            + + + GL+KF    +L+   +RIYE +N  +   + ++ +L  D+M +E IA IA+N+FY DQ ++ALKFYRRL QMGV   EL NNL LCCFY+QQ+DM +TCF  AL+LA +  ++EV+YNIG +AL IGD +LA+Q FRL L+++N+H+E+YNNLGVLE++K +++MA+AF QA++     ++E H+N+  LA++ GDLQ+SY + K++++ FPNH D+ ++ K L   FS
Sbjct:  263 IEVFKQGLEKFQGETTLMTGIARIYEGMNDMDNAVKFYKDVLYYDSMYVEAIACIATNHFYTDQPEVALKFYRRLLQMGVYNAELFNNLGLCCFYAQQYDMTLTCFERALSLAEEVTLSEVWYNIGHVALGIGDMTLAYQAFRLTLANNNDHAEAYNNLGVLELRKGHVEMARAFFQAALGLAPHMYEPHYNWAALADQLGDLQSSYNAAKRAVDAFPNHVDSKELLKQLKHHFS 497          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:103039229])

HSP 1 Score: 305.064 bits (780), Expect = 1.090e-97
Identity = 139/272 (51.10%), Postives = 200/272 (73.53%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN-LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            +TL M+ L  A  YF+  K  +C   C K L  + YDQ+AW LK +A    +Y+D+++ DQ GI E+ L+++SI+ VA+PGTS +    +       A+RPM++SGRPI+GF+R S  +      E ++++ R A TARP++++SGRFVR+GTASM+++P G FINL RLNL KY+ +P L+K+LFEYI++HENDV++AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL +Q  ++ YL+L K++Q+LDQP+T+L  +K
Sbjct:    3 VTLSMDPLFLAWSYFRRRKFQKCSDICTKVLEDSPYDQAAWSLKTRAVTEMVYIDEVEVDQEGIAEIMLDESSIAQVARPGTSLRLPGTSHGGGPTPAVRPMTQSGRPITGFVRPSTQSGRPGTMEQAIRTPRTANTARPVTSSSGRFVRLGTASMLTNPDGPFINLSRLNLAKYSQKPNLSKTLFEYIFHHENDVKNALDLAALATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNHQEFVDTYLYLAKVYQRLDQPITALNLFK 274          

HSP 2 Score: 210.305 bits (534), Expect = 1.530e-61
Identity = 96/208 (46.15%), Postives = 143/208 (68.75%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTL-ATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEK 1466
            ++      L + + GLD FP  ++LL   +RI+E +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L ++    A+V+YN+G +A+ IGD  LA+Q F+LAL+ +N+H+E+YNNL  LE++K  I+ AKAFLQ + T    ++E H+NF +L++K
Sbjct:  262 RLDQPITALNLFKQGLDHFPGEVTLLTGIARIHEEMNNITSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMTLSSFERALALVSSDEEQADVWYNLGHVAVGIGDLPLAYQCFKLALAFNNDHAEAYNNLAALELRKGRIEQAKAFLQTAATLAPHMYEPHYNFAILSDK 469          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:103039229])

HSP 1 Score: 305.449 bits (781), Expect = 1.979e-97
Identity = 139/272 (51.10%), Postives = 200/272 (73.53%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN-LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            +TL M+ L  A  YF+  K  +C   C K L  + YDQ+AW LK +A    +Y+D+++ DQ GI E+ L+++SI+ VA+PGTS +    +       A+RPM++SGRPI+GF+R S  +      E ++++ R A TARP++++SGRFVR+GTASM+++P G FINL RLNL KY+ +P L+K+LFEYI++HENDV++AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL +Q  ++ YL+L K++Q+LDQP+T+L  +K
Sbjct:    3 VTLSMDPLFLAWSYFRRRKFQKCSDICTKVLEDSPYDQAAWSLKTRAVTEMVYIDEVEVDQEGIAEIMLDESSIAQVARPGTSLRLPGTSHGGGPTPAVRPMTQSGRPITGFVRPSTQSGRPGTMEQAIRTPRTANTARPVTSSSGRFVRLGTASMLTNPDGPFINLSRLNLAKYSQKPNLSKTLFEYIFHHENDVKNALDLAALATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNHQEFVDTYLYLAKVYQRLDQPITALNLFK 274          

HSP 2 Score: 246.514 bits (628), Expect = 9.245e-75
Identity = 113/244 (46.31%), Postives = 167/244 (68.44%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTL-ATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            ++      L + + GLD FP  ++LL   +RI+E +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L ++    A+V+YN+G +A+ IGD  LA+Q F+LAL+ +N+H+E+YNNL  LE++K  I+ AKAFLQ + T    ++E H+NF +L++K GDLQ+SY++ +KS + FP H DT  + KSL   F+
Sbjct:  262 RLDQPITALNLFKQGLDHFPGEVTLLTGIARIHEEMNNITSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMTLSSFERALALVSSDEEQADVWYNLGHVAVGIGDLPLAYQCFKLALAFNNDHAEAYNNLAALELRKGRIEQAKAFLQTAATLAPHMYEPHYNFAILSDKVGDLQSSYMAAQKSEDAFPEHVDTQQMLKSLRHHFA 505          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:103039229])

HSP 1 Score: 296.975 bits (759), Expect = 1.644e-94
Identity = 139/282 (49.29%), Postives = 200/282 (70.92%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQ----------SAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN-LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            +TL M+ L  A  YF+  K  +C   C K L  + YDQ          +AW LK +A    +Y+D+++ DQ GI E+ L+++SI+ VA+PGTS +    +       A+RPM++SGRPI+GF+R S  +      E ++++ R A TARP++++SGRFVR+GTASM+++P G FINL RLNL KY+ +P L+K+LFEYI++HENDV++AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL +Q  ++ YL+L K++Q+LDQP+T+L  +K
Sbjct:    3 VTLSMDPLFLAWSYFRRRKFQKCSDICTKVLEDSPYDQEHDTPLHISEAAWSLKTRAVTEMVYIDEVEVDQEGIAEIMLDESSIAQVARPGTSLRLPGTSHGGGPTPAVRPMTQSGRPITGFVRPSTQSGRPGTMEQAIRTPRTANTARPVTSSSGRFVRLGTASMLTNPDGPFINLSRLNLAKYSQKPNLSKTLFEYIFHHENDVKNALDLAALATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNHQEFVDTYLYLAKVYQRLDQPITALNLFK 284          

HSP 2 Score: 210.305 bits (534), Expect = 1.970e-61
Identity = 96/208 (46.15%), Postives = 143/208 (68.75%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTL-ATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEK 1466
            ++      L + + GLD FP  ++LL   +RI+E +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L ++    A+V+YN+G +A+ IGD  LA+Q F+LAL+ +N+H+E+YNNL  LE++K  I+ AKAFLQ + T    ++E H+NF +L++K
Sbjct:  272 RLDQPITALNLFKQGLDHFPGEVTLLTGIARIHEEMNNITSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMTLSSFERALALVSSDEEQADVWYNLGHVAVGIGDLPLAYQCFKLALAFNNDHAEAYNNLAALELRKGRIEQAKAFLQTAATLAPHMYEPHYNFAILSDK 479          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:103039229])

HSP 1 Score: 246.128 bits (627), Expect = 4.312e-75
Identity = 113/244 (46.31%), Postives = 167/244 (68.44%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTL-ATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            ++      L + + GLD FP  ++LL   +RI+E +N      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L ++    A+V+YN+G +A+ IGD  LA+Q F+LAL+ +N+H+E+YNNL  LE++K  I+ AKAFLQ + T    ++E H+NF +L++K GDLQ+SY++ +KS + FP H DT  + KSL   F+
Sbjct:  230 RLDQPITALNLFKQGLDHFPGEVTLLTGIARIHEEMNNITSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMTLSSFERALALVSSDEEQADVWYNLGHVAVGIGDLPLAYQCFKLALAFNNDHAEAYNNLAALELRKGRIEQAKAFLQTAATLAPHMYEPHYNFAILSDKVGDLQSSYMAAQKSEDAFPEHVDTQQMLKSLRHHFA 473          

HSP 2 Score: 228.409 bits (581), Expect = 2.580e-68
Identity = 113/272 (41.54%), Postives = 165/272 (60.66%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN-LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            +TL M+ L  A  YF+  K  +C   C K L  + YDQ+AW LK +A    +Y+D+++ DQ GI E+ L+++SI+ VA+PGTS +    +       A+RPM++SGRPI+GF+R S  +      E ++++ R A TARP++++SGRFVR+GT                                F Y++        AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL +Q  ++ YL+L K++Q+LDQP+T+L  +K
Sbjct:    3 VTLSMDPLFLAWSYFRRRKFQKCSDICTKVLEDSPYDQAAWSLKTRAVTEMVYIDEVEVDQEGIAEIMLDESSIAQVARPGTSLRLPGTSHGGGPTPAVRPMTQSGRPITGFVRPSTQSGRPGTMEQAIRTPRTANTARPVTSSSGRFVRLGT--------------------------------FVYVFISHCKTFQALDLAALATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNHQEFVDTYLYLAKVYQRLDQPITALNLFK 242          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Match: bbs4 (Bardet-Biedl syndrome 4 [Source:NCBI gene;Acc:103021455])

HSP 1 Score: 46.2098 bits (108), Expect = 4.598e-8
Identity = 45/196 (22.96%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  942 YENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTS---YLSIKKSLNMF 1520
            Y  L + +K  E     L  D  N + I +  S        D+A+  YR       ++  L NN+ +C F  +++   I+C   A  L+      ++ YN+G++ L++   + AF     A++      E Y  L V     +++D A+   + +I  ++     + NF +L    GD + +   Y  ++K +NM 
Sbjct:  213 YMQLGKYQKAFEHLGNALTYDPNNYKAILAAGSMMQTHGDFDVAMNKYRVAAFTVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLSPFD--WKILYNLGLVHLTMQQYASAFHFLSAAINLQPRMGELYMLLAVALTNLDDVDNARRSYEQAIQLDTSNPLVNLNFAVLLYNQGDKKAALQQYQEMEKKVNML 406          

HSP 2 Score: 30.8018 bits (68), Expect = 4.598e-8
Identity = 26/78 (33.33%), Postives = 37/78 (47.44%), Query Frame = 1
Query:  658 RHALELAAFATECNQFKDCWWKIQ--LGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            + A+E+   A   NQ KD  W+I   LG CY     ++ AE+Q   AL        Y+ LGKI+        ++E YK
Sbjct:  119 KAAIEVYNEAARLNQ-KD--WEISHNLGVCYIYTKDFKSAEEQLNLALQLNKHDMTYMMLGKIYLLEGDTEKAIEIYK 193          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002715.1 (pep scaffold:Pmarinus_7.0:GL480743:201247:204490:-1 gene:ENSPMAG00000002473.1 transcript:ENSPMAT00000002715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 1.444e-82
Identity = 118/241 (48.96%), Postives = 171/241 (70.95%), Query Frame = 1
Query:  136 ECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN----LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYF---RLCLYRDAEQQFRSALVNQPILEAYLWLGK 837
            +C   C + L KN  DQ AW LKM+A   ++YVD++D D+ G  EM L+DN+I+ V++PGTS +    +Q +     +QA+RPM+ +GRP++GF+R    +      E ++++ R A TARP+++ASGR VR+GTASM+SSP G FI+L RLN  KYA +P++ K LFEYI +HENDV++ALELA+ ATE  +F+D WWK+QLGKCY+   RL LYR+AE+QF+SA+     ++ +L+L K
Sbjct:   23 DCAEICGQLLRKNPLDQVAWTLKMRALTEQLYVDEVDVDEEGFAEMLLDDNAIATVSRPGTSLRAPATSQGSGAMGPSQAVRPMTATGRPLTGFMRPGTQSGRPGTMEQAIRTPRTARTARPVTSASGRHVRLGTASMLSSPDGPFIHLSRLNFAKYAQQPSVAKPLFEYILHHENDVKNALELASLATEHARFQDWWWKVQLGKCYYRGPRLGLYREAEKQFKSAMKQHDCVDTFLFLSK 263          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004718.1 (pep scaffold:Pmarinus_7.0:GL487045:3941:8915:-1 gene:ENSPMAG00000004297.1 transcript:ENSPMAT00000004718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.261 bits (591), Expect = 3.743e-73
Identity = 107/238 (44.96%), Postives = 167/238 (70.17%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLAT-KSNVAEVYYNIGIIAL--SIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            L + + GL++FP  ++LL   +RI+E +N      E ++ +L+QDN ++E IA + S++FY DQ +IAL+FYRRL QMGV  ++L NNL LCCFY+QQ+DM +  F  AL LA      AEV+YN+G +A+   IGD +LA+Q F+LAL+++N+H+E+YNNLGVLE ++ ++D AKA  Q + +    ++E HFN+  L+ + GDLQ+SYLS +++L+ FP H D++ + + L + F+
Sbjct:   13 LEVFRQGLERFPGEVTLLTGIARIHEGMNNLSLATESYKEVLKQDNTHVEAIACMGSSHFYSDQPEIALRFYRRLLQMGVYNMQLFNNLGLCCFYAQQYDMALGSFERALALAQDPEEGAEVWYNLGHVAVVQGIGDVTLAYQCFKLALANNNDHAEAYNNLGVLEHRRGHLDQAKALFQTASSLAPHMYEPHFNYASLSNQLGDLQSSYLSAQRALSAFPQHVDSHQLIQQLKQHFA 250          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Sea Lamprey
Match: bbs4 (Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-060126-2])

HSP 1 Score: 46.9802 bits (110), Expect = 8.757e-6
Identity = 36/126 (28.57%), Postives = 56/126 (44.44%), Query Frame = 3
Query: 1002 DNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESY-------NNLGVLE 1358
            D  N + I +  S        D+AL  YR       ++  L NN+A+C F  +++   I+C   A  LA      +V YN+G++ L++  ++ AF     A+S      E Y       NNLG  E
Sbjct:  221 DPTNYKAILAAGSMMQTHGDFDVALTKYRVAAHSAPESPPLWNNIAMCFFGKKKYVAAISCLKRAHYLAPFD--GKVLYNLGLVHLTMQQHASAFHFLSAAISLMPRMGELYMLLAVALNNLGDPE 344          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Nematostella
Match: EDO48471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW9])

HSP 1 Score: 298.516 bits (763), Expect = 5.619e-150
Identity = 135/267 (50.56%), Postives = 192/267 (71.91%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            M+ L  +L  ++  K ++C+  C + L KN YDQ+AW LK +A   ++YVD++D D+ GI EM ++DNS++ + +PGTS KK    Q      +RPMS++GRP+SGF+R           E ++++ R A TARP+++ASGR VR+GTASM+S P G FIN+ +LNL KYA RP L K LFEYI++HENDVR+ALELAA ATE  QFKD WWK+QL KCY+RL +YRDAE+Q +SAL +  +++ YL+L K++ +LDQP+T++E +K
Sbjct:    1 MDPLFLSLSLYRRRKHEDCVEVCTQMLKKNPYDQAAWCLKTRALTEQVYVDEVDVDEEGIAEMLMDDNSVAQLPRPGTSLKKPGTGQGGPTPGVRPMSQAGRPVSGFVRPGTQGGRPGTMEQAIRTPRTAQTARPVTSASGRHVRLGTASMLSQPDGPFINISKLNLSKYAQRPNLAKPLFEYIFHHENDVRNALELAAKATEEAQFKDWWWKVQLAKCYYRLGMYRDAEKQLKSALRDTDMIDTYLYLCKVYIRLDQPLTAIETFK 267          

HSP 2 Score: 251.521 bits (641), Expect = 5.619e-150
Identity = 119/237 (50.21%), Postives = 170/237 (71.73%), Query Frame = 3
Query:  870 LRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV 1580
            +   + G++KFP   +LL   +RI+E L       +L++ +L  DN ++E IA IA+N+FY DQ +IA+++YRRL QMGV   EL NNL LCCFYSQQ+DM ++CF  AL+LA+  N+A+V+YNIG +AL IGD++LA+Q FRLAL+ +N+HSE+YNNLGVLEM+K + D A+AFLQA+      ++E H+N  LL+ K GDLQ+S+ S+ KSL  +  H D+ D+ K L E FS++
Sbjct:  263 IETFKKGVEKFPGETTLLTGIARIHEELMDMTNAVKLYKEVLYFDNTHVEGIACIATNHFYTDQPEIAMRYYRRLLQMGVYNAELFNNLGLCCFYSQQYDMTLSCFERALSLASDENMADVWYNIGHVALGIGDSALAYQCFRLALAANNDHSEAYNNLGVLEMRKGHNDQARAFLQAAAGLAPHMYEPHYNHSLLSFKIGDLQSSFGSVNKSLEGYQEHCDSKDLLKQLQEDFSAL 499          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Nematostella
Match: EDO48470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW7])

HSP 1 Score: 61.6178 bits (148), Expect = 3.371e-11
Identity = 31/92 (33.70%), Postives = 54/92 (58.70%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKI------DECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKK 330
            +  ++ +LLKA+   QN         +  + YC    ++    ++AW LK +A   ++YVD++D D+ GI EM ++DNS++ + +PGTS KK
Sbjct:   47 VVEVLLFLLKAIKILQNGSFYLMNSGESNVFYCFTPSSRRP--KAAWCLKTRALTEQVYVDEVDVDEEGIAEMLMDDNSVAQLPRPGTSLKK 136          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Medaka
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:101163700])

HSP 1 Score: 306.605 bits (784), Expect = 6.168e-98
Identity = 141/272 (51.84%), Postives = 200/272 (73.53%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQEN-LNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            + + M+ L  A  YF+  K+ +C   C K L  N YDQ+AW LK  +    +Y+D+++ DQ GI EM L++NSI+ VA+PGTS +    +Q      A+RPM++SGRPI+GF+R S  +      E ++K+ R A TARP++++SGRFVR+GTASM+++P G FINL RLNL KY+ +P L+K+LFEYI++HENDV++AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL  Q +++ YL+L K++Q++DQPVT+L  +K
Sbjct:    1 MEVTMDPLFLAWSYFRRRKLQQCSEICTKILHDNPYDQAAWSLKTCSLTEMVYIDEIEVDQEGIAEMMLDENSIAQVARPGTSLRLPGTSQGGGPTPAVRPMTQSGRPITGFVRPSTQSGRPGTMEQAIKTPRTASTARPVTSSSGRFVRLGTASMLTNPDGPFINLSRLNLAKYSQKPNLSKTLFEYIFHHENDVKNALDLAAQATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNQQEVVDTYLYLAKVYQRMDQPVTALNLFK 272          

HSP 2 Score: 249.21 bits (635), Expect = 7.086e-76
Identity = 117/244 (47.95%), Postives = 168/244 (68.85%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            ++      L + + GLD FP  ++LL   +RI+E LN      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L  +    AEV+YNIG +A+ IGD +LA+Q F+LAL+ +N+H+E+YNNL VLE++K +I+ AKAFLQ + +    ++E HFNF +L+EK GDLQ+SY + +KS + FP H DT  + K L + F+
Sbjct:  260 RMDQPVTALNLFKQGLDHFPGEVTLLTGVARIHEELNNISSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMALSSFERALGLVCSDEEQAEVWYNIGHVAVGIGDLTLAYQCFKLALALNNDHAEAYNNLAVLELRKGHIEQAKAFLQTAASLAPHMYEPHFNFSILSEKIGDLQSSYTAAQKSEDAFPEHVDTQKLLKQLRQHFA 503          
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Medaka
Match: ttc8 (tetratricopeptide repeat domain 8 [Source:NCBI gene;Acc:101163700])

HSP 1 Score: 248.825 bits (634), Expect = 4.494e-76
Identity = 117/244 (47.95%), Postives = 168/244 (68.85%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLA-TKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLLAEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFS 1574
            ++      L + + GLD FP  ++LL   +RI+E LN      E ++ +L+QDN ++E IA I SN+FY DQ +IAL+FYRRL QMGV   +L NNL LCCFY+QQ+DM ++ F  AL L  +    AEV+YNIG +A+ IGD +LA+Q F+LAL+ +N+H+E+YNNL VLE++K +I+ AKAFLQ + +    ++E HFNF +L+EK GDLQ+SY + +KS + FP H DT  + K L + F+
Sbjct:  234 RMDQPVTALNLFKQGLDHFPGEVTLLTGVARIHEELNNISSATEYYKDVLKQDNTHVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMALSSFERALGLVCSDEEQAEVWYNIGHVAVGIGDLTLAYQCFKLALALNNDHAEAYNNLAVLELRKGHIEQAKAFLQTAASLAPHMYEPHFNFSILSEKIGDLQSSYTAAQKSEDAFPEHVDTQKLLKQLRQHFA 477          

HSP 2 Score: 235.343 bits (599), Expect = 6.406e-71
Identity = 118/276 (42.75%), Postives = 172/276 (62.32%), Query Frame = 1
Query:   73 ITLIMNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAM-----RPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLEFYK 885
            + + M+ L  A  YF+  K+ +C   C K L  N YDQ+AW LK  +    +Y+D+++ DQ GI EM L++NSI+ VA       +++  ++  N        RPM++SGRPI+GF+R S  +      E ++K+ R A TARP++++SGRFVR+GT                              +LFEYI++HENDV++AL+LAA ATE  QFKD WWK+QLGKCY+RL LYR+AE+QFRSAL  Q +++ YL+L K++Q++DQPVT+L  +K
Sbjct:    1 MEVTMDPLFLAWSYFRRRKLQQCSEICTKILHDNPYDQAAWSLKTCSLTEMVYIDEIEVDQEGIAEMMLDENSIAQVAIRVEVQLQLLGNEQKKNGPFSCLIFRPMTQSGRPITGFVRPSTQSGRPGTMEQAIKTPRTASTARPVTSSSGRFVRLGT------------------------------TLFEYIFHHENDVKNALDLAAQATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNQQEVVDTYLYLAKVYQRMDQPVTALNLFK 246          
BLAST of Tetratricopeptide repeat domain 8 vs. Planmine SMEST
Match: SMESG000047940.1 (SMESG000047940.1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 876
            MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE
Sbjct:    1 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 264          

HSP 2 Score: 343.969 bits (881), Expect = 1.679e-113
Identity = 170/180 (94.44%), Postives = 171/180 (95.00%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMA 1385
            K+      L ILQ GLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDM 
Sbjct:  255 KLDQPVTSLEILQSGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMV 434          
BLAST of Tetratricopeptide repeat domain 8 vs. Planmine SMEST
Match: SMESG000044097.1 (SMESG000044097.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 876
            MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE
Sbjct:    1 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 264          

HSP 2 Score: 346.665 bits (888), Expect = 1.683e-114
Identity = 171/180 (95.00%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMA 1385
            K+      L ILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDM 
Sbjct:  255 KLDQPVTSLEILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLALSHDNEHSESYNNLGVLEMQKENIDMV 434          
BLAST of Tetratricopeptide repeat domain 8 vs. Planmine SMEST
Match: SMESG000044097.1 (SMESG000044097.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 1
Query:   85 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 876
            MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE
Sbjct:    1 MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYVDDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKSGRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTASMISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAFATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIFQKLDQPVTSLE 264          

HSP 2 Score: 145.976 bits (367), Expect = 4.554e-39
Identity = 73/84 (86.90%), Postives = 75/84 (89.29%), Query Frame = 3
Query:  846 KIRSTCNILRILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLF 1097
            K+      L ILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYR  +
Sbjct:  255 KLDQPVTSLEILQGGLDKFPLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRYFY 338          
BLAST of Tetratricopeptide repeat domain 8 vs. Planmine SMEST
Match: SMESG000046074.1 (SMESG000046074.1)

HSP 1 Score: 44.669 bits (104), Expect = 4.759e-7
Identity = 41/174 (23.56%), Postives = 77/174 (44.25%), Query Frame = 3
Query:  903 PLNISLLLAKSRIYENLNQSEKLKELFQTILEQDNMNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYSQQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQ--NFRLALSHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTN 1418
            P N  +L+    +Y +L Q+ K  E F   L  D  ++  I + +S        D+AL  YR   Q   +   + +N+ +  F  +++   I+C N A  LA      ++  N+G++ L     + AF+  +  + L   N +S+ Y  L +     E+ + A+   Q ++  N
Sbjct:  204 PENSDILMTLGLLYMDLGQTNKAFEQFGNALSNDPTHVNSIIAASSIIQQHGDYDVALNKYRIAAQKAPENGPIWSNIGMAFFAKKKYVAAISCLNRAYYLAPFE--WKIASNLGLVHLHTEQYASAFRFLSSAIQLVKSNANSKLYMMLAISLSHLEDPENAEKAYQEAVKIN 375          

HSP 2 Score: 28.4906 bits (62), Expect = 4.759e-7
Identity = 16/44 (36.36%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  718 WKIQ--LGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLGKIF 843
            W+I   LG C+ +   +  A++ FR+A+  +    +YL LGKIF
Sbjct:  140 WEINHNLGLCHMQCNEFELAKEFFRNAINCRKSESSYLMLGKIF 183          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC81.351e-14951.12tetratricopeptide repeat domain 8 [Source:HGNC Sym... [more]
TTC83.332e-14749.28tetratricopeptide repeat domain 8 [Source:HGNC Sym... [more]
TTC83.332e-14749.28tetratricopeptide repeat domain 8 [Source:HGNC Sym... [more]
TTC82.031e-14546.60tetratricopeptide repeat domain 8 [Source:HGNC Sym... [more]
TTC82.031e-14546.60tetratricopeptide repeat domain 8 [Source:HGNC Sym... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs-83.946e-10339.16Tetratricopeptide repeat protein 8 [Source:UniPro... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BBS83.442e-3231.75gene:FBgn0031255 transcript:FBtr0078058[more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc84.402e-8747.74tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
bbs45.655e-622.34Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC87.620e-14850.37tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
TTC81.376e-14749.64tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
TTC81.768e-13851.70tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
TTC83.574e-13548.74tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
TTC81.069e-13051.70tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttc87.994e-15150.75tetratricopeptide repeat domain 8 [Source:MGI Symb... [more]
Ttc81.785e-14848.92tetratricopeptide repeat domain 8 [Source:MGI Symb... [more]
Ttc82.666e-8152.91tetratricopeptide repeat domain 8 [Source:MGI Symb... [more]
Tmtc41.555e-623.12transmembrane and tetratricopeptide repeat contain... [more]
Tmtc41.555e-623.12transmembrane and tetratricopeptide repeat contain... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VD72|TTC8_MOUSE1.077e-14748.92Tetratricopeptide repeat protein 8 OS=Mus musculus... [more]
sp|Q8TAM2|TTC8_HUMAN3.052e-14245.07Tetratricopeptide repeat protein 8 OS=Homo sapiens... [more]
sp|Q23049|TTC8_CAEEL4.089e-10239.16Tetratricopeptide repeat protein 8 OS=Caenorhabdit... [more]
sp|Q6YZI0|SPY_ORYSJ5.130e-726.58Probable UDP-N-acetylglucosamine--peptide N-acetyl... [more]
sp|Q8RVB2|SPY_SOLLC2.439e-625.32Probable UDP-N-acetylglucosamine--peptide N-acetyl... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TJS46.521e-15252.81TPR_REGION domain-containing protein OS=Capitella ... [more]
A0A267E7G37.637e-15251.12TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A267GHU18.509e-15251.12TPR_REGION domain-containing protein (Fragment) OS... [more]
C3ZKQ72.868e-15152.63TPR_REGION domain-containing protein OS=Branchiost... [more]
K1P4M13.065e-15151.69Tetratricopeptide repeat protein 8 OS=Crassostrea ... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc81.090e-9751.10tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
ttc81.979e-9751.10tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
ttc81.644e-9449.29tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
ttc84.312e-7546.31tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
bbs44.598e-822.96Bardet-Biedl syndrome 4 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002715.11.444e-8248.96pep scaffold:Pmarinus_7.0:GL480743:201247:204490:-... [more]
ENSPMAT00000004718.13.743e-7344.96pep scaffold:Pmarinus_7.0:GL487045:3941:8915:-1 ge... [more]
bbs48.757e-628.57Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO484715.619e-15050.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484703.371e-1133.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc86.168e-9851.84tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
ttc84.494e-7647.95tetratricopeptide repeat domain 8 [Source:NCBI gen... [more]
back to top
BLAST of Tetratricopeptide repeat domain 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000047940.11.679e-113100.00SMESG000047940.1[more]
SMESG000044097.11.683e-114100.00SMESG000044097.1[more]
SMESG000044097.14.554e-39100.00SMESG000044097.1[more]
SMESG000046074.14.759e-723.56SMESG000046074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011766 ID=SMED30011766|Name=Tetratricopeptide repeat domain 8|organism=Schmidtea mediterranea sexual|type=transcript|length=1613bp
TTTAAATTTTGTACGCAATTATATTTTTACTTCACTGAAATAAATTCTTA
TTATTCAATTTACTTTTTTTAAATAACATTAATAATGAACTATCTATTAA
AAGCATTGATATATTTTCAAAATGACAAAATTGATGAGTGTATATTATAT
TGTGATAAAGCTTTGACAAAAAATGAATATGACCAAAGTGCTTGGCTTTT
AAAAATGAAGGCATCATTTTTCAAAATTTATGTTGATGACTTGGACAACG
ATCAAAGTGGTATCACAGAGATGTCTCTTAATGATAATTCGATATCAAAT
GTAGCAAAACCTGGAACTTCTTTCAAGAAAGTAGTTAATACGCAGGAAAA
CTTGAATCAAGCAATGAGGCCAATGTCTAAGTCAGGAAGACCAATATCAG
GTTTTATAAGGCAATCTAATGATAATAATATGGAATCTAATTTTGAACTT
TCTGTAAAATCTGCTCGAAATGCTTATACTGCACGTCCAATTTCTACAGC
TTCAGGTCGCTTTGTTCGTATTGGAACGGCCTCAATGATTTCTAGTCCTG
GTGGATCATTTATCAATTTGCCACGTCTTAATTTACAAAAATATGCTAGT
AGACCAACTTTAAACAAATCTTTATTTGAATACATTTATTATCATGAAAA
TGATGTTAGACATGCTCTAGAATTAGCCGCATTTGCTACGGAATGTAATC
AGTTTAAGGATTGTTGGTGGAAAATTCAGTTAGGAAAATGCTATTTTAGG
CTATGTCTTTATCGTGATGCTGAGCAGCAGTTTCGATCTGCTTTAGTTAA
TCAACCAATATTAGAAGCATATCTTTGGCTTGGGAAAATATTCCAAAAAT
TAGATCAACCTGTAACATCCTTAGAATTTTACAAGGTGGTCTCGATAAAT
TTCCATTGAATATCTCACTTTTATTAGCTAAATCAAGAATATATGAAAAC
TTGAATCAATCGGAAAAGTTAAAGGAATTGTTCCAAACGATTTTGGAGCA
GGACAACATGAATATTGAAATAATTGCTTCCATTGCTAGTAATTATTTCT
ATGAAGATCAATCAGACATTGCCCTAAAATTTTATCGGAGATTATTTCAG
ATGGGTGTTCAAACTGTTGAATTGATGAATAATTTAGCTTTATGCTGCTT
TTACTCCCAGCAATTTGATATGTGCATAACTTGTTTTAACTTGGCACTGA
CGCTAGCTACAAAAAGTAACGTAGCAGAAGTGTATTACAATATTGGAATT
ATAGCTTTAAGCATTGGTGATAATAGTTTGGCATTCCAAAATTTCCGCCT
GGCTCTTTCTCATGACAATGAACACTCGGAATCCTATAATAATTTGGGAG
TTTTAGAAATGCAGAAAGAAAATATTGATATGGCTAAGGCATTCTTACAA
GCTTCTATTACTACCAATTCTTGTTTATTCGAATCGCATTTTAATTTTGG
ATTATTAGCGGAAAAAACCGGAGATCTCCAGACCAGTTATCTGTCCATAA
AGAAGTCATTAAATATGTTTCCAAATCATTTCGATACTAATGATATTTAC
AAGTCTTTAACTGAATTATTTTCTAGCGTTTAAACACTATTAAATTTAAA
GTTGTATTTATTT
back to top

protein sequence of SMED30011766-orf-1

>SMED30011766-orf-1 ID=SMED30011766-orf-1|Name=SMED30011766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MNYLLKALIYFQNDKIDECILYCDKALTKNEYDQSAWLLKMKASFFKIYV
DDLDNDQSGITEMSLNDNSISNVAKPGTSFKKVVNTQENLNQAMRPMSKS
GRPISGFIRQSNDNNMESNFELSVKSARNAYTARPISTASGRFVRIGTAS
MISSPGGSFINLPRLNLQKYASRPTLNKSLFEYIYYHENDVRHALELAAF
ATECNQFKDCWWKIQLGKCYFRLCLYRDAEQQFRSALVNQPILEAYLWLG
KIFQKLDQPVTSLEFYKVVSINFH*
back to top

protein sequence of SMED30011766-orf-2

>SMED30011766-orf-2 ID=SMED30011766-orf-2|Name=SMED30011766-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
MNIEIIASIASNYFYEDQSDIALKFYRRLFQMGVQTVELMNNLALCCFYS
QQFDMCITCFNLALTLATKSNVAEVYYNIGIIALSIGDNSLAFQNFRLAL
SHDNEHSESYNNLGVLEMQKENIDMAKAFLQASITTNSCLFESHFNFGLL
AEKTGDLQTSYLSIKKSLNMFPNHFDTNDIYKSLTELFSSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051620norepinephrine uptake
GO:1905515non-motile cilium assembly
GO:0001736establishment of planar polarity
GO:0006810transport
GO:0007411axon guidance
GO:0007608sensory perception of smell
GO:0015031protein transport
GO:0021772olfactory bulb development
GO:0030030cell projection organization
GO:0032880regulation of protein localization
GO:0034260negative regulation of GTPase activity
GO:0035264multicellular organism growth
GO:0045444fat cell differentiation
GO:0048560establishment of anatomical structure orientation
GO:0051492regulation of stress fiber assembly
GO:0060122inner ear receptor stereocilium organization
GO:0060219camera-type eye photoreceptor cell differentiation
GO:0060271cilium morphogenesis
GO:0061326renal tubule development
GO:0090002establishment of protein localization to plasma membrane
GO:1903251multi-ciliated epithelial cell differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028796BBS8
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001103RNA polymerase II repressing transcription factor binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0016020membrane
GO:0032391photoreceptor connecting cilium
GO:0034464BBSome
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0060170ciliary membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 275..275
IPR028796Tetratricopeptide repeat protein 8PANTHERPTHR44177FAMILY NOT NAMEDcoord: 1..274
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 3..273