Phosphoinositide phospholipase C

Overview
NamePhosphoinositide phospholipase C
Smed IDSMED30011750
Length (bp)11070
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoinositide phospholipase C (SMED30011750) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoinositide phospholipase C (SMED30011750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoinositide phospholipase C (SMED30011750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoinositide phospholipase C (SMED30011750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30011750h1SMcG0011689 SmedASXL_001955SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011750h1SMcG0011689 SmedASXL_018260SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30011750h1SMcG0011689 dd_Smed_v4_39585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011750h1SMcG0011689 dd_Smed_v4_9716_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011750h1SMcG0011689 dd_Smed_v6_9716_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011750h1SMcG0011689 OX_Smed_1.0.20517ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011750h1SMcG0011689 OX_Smed_1.0.06160ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCE1 (phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:HGNC:17175])

HSP 1 Score: 243.432 bits (620), Expect = 3.389e-63
Identity = 133/351 (37.89%), Postives = 207/351 (58.97%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVK---LRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            ++ QI P LS+LV+Y QAVK   L +LN   S +  ++  + +I           G N   +    T++ +  + KS           S  GI  T   SS   +           P  + I+S+NE+ AK +CRR    L  H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+KN  ++ KF+P E++ + + P   ++ I+SGQN+   N  GSP +E++++G+ +D    +T+PI RN +NP W+E F F + F DL F+RFAV++ NS+ +  Q++ P+K LK+G+RH+ L++     N++ ++++LF+
Sbjct: 1657 ESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSI----------FGNNPGRMSPGETASFNKTSGKS-----------SCEGIRQTWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLH---NEVLEISSLFI 1983          

HSP 2 Score: 197.978 bits (502), Expect = 1.897e-49
Identity = 148/585 (25.30%), Postives = 259/585 (44.27%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDL------SSVPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQ--MHNSEXXXXXXXXXXMDYPMKNKS-----------TNDPFFEEFFKPSCRPIVDMINI--SNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            + EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DL      SS+P +   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  YR VV RAL I    V+PF G+FL +L  +++    ++ L    ++    +  V+D++G+D F+ R+G  GL N  K   V +I   I      +   E     + +      +K+KS           +++  FE+  +       D          +I   +  +     Q +  G TV+  D+D       FL+L   NS + W KPT  +                           SK+   ++  T    PG +    +  + S  +          G +D+F +K +Y G+     +   +  + G            ++++YG   ++N++++ V P   AK    GL +L  A + +R   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S
Sbjct:  519 SKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS------------------------PASSKAKLGVLNNT--AEPGKFPLLGNAGLSSLTE----------GVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSM----FLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPS 1060          

HSP 3 Score: 58.9214 bits (141), Expect = 2.415e-7
Identity = 81/323 (25.08%), Postives = 132/323 (40.87%), Query Frame = 2
Query: 9716 KVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKEL--------EEEQSTSGLTPPQISDNPRYR 10615
            + H + + GV   E +T+  I   + A  ++ Q L     +     +Y L++E   I         +   R IG +E I  I+              SS      +M  I+ +  +   EE+       +    S      V +++VSPEQP T++K    ST   VI   L KA+         +P+D+VL+EE+      +          T KSS+R+L   ECV+  Q +   +GK +L  K   E+V +    KK   +F S+  K       +  +K+   +TS  +L        +EE+   GL+    SD   YR
Sbjct: 2012 QTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQIL--------------SSWFPEEGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKK-------TTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKKKGISFASELKK------LTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSS---SDTMDYR 2301          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCE1 (phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:HGNC:17175])

HSP 1 Score: 242.276 bits (617), Expect = 5.551e-63
Identity = 133/351 (37.89%), Postives = 207/351 (58.97%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVK---LRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            ++ QI P LS+LV+Y QAVK   L +LN   S +  ++  + +I           G N   +    T++ +  + KS           S  GI  T   SS   +           P  + I+S+NE+ AK +CRR    L  H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+KN  ++ KF+P E++ + + P   ++ I+SGQN+   N  GSP +E++++G+ +D    +T+PI RN +NP W+E F F + F DL F+RFAV++ NS+ +  Q++ P+K LK+G+RH+ L++     N++ ++++LF+
Sbjct: 1349 ESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSI----------FGNNPGRMSPGETASFNKTSGKS-----------SCEGIRQTWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLH---NEVLEISSLFI 1675          

HSP 2 Score: 196.823 bits (499), Expect = 3.884e-49
Identity = 148/585 (25.30%), Postives = 259/585 (44.27%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDL------SSVPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQ--MHNSEXXXXXXXXXXMDYPMKNKS-----------TNDPFFEEFFKPSCRPIVDMINI--SNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            + EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DL      SS+P +   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  YR VV RAL I    V+PF G+FL +L  +++    ++ L    ++    +  V+D++G+D F+ R+G  GL N  K   V +I   I      +   E     + +      +K+KS           +++  FE+  +       D          +I   +  +     Q +  G TV+  D+D       FL+L   NS + W KPT  +                           SK+   ++  T    PG +    +  + S  +          G +D+F +K +Y G+     +   +  + G            ++++YG   ++N++++ V P   AK    GL +L  A + +R   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S
Sbjct:  211 SKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS------------------------PASSKAKLGVLNNT--AEPGKFPLLGNAGLSSLTE----------GVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSM----FLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPS 752          

HSP 3 Score: 59.6918 bits (143), Expect = 1.559e-7
Identity = 81/323 (25.08%), Postives = 132/323 (40.87%), Query Frame = 2
Query: 9716 KVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKEL--------EEEQSTSGLTPPQISDNPRYR 10615
            + H + + GV   E +T+  I   + A  ++ Q L     +     +Y L++E   I         +   R IG +E I  I+              SS      +M  I+ +  +   EE+       +    S      V +++VSPEQP T++K    ST   VI   L KA+         +P+D+VL+EE+      +          T KSS+R+L   ECV+  Q +   +GK +L  K   E+V +    KK   +F S+  K       +  +K+   +TS  +L        +EE+   GL+    SD   YR
Sbjct: 1704 QTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQIL--------------SSWFPEEGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKK-------TTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKKKGISFASELKK------LTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSS---SDTMDYR 1993          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCE1 (phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:HGNC:17175])

HSP 1 Score: 242.276 bits (617), Expect = 5.551e-63
Identity = 133/351 (37.89%), Postives = 207/351 (58.97%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVK---LRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            ++ QI P LS+LV+Y QAVK   L +LN   S +  ++  + +I           G N   +    T++ +  + KS           S  GI  T   SS   +           P  + I+S+NE+ AK +CRR    L  H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+KN  ++ KF+P E++ + + P   ++ I+SGQN+   N  GSP +E++++G+ +D    +T+PI RN +NP W+E F F + F DL F+RFAV++ NS+ +  Q++ P+K LK+G+RH+ L++     N++ ++++LF+
Sbjct: 1349 ESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSI----------FGNNPGRMSPGETASFNKTSGKS-----------SCEGIRQTWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLH---NEVLEISSLFI 1675          

HSP 2 Score: 196.823 bits (499), Expect = 3.884e-49
Identity = 148/585 (25.30%), Postives = 259/585 (44.27%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDL------SSVPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQ--MHNSEXXXXXXXXXXMDYPMKNKS-----------TNDPFFEEFFKPSCRPIVDMINI--SNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            + EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DL      SS+P +   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  YR VV RAL I    V+PF G+FL +L  +++    ++ L    ++    +  V+D++G+D F+ R+G  GL N  K   V +I   I      +   E     + +      +K+KS           +++  FE+  +       D          +I   +  +     Q +  G TV+  D+D       FL+L   NS + W KPT  +                           SK+   ++  T    PG +    +  + S  +          G +D+F +K +Y G+     +   +  + G            ++++YG   ++N++++ V P   AK    GL +L  A + +R   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S
Sbjct:  211 SKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS------------------------PASSKAKLGVLNNT--AEPGKFPLLGNAGLSSLTE----------GVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSM----FLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPS 752          

HSP 3 Score: 59.6918 bits (143), Expect = 1.559e-7
Identity = 81/323 (25.08%), Postives = 132/323 (40.87%), Query Frame = 2
Query: 9716 KVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKEL--------EEEQSTSGLTPPQISDNPRYR 10615
            + H + + GV   E +T+  I   + A  ++ Q L     +     +Y L++E   I         +   R IG +E I  I+              SS      +M  I+ +  +   EE+       +    S      V +++VSPEQP T++K    ST   VI   L KA+         +P+D+VL+EE+      +          T KSS+R+L   ECV+  Q +   +GK +L  K   E+V +    KK   +F S+  K       +  +K+   +TS  +L        +EE+   GL+    SD   YR
Sbjct: 1704 QTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQIL--------------SSWFPEEGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKK-------TTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKKKGISFASELKK------LTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSS---SDTMDYR 1993          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 196.052 bits (497), Expect = 2.707e-49
Identity = 106/203 (52.22%), Postives = 136/203 (67.00%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIE +E D +L+ +G++S +GF  YLM  +N     LD     Q MDHPL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLL+GCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS  QQ KM++    +FG+ L+ + L    L+    LPSPN LK +ILIKNK+L
Sbjct:  264 DAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDEN-APVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRL 465          

HSP 2 Score: 143.665 bits (361), Expect = 3.934e-33
Identity = 84/242 (34.71%), Postives = 142/242 (58.68%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWS-ETFQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            + ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LNYQT D A+++N   F  + +CGY+LKP  M   +      F+P+ E   +G++    ++Q+ISGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++ E+F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  590 YNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRT----FDPFSETPVDGVIAATCSVQVISGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK-LIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTIFCNIVLK 821          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 196.052 bits (497), Expect = 2.707e-49
Identity = 106/203 (52.22%), Postives = 136/203 (67.00%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIE +E D +L+ +G++S +GF  YLM  +N     LD     Q MDHPL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLL+GCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS  QQ KM++    +FG+ L+ + L    L+    LPSPN LK +ILIKNK+L
Sbjct:  264 DAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDEN-APVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRL 465          

HSP 2 Score: 143.665 bits (361), Expect = 3.934e-33
Identity = 84/242 (34.71%), Postives = 142/242 (58.68%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWS-ETFQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            + ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LNYQT D A+++N   F  + +CGY+LKP  M   +      F+P+ E   +G++    ++Q+ISGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++ E+F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  590 YNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRT----FDPFSETPVDGVIAATCSVQVISGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK-LIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTIFCNIVLK 821          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 262.307 bits (669), Expect = 1.578e-69
Identity = 203/598 (33.95%), Postives = 300/598 (50.17%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLF-YSKDLGQALTLAEITKAFGGR--RWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKS--ASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGF-EKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+  + +        E  +AFGGR  RW      G    Q+ + +T  +  +  S P       KS  + + N   K    +    S++ S  P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS VN+  G  + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  466 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLYEITGESNCGPRPFEALQAFGGRVERWK-----GFGLSQTNTNATRPNDSSLSSEPG----GAKSRLKNLKNAMQKKLRGASREGSRSQSPQPHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALAS-VNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1039          

HSP 2 Score: 233.417 bits (594), Expect = 9.381e-61
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   52 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 395          

HSP 3 Score: 217.238 bits (552), Expect = 9.827e-56
Identity = 130/367 (35.42%), Postives = 197/367 (53.68%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVN-STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D   +  ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1201 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1541          

HSP 4 Score: 92.0485 bits (227), Expect = 1.002e-17
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF-------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F             + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1578 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1798          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 254.988 bits (650), Expect = 2.584e-67
Identity = 196/595 (32.94%), Postives = 296/595 (49.75%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKA--FGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK-SRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+            EIT     G R +    + G+    + +T    S+ +S+    K+  K+ K+  Q+     ++  S+    Q     P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS+ +     + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  466 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLY------------EITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQKKLRGASREGSRSQSPQ-----PHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALASVNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1029          

HSP 2 Score: 233.417 bits (594), Expect = 9.418e-61
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   52 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 395          

HSP 3 Score: 217.238 bits (552), Expect = 9.440e-56
Identity = 130/367 (35.42%), Postives = 197/367 (53.68%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVN-STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D   +  ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1191 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1531          

HSP 4 Score: 91.2781 bits (225), Expect = 1.555e-17
Identity = 69/223 (30.94%), Postives = 108/223 (48.43%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF---------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F               + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1568 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGKWLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1790          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 254.988 bits (650), Expect = 2.702e-67
Identity = 196/595 (32.94%), Postives = 296/595 (49.75%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKA--FGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK-SRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+            EIT     G R +    + G+    + +T    S+ +S+    K+  K+ K+  Q+     ++  S+    Q     P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS+ +     + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  466 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLY------------EITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQKKLRGASREGSRSQSPQ-----PHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALASVNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1029          

HSP 2 Score: 233.802 bits (595), Expect = 8.822e-61
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   52 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 395          

HSP 3 Score: 217.238 bits (552), Expect = 8.915e-56
Identity = 130/367 (35.42%), Postives = 196/367 (53.41%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNST-HIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D      ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1191 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1531          

HSP 4 Score: 90.8929 bits (224), Expect = 1.809e-17
Identity = 69/223 (30.94%), Postives = 108/223 (48.43%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF---------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F               + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1568 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGKWLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1790          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 254.988 bits (650), Expect = 2.765e-67
Identity = 199/596 (33.39%), Postives = 298/596 (50.00%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKA--FGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK-SRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGF-EKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+            EIT     G R +    + G+    + +T    S+ +S+    K+  K+ K+  Q+     ++  S+    Q     P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS VN+  G  + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  484 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLY------------EITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQKKLRGASREGSRSQSPQ-----PHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALAS-VNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1047          

HSP 2 Score: 233.802 bits (595), Expect = 8.970e-61
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   70 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 413          

HSP 3 Score: 217.238 bits (552), Expect = 9.001e-56
Identity = 130/367 (35.42%), Postives = 196/367 (53.41%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNST-HIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D      ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1209 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1549          

HSP 4 Score: 91.6633 bits (226), Expect = 1.073e-17
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF-------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F             + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1586 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 254.988 bits (650), Expect = 2.909e-67
Identity = 199/596 (33.39%), Postives = 298/596 (50.00%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKA--FGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK-SRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGF-EKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+            EIT     G R +    + G+    + +T    S+ +S+    K+  K+ K+  Q+     ++  S+    Q     P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS VN+  G  + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  466 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLY------------EITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQKKLRGASREGSRSQSPQ-----PHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALAS-VNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1029          

HSP 2 Score: 233.802 bits (595), Expect = 8.703e-61
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   52 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 395          

HSP 3 Score: 217.238 bits (552), Expect = 8.825e-56
Identity = 130/367 (35.42%), Postives = 197/367 (53.68%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVN-STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D   +  ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1191 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1531          

HSP 4 Score: 91.6633 bits (226), Expect = 1.061e-17
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF-------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F             + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1568 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1788          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0070651)

HSP 1 Score: 179.104 bits (453), Expect = 1.942e-44
Identity = 100/201 (49.75%), Postives = 129/201 (64.18%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            C +II  +E+D E +    MS +GF  YLM  +N   FL   LD      MD PL+HY+I SSHNTYLSG QI G+SSVEMY Q LL+GCRC+ELDCW+  GED  P++ HGH +  +I F+  ++ I   AF +S YPVILS ENHC+  QQ K+A+     FG+ L+   L D  LD    LP P +LK +ILIKNK++
Sbjct:  274 CTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFL-DRLDFY--MEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRM 471          

HSP 2 Score: 132.88 bits (333), Expect = 2.955e-30
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            AH ++S  ES   +  ++     + + ++Q+ R YP G R DSSN+ P +FW  G QMV+LN+Q+ D  +++N   F  +  CGY+LKP  M   +      F+P+ +   +G++    ++++I+GQ L+  +      +E+++ G+  D +K   +TR +  N +NP ++E  F F K+  PDLA +RF V +  S  I+ Q++ P+  L+ G+RH+ L+++    N    +  LFV I ++
Sbjct:  574 AHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRAD----KDFDPFADAPVDGVIAAQCSVKVIAGQFLS--DKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYE-ESGKILGQRILPLDGLQAGYRHVSLRTE---ANFPMSLPMLFVNIELK 806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0301475)

HSP 1 Score: 179.104 bits (453), Expect = 1.942e-44
Identity = 100/201 (49.75%), Postives = 129/201 (64.18%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            C +II  +E+D E +    MS +GF  YLM  +N   FL   LD      MD PL+HY+I SSHNTYLSG QI G+SSVEMY Q LL+GCRC+ELDCW+  GED  P++ HGH +  +I F+  ++ I   AF +S YPVILS ENHC+  QQ K+A+     FG+ L+   L D  LD    LP P +LK +ILIKNK++
Sbjct:  274 CTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFL-DRLDFY--MEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRM 471          

HSP 2 Score: 132.88 bits (333), Expect = 2.955e-30
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            AH ++S  ES   +  ++     + + ++Q+ R YP G R DSSN+ P +FW  G QMV+LN+Q+ D  +++N   F  +  CGY+LKP  M   +      F+P+ +   +G++    ++++I+GQ L+  +      +E+++ G+  D +K   +TR +  N +NP ++E  F F K+  PDLA +RF V +  S  I+ Q++ P+  L+ G+RH+ L+++    N    +  LFV I ++
Sbjct:  574 AHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRAD----KDFDPFADAPVDGVIAAQCSVKVIAGQFLS--DKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYE-ESGKILGQRILPLDGLQAGYRHVSLRTE---ANFPMSLPMLFVNIELK 806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0070650)

HSP 1 Score: 179.104 bits (453), Expect = 1.942e-44
Identity = 100/201 (49.75%), Postives = 129/201 (64.18%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            C +II  +E+D E +    MS +GF  YLM  +N   FL   LD      MD PL+HY+I SSHNTYLSG QI G+SSVEMY Q LL+GCRC+ELDCW+  GED  P++ HGH +  +I F+  ++ I   AF +S YPVILS ENHC+  QQ K+A+     FG+ L+   L D  LD    LP P +LK +ILIKNK++
Sbjct:  274 CTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFL-DRLDFY--MEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRM 471          

HSP 2 Score: 132.88 bits (333), Expect = 2.955e-30
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            AH ++S  ES   +  ++     + + ++Q+ R YP G R DSSN+ P +FW  G QMV+LN+Q+ D  +++N   F  +  CGY+LKP  M   +      F+P+ +   +G++    ++++I+GQ L+  +      +E+++ G+  D +K   +TR +  N +NP ++E  F F K+  PDLA +RF V +  S  I+ Q++ P+  L+ G+RH+ L+++    N    +  LFV I ++
Sbjct:  574 AHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRAD----KDFDPFADAPVDGVIAAQCSVKVIAGQFLS--DKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYE-ESGKILGQRILPLDGLQAGYRHVSLRTE---ANFPMSLPMLFVNIELK 806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0343599)

HSP 1 Score: 179.104 bits (453), Expect = 2.152e-44
Identity = 100/201 (49.75%), Postives = 129/201 (64.18%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            C +II  +E+D E +    MS +GF  YLM  +N   FL   LD      MD PL+HY+I SSHNTYLSG QI G+SSVEMY Q LL+GCRC+ELDCW+  GED  P++ HGH +  +I F+  ++ I   AF +S YPVILS ENHC+  QQ K+A+     FG+ L+   L D  LD    LP P +LK +ILIKNK++
Sbjct:  274 CTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFL-DRLDFY--MEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRM 471          

HSP 2 Score: 132.88 bits (333), Expect = 3.300e-30
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            AH ++S  ES   +  ++     + + ++Q+ R YP G R DSSN+ P +FW  G QMV+LN+Q+ D  +++N   F  +  CGY+LKP  M   +      F+P+ +   +G++    ++++I+GQ L+  +      +E+++ G+  D +K   +TR +  N +NP ++E  F F K+  PDLA +RF V +  S  I+ Q++ P+  L+ G+RH+ L+++    N    +  LFV I ++
Sbjct:  574 AHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRAD----KDFDPFADAPVDGVIAAQCSVKVIAGQFLS--DKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYE-ESGKILGQRILPLDGLQAGYRHVSLRTE---ANFPMSLPMLFVNIELK 806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0100670)

HSP 1 Score: 179.104 bits (453), Expect = 2.152e-44
Identity = 100/201 (49.75%), Postives = 129/201 (64.18%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            C +II  +E+D E +    MS +GF  YLM  +N   FL   LD      MD PL+HY+I SSHNTYLSG QI G+SSVEMY Q LL+GCRC+ELDCW+  GED  P++ HGH +  +I F+  ++ I   AF +S YPVILS ENHC+  QQ K+A+     FG+ L+   L D  LD    LP P +LK +ILIKNK++
Sbjct:  274 CTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFL-DRLDFY--MEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRM 471          

HSP 2 Score: 132.88 bits (333), Expect = 3.300e-30
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            AH ++S  ES   +  ++     + + ++Q+ R YP G R DSSN+ P +FW  G QMV+LN+Q+ D  +++N   F  +  CGY+LKP  M   +      F+P+ +   +G++    ++++I+GQ L+  +      +E+++ G+  D +K   +TR +  N +NP ++E  F F K+  PDLA +RF V +  S  I+ Q++ P+  L+ G+RH+ L+++    N    +  LFV I ++
Sbjct:  574 AHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRAD----KDFDPFADAPVDGVIAAQCSVKVIAGQFLS--DKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYE-ESGKILGQRILPLDGLQAGYRHVSLRTE---ANFPMSLPMLFVNIELK 806          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plce1 (phospholipase C, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-061212-4])

HSP 1 Score: 275.789 bits (704), Expect = 1.108e-74
Identity = 144/302 (47.68%), Postives = 195/302 (64.57%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSS--NIGKIFQKDFNYENEQFYLTRN-------YPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPL--TEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++F++F  LF+SF I SR D+K++FD  +   S S  ++       +I  K    + +   LTRN         +  +++  Q+ ++ A+A ASIV N +G E S   ++ L  +++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DNF  K      N   + HPLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE I+R+AF  S  PVILSIENHCSLPQQ+KMA+IF  VFGEKLVT+
Sbjct:   88 SIMSFVEFVELFKSFSIRSRKDLKELFDTYAVPCSRSGPESVPLYTTLRIDDKLTGLQPDLDLLTRNGSDLGLFIRTRQQMSENQKQISDAIAAASIVTNGTGVENSSLGVLGLAISQLNDFLVNCQREHLSYDEILSIIQKFEPSSNMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDELQHPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAINRAAFVNSEMPVILSIENHCSLPQQRKMAEIFKMVFGEKLVTK 389          

HSP 2 Score: 246.899 bits (629), Expect = 2.026e-65
Identity = 131/353 (37.11%), Postives = 209/353 (59.21%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVL---PQVHLSGTNLSAIVXXXXXXXXGLNIKS-DQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVF 9499
            ++ QI   LS+LV+Y QA+K   L+   SP  + + K    ++ +    P     G  ++ + +   ++  G+ + S DQL      SLS I                         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+IFW  G+Q+VALNYQT+D  +++N A+F  + +CG+VLKP V+W+++  L+  F P +++ E + P   T+ I+SGQN+   N +GSP +E+E++G+  D    +T+PI RN +NP W+E FQF + F DLAF+R AV++ NS+ +  Q++ P+KTL+ G+RH+ L++     N+  +V++LF+F
Sbjct:  530 ESRQIAQELSDLVIYCQAIKFPGLS-TLSPSGSGRGKDRKSRKSIFGSAPARGSPGEPVTLVRAPGKASLEGIRMNSEDQLCLSPSTSLSSI----------------------IRTPKCYHISSVNENAAKRLCRRYSQKLIQHTSCQLLRTYPAATRIDSANPNPLIFWLHGVQLVALNYQTDDLPMQLNAALFEANGHCGFVLKPPVLWDRSCPLYQHFYPLDRDLENMTPTLYTLTIVSGQNVCPGNSNGSPCVEVEVLGMPADSCHFRTKPIHRNTLNPMWNEHFQFHVHFEDLAFLRIAVVENNSSQVTAQRILPLKTLRAGYRHLQLRN---LHNEPLEVSSLFMF 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plce1 (phospholipase C, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-061212-4])

HSP 1 Score: 274.248 bits (700), Expect = 8.113e-73
Identity = 144/302 (47.68%), Postives = 195/302 (64.57%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSS--NIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPL--TEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++F++F  LF+SF I SR D+K++FD  +   S S  ++       +I  K    + +   LTRN         +  +++  Q+ ++ A+A ASIV N +G E S   ++ L  +++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DNF  K      N   + HPLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE I+R+AF  S  PVILSIENHCSLPQQ+KMA+IF  VFGEKLVT+
Sbjct: 1179 SIMSFVEFVELFKSFSIRSRKDLKELFDTYAVPCSRSGPESVPLYTTLRIDDKLTGLQPDLDLLTRNGSDLGLFIRTRQQMSENQKQISDAIAAASIVTNGTGVENSSLGVLGLAISQLNDFLVNCQREHLSYDEILSIIQKFEPSSNMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDELQHPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAINRAAFVNSEMPVILSIENHCSLPQQRKMAEIFKMVFGEKLVTK 1480          

HSP 2 Score: 246.514 bits (628), Expect = 2.418e-64
Identity = 131/353 (37.11%), Postives = 209/353 (59.21%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVL---PQVHLSGTNLSAIVXXXXXXXXGLNIKS-DQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVF 9499
            ++ QI   LS+LV+Y QA+K   L+  S P  + + K    ++ +    P     G  ++ + +   ++  G+ + S DQL      SLS I                         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+IFW  G+Q+VALNYQT+D  +++N A+F  + +CG+VLKP V+W+++  L+  F P +++ E + P   T+ I+SGQN+   N +GSP +E+E++G+  D    +T+PI RN +NP W+E FQF + F DLAF+R AV++ NS+ +  Q++ P+KTL+ G+RH+ L++     N+  +V++LF+F
Sbjct: 1621 ESRQIAQELSDLVIYCQAIKFPGLSTLS-PSGSGRGKDRKSRKSIFGSAPARGSPGEPVTLVRAPGKASLEGIRMNSEDQLCLSPSTSLSSI----------------------IRTPKCYHISSVNENAAKRLCRRYSQKLIQHTSCQLLRTYPAATRIDSANPNPLIFWLHGVQLVALNYQTDDLPMQLNAALFEANGHCGFVLKPPVLWDRSCPLYQHFYPLDRDLENMTPTLYTLTIVSGQNVCPGNSNGSPCVEVEVLGMPADSCHFRTKPIHRNTLNPMWNEHFQFHVHFEDLAFLRIAVVENNSSQVTAQRILPLKTLRAGYRHLQLRNLH---NEPLEVSSLFMF 1947          

HSP 3 Score: 199.519 bits (506), Expect = 4.477e-50
Identity = 153/597 (25.63%), Postives = 266/597 (44.56%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDK----------------------GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAA--GVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI-----SMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFF-----------KP--SCRPIVDMINISNVV--------VIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            + EL +L  LIQFPEE+A +L + E +L++ + P  Y+ +++ DL S P+  K                       V +L+TR  EVSSW+T LI+T  + EE++ +FS +V +   S+ +GN+NAV+E LAGL+S K+   W  +      ++  +  L + +   E +  Y+ VV+RAL I    V+PF G+FL +L   ++   +I+ L PS D+    V  V+D+NG+  F+ R+G  GL + +K   V  IL  I     S+      E ++   +     +  K+++   P  E               P  + + +VD+    +V         +I   +  + P   Q +  G TV+  D +        L+L   N  + W KP +  S +             G   +F+  P S    H+ Q          +C  S                  G +D+  +K ++ G+     N   +  +         P    ++++YG   ++N++++ V P   A+    GL +L+ + + IR   DQ++ WL+  Y+ L+      +  TLA   + FGGRRW++  S 
Sbjct:  468 SKELADLRHLIQFPEEIATILTEQEQQLYRRVFPLDYLSFLTRDLGS-PECHKRHPHLKASLSAPIMPTQNDNHNTVEDLVTRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCSWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQA---DIETMRGLKDAMAQHESSSEYKKVVSRALNIPGCKVVPFCGVFLKELSEALDGAASIIGLRPSFDSQEDPVEFVTDYNGQQHFLQRLGSDGLHSSDKEATVSNILQTIRSCNRSLEAEEPEERAREITVCPKNSFKDKSRNQKGPGTERVLFSIGDLSDSEGDPLETVKDVVDLQTTEDVRGPFSHGTELIPWYVLSLQPDIHQFLLQGATVIHYDPESHLTARCLLRLQPDNCFLTWCKPHSSCSLY-------------GRARTFMGHPASPDHLHIGQPV--------HCGLS-----------------DGLLDLNVVKAVFMGHPGVDVNYVCLQHKLCNMN----PGENGVTLLYGLHTTDNRLLHFVAPKHTARMLHEGLQELLNSIRKIRKFPDQRLQWLRKQYVSLYQEDGRFEGPTLAHAIELFGGRRWNMGTSG 1018          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcd1b (phospholipase C, delta 1b [Source:ZFIN;Acc:ZDB-GENE-030131-9435])

HSP 1 Score: 195.282 bits (495), Expect = 1.711e-50
Identity = 100/231 (43.29%), Postives = 141/231 (61.04%), Query Frame = 2
Query: 7322 IIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVK 8014
            ++   ++ N L   Q E   + D  ++IEK+E+D   +A+  M+ +GF  YL   +  +      +    M+ PLSHYFI+SSHNTYL   Q+ G SS E Y + LL GCRC+ELDCWDG DG PVIYHG+T T+KI F+ V++ I   AF+TS YPVILS+ENHC + QQ+ MAQ  + + G  LVT+            LP+P +LK R ++K K+L   ++AF  + K
Sbjct:  224 LMSANDLLNFLLTEQREEVSQNDALQLIEKYELDENAKAKQQMTQDGFLMYLHQPEGLIFNQAHKSVYHDMNQPLSHYFISSSHNTYLMEDQLKGPSSTEAYIRALLKGCRCVELDCWDGSDGEPVIYHGYTLTSKILFKDVIKAIKEYAFKTSEYPVILSLENHCGVEQQKIMAQHLTSILGSALVTK---PLGDQMPTCLPAPEELKGRFIVKGKRLDKLENAFSDESK 451          

HSP 2 Score: 147.132 bits (370), Expect = 6.603e-35
Identity = 87/249 (34.94%), Postives = 131/249 (52.61%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNH----VLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGS----PLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNST---HIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMED 9514
            +++AS  E KA  +     T  I H   +L R YP G+R DSSN+NPV  W  G Q+VALN+QT    +++N  +F Q+   GY+LKP+ +  ++     +   K  PW K         L + +IS Q L  +    S    P++++++ G+  D    +T  I+ N  NP W+E FQ ++  PDLA +RF + D +ST     I Q   P  +L+ G+ H+PL +Q   GN L   A LFV I + D
Sbjct:  509 YEMASFKEGKALKLAEESATEYIRHNTDKLSRIYPGGMRTDSSNYNPVPMWNAGCQIVALNFQTPCLEMDLNQGLFYQNGRSGYILKPSYLRERDTEFDPITLTK-GPWLKR------KTLHVMVISAQQLPKVGKRESAIVDPIVKVQVYGVPADTAAVETSYIKNNGFNPMWNENFQLEVCVPDLALVRFLIEDYDSTSDNEFIGQYTLPFNSLRNGYHHVPLLTQ--DGN-LLSSAGLFVHIMVVD 747          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcg1 (phospholipase C, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-030421-3])

HSP 1 Score: 190.66 bits (483), Expect = 5.108e-48
Identity = 99/181 (54.70%), Postives = 127/181 (70.17%), Query Frame = 2
Query: 7463 FACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQ 8002
            F  YL  ++N +    LD    + M++PLSHY+I+SSHNTYL+G Q + ESS+E YA+ L  GCRCIELDCWDG DG PVIYHGHT T KI F  V+ TI   AF TS YP+ILSIE+HCS+ QQ+ MA  F +VFGE L+T+    +       LPSP+QLK +ILIK+KKL ++ SA++
Sbjct:    1 FLTYLFSKENTIWDAQLDQVRPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIKEHAFVTSDYPIILSIEDHCSIVQQRNMATFFKKVFGEMLLTK----AVDISADGLPSPHQLKRKILIKHKKL-AEGSAYE 176          

HSP 2 Score: 138.272 bits (347), Expect = 7.315e-32
Identity = 78/245 (31.84%), Postives = 138/245 (56.33%), Query Frame = 2
Query: 8807 IASVNESKAKSVCRRIPTFLICHCEK-QLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKE-FEGILPCYLTIQIISGQNL-----NIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWS-ETFQFKIAFPDLAFIRFAVIDVN---STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISM 9508
            ++S  E+KA+    R+         + QL R YP G RLDSSN++P+  W  G Q+VALN+QT D+ +++N A+F  +   GYVL+P +M + N      F+P+++    G+ P  L+I+++  ++L      I+     PL+E+E+ G + D  K +T     N +NP W+ + F+F +  P  AF+RF V +++     + + Q  +P+  LK G+R +PLK+ +   ++  ++A L V + +
Sbjct:  683 MSSFPETKAEKYVNRVKGKKFLQYNRLQLSRIYPRGQRLDSSNYDPLPMWLCGSQLVALNFQTADKPMQMNQAIFMLNGRSGYVLQPPIMRDDN------FDPFDRHSLRGVEPITLSIEVLGARHLPKHGRGIV----CPLIEIEVCGAEYDNAKQRTDSEADNGLNPTWTRKLFRFTVCNPSFAFLRFVVYEIDMFSDQNFLAQATFPINCLKTGYRSVPLKNSY---SEDLELACLLVHMDV 914          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plch2a (phospholipase C, eta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6367])

HSP 1 Score: 191.43 bits (485), Expect = 7.816e-48
Identity = 86/166 (51.81%), Postives = 117/166 (70.48%), Query Frame = 2
Query: 7382 KEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKL 7879
            KE C +I+ K E  PE +  G++  +GF  Y+      +        +Q M  PLS YFIASSHNTYL G Q+  +S V+MYA VL +GCRC+E+DCWDG+DG P+++HG+T T+KI F+ V+ETI++ AF  + YPVILSIENHCS+PQQ+KMAQ  ++V G+KL
Sbjct:  292 KEHCLEIVAKFEPCPENQTSGVLGIDGFTNYMRSPAGDIFNPEHYEVNQDMTQPLSDYFIASSHNTYLMGDQLMSQSRVDMYAWVLQAGCRCVEVDCWDGQDGEPIVHHGYTLTSKILFKDVIETINKYAFAKNQYPVILSIENHCSVPQQKKMAQYLTEVLGDKL 457          

HSP 2 Score: 154.066 bits (388), Expect = 2.182e-36
Identity = 88/253 (34.78%), Postives = 137/253 (54.15%), Query Frame = 2
Query: 8804 QIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNP-WEKEFEGILPCYLTIQIISGQNL-----NIINPSGS---PLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVN--STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRV 9529
            Q++S++E+KA  + ++ P   +   ++QL R YP+  R+DSSNFNP  FW  G  +VALNYQ+E + L++N A F  + NCGY+ KP  +          FNP  E    G L   L +++ISGQ L     +++   G    P +E+EIIG+ +DC K +TR +  N  NP W ET  F +  P+ A IRF V D +      I Q+     ++  G+RH+ L+          + A++FV +++ D  S+ 
Sbjct:  670 QVSSMSETKAHQLIQQKPVPFMRFNQRQLSRVYPSPYRVDSSNFNPQPFWNAGCHLVALNYQSEGRVLQLNRAKFYCNGNCGYIQKPGCLCE------GSFNPVAEDPLPGRLKKQLILKVISGQQLPKPKDSMLGDRGEIIDPFVEVEIIGLPVDCCKEQTRVVDDNGFNPMWEETLVFTLHMPENALIRFLVWDHDPIGQDFIGQRTIAFNSMIPGYRHVYLEG--------MEEASIFVHVAVNDITSKA 908          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:Xenbase;Acc:XB-GENE-1008596])

HSP 1 Score: 329.717 bits (844), Expect = 1.401e-89
Identity = 216/632 (34.18%), Postives = 328/632 (51.90%), Query Frame = 2
Query: 6152 MDG-QSGFIDIFTIKQIYYGN---GRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNS------------------------------------SGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQ--NILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            M+G   GF+D+F++K +Y G+         + + +     +EN        ++++YG   ++NK+++ V P   A+    GL +L  A + I+   DQ++ WL+  Y+ L+  ++  +   LA+  + FGGRRWS  N+                                    SG  +D   +T    S   S+SR  ++      +++Q  N+     + +S SQ      + P  R+ S    +++S S N     + P  LR ++  S  ++NSN+ QS    S+ +           VK  +    ++           +   S +NF +F  LF+SF + SR D+K IFD  +   + S  ++    +N+  I +     + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  +  +Q  + L   QGE    ++   II+K E    +R QG+MS+EGFA +LMD+DNF  +      N + +  PLS+YFI SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ V+E I RSAF TS  P++LSIENHCSLPQQ+KMA IF  VFGEKLVT+
Sbjct:  831 MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEENG-------VTLLYGLHTTDNKLLHFVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIELFGGRRWSTRNTSTGTLTKSTEKPNVQRNNTLGINTAKKKKKVLMRGESGDAADDEMATRKTKSCKESRSRSGSDPPEIDEQEEQDLNII----AGYSPSQ------MLPSRRAHS----MSTSGSPNLTPGPSIP--LRPAS--SPILSNSNKPQSNTWSSSSWHG--------RVKGGMKGFQSF-----------MVSDSNMNFTEFVELFKSFSVRSRKDLKDIFDVYAVACNRSGAESVPLYTNL-TIDENVVGVQPDLDLLTRNVSDLGLFIRSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDEVLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTK 1417          

HSP 2 Score: 266.159 bits (679), Expect = 3.541e-70
Identity = 190/593 (32.04%), Postives = 308/593 (51.94%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI-------EEIP--RLIGLQENIESIIE----KSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNF------LSKSSKDS 10489
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN +P+IFW  G+Q+VALNYQT+D  L +N AMF  +  CGYVLKP V W++   ++  F+P E++ E + P   ++ I+SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP W+E F F+I F DL F+RFAV++ NS+ +  Q++  +K LK+G RH+ L++     N+  +V+TLF+      +  R++                         +IP   T        L +  +  S+ R T A   K  VH     G+   E +T+ +I+  +TA  ++   L      +  I +Y L++E   I       +++P  R+I  +E+I  I+     +     R +LK    + + +      + ED   ++E+E +     ++F         V +++VSPEQP T++K    ST  +VI  AL KA+         +P+D+VL+EE+   A N + S         T K+ +R+L   ECV+  Q +   +GK +L  K   E+V +    K+   +       L+KSS+ S
Sbjct: 1658 PRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAIYSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYFEDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRN---LHNEPLEVSTLFI------NSRRME-------------------------EIPNGNT--------LPASLFFSSEERKTPATF-KATVH-----GIPGPEPFTVFEISLGTTAKQLLDHILATIQGNEADITDYFLMEEKCFISKDKNECKKLPFQRVISPEEDILQILNSWFPEEGYVGRIVLKTREENMNDKN-----VQED---KEEKEVTVSSDEETF--------FVQVHDVSPEQPRTVIKALRFSTAQEVIQQALCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSS---------TSKTIQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQAARDDKRKGLSIASELKKLAKSSRQS 2174          

HSP 3 Score: 126.331 bits (316), Expect = 9.638e-28
Identity = 77/217 (35.48%), Postives = 119/217 (54.84%), Query Frame = 2
Query: 4985 AQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAG--VSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            AQ +S  F+  +P    R V+L           V  L   LK VSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL++ K+   W  +    ++++  +  L + +   E +  YR VVNRAL I    V+PF G+FL +L  +++   +I+ L P  DA    +  VSD+NG+D F+ RIG  GL N  K   V +I+  I
Sbjct:  475 AQVQSSYFEVREPVYLCRTVTLR----------VLFLCLSLK-VSSWVTWLILTAGSMEEKREVFSHVVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQDNFLQRIGKDGLKNTEKESTVNSIMQTI 677          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:Xenbase;Acc:XB-GENE-1008596])

HSP 1 Score: 326.25 bits (835), Expect = 1.498e-88
Identity = 213/603 (35.32%), Postives = 319/603 (52.90%), Query Frame = 2
Query: 6152 MDG-QSGFIDIFTIKQIYYGN---GRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSC-------STSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQ--NILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            M+G   GF+D+F++K +Y G+         + + +     +EN        ++++YG   ++NK+++ V P   A+    GL +L  A + I+   DQ++ WL+  Y+ L+  ++  +   LA+  + FGGRRWS  N+S     +S        + +   +T   K +     +S  +   ++     KS  K S S++ S     PP     +EQ L   + ++   M+  PS   HS      M+ S     T   S    +   S     VK  +    ++           +   S +NF +F  LF+SF + SR D+K IFD  +   + S  ++    +N+  I +     + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  +  +Q  + L   QGE    ++   II+K E    +R QG+MS+EGFA +LMD+DNF  +      N + +  PLS+YFI SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ V+E I RSAF TS  P++LSIENHCSLPQQ+KMA IF  VFGEKLVT+
Sbjct:  777 MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEEN-------GVTLLYGLHTTDNKLLHFVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIELFGGRRWSTRNTSTGTLTKSTEKPNVQRNNTLGINTAKKKKKVLMRGESGDAADDEMATRKTKSC-KESRSRSGS----DPPEIDEQEEQDLNIIAGYSPSQML--PSRRAHS------MSTSGSPNLTPGPSIPLTW-SSSSWHGRVKGGMKGFQSF-----------MVSDSNMNFTEFVELFKSFSVRSRKDLKDIFDVYAVACNRSGAESVPLYTNL-TIDENVVGVQPDLDLLTRNVSDLGLFIRSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDEVLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTK 1346          

HSP 2 Score: 256.914 bits (655), Expect = 2.096e-67
Identity = 189/589 (32.09%), Postives = 304/589 (51.61%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI-------EEIP--RLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNF------LSKSSKDS 10489
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN +P+IFW  G+Q+VALNYQT+D  L +N AMF  +  CGYVLKP V W++   ++  F+P E++ E + P   ++ I+SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP W+E F F+I F DL F+RFAV++ NS+ +  Q++  +K LK+G RH+ L++     N+  +V+TLF+      +  R++                         +IP   T        L +  +  S+ R T A   K  VH     G+   E +T+ +I+  +TA  ++   L      +  I +Y L++E   I       +++P  R+I  +E+I  I+             NS  P    ++  I+ +     +E+E +     ++F         V +++VSPEQP T++K    ST  +VI  AL KA+         +P+D+VL+EE+   A N + S         T K+ +R+L   ECV+  Q +   +GK +L  K   E+V +    K+   +       L+KSS+ S
Sbjct: 1587 PRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAIYSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYFEDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRN---LHNEPLEVSTLFI------NSRRME-------------------------EIPNGNT--------LPASLFFSSEERKTPATF-KATVH-----GIPGPEPFTVFEISLGTTAKQLLDHILATIQGNEADITDYFLMEEKCFISKDKNECKKLPFQRVISPEEDILQIL-------------NSWFP-EEGYVGRIVLKTREEVEEKEVTVSSDEETF--------FVQVHDVSPEQPRTVIKALRFSTAQEVIQQALCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSS---------TSKTIQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQAARDDKRKGLSIASELKKLAKSSRQS 2093          

HSP 3 Score: 124.02 bits (310), Expect = 4.934e-27
Identity = 68/180 (37.78%), Postives = 107/180 (59.44%), Query Frame = 2
Query: 5096 ITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAG--VSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            +TR  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL++ K+   W  +    ++++  +  L + +   E +  YR VVNRAL I    V+PF G+FL +L  +++   +I+ L P  DA    +  VSD+NG+D F+ RIG  GL N  K   V +I+  I
Sbjct:  448 VTR-AEVSSWVTWLILTAGSMEEKREVFSHVVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQDNFLQRIGKDGLKNTEKESTVNSIMQTI 623          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:Xenbase;Acc:XB-GENE-1008596])

HSP 1 Score: 325.479 bits (833), Expect = 2.488e-88
Identity = 214/603 (35.49%), Postives = 321/603 (53.23%), Query Frame = 2
Query: 6152 MDG-QSGFIDIFTIKQIYYGN---GRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSN-SSGVVSDQS----CSTSTYASTFTSKSRPKT--NNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQ--NILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            M+G   GF+D+F++K +Y G+         + + +     +EN        ++++YG   ++NK+++ V P   A+    GL +L  A + I+   DQ++ WL+  Y+ L+  ++  +   LA+  + FGGRRWS  N S+G ++  +       +      T+K + K     +S  +   ++     KS  K S S++ S     PP     +EQ L   + ++   M+  PS   HS      M+ S     T   S    +   S     VK  +    ++           +   S +NF +F  LF+SF + SR D+K IFD  +   + S  ++    +N+  I +     + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  +  +Q  + L   QGE    ++   II+K E    +R QG+MS+EGFA +LMD+DNF  +      N + +  PLS+YFI SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ V+E I RSAF TS  P++LSIENHCSLPQQ+KMA IF  VFGEKLVT+
Sbjct:  814 MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEEN-------GVTLLYGLHTTDNKLLHFVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIELFGGRRWSTRNTSTGTLTKSTEKPNVQRNNTLGINTAKKKKKVLMRGESGDAADDEMATRKTKSC-KESRSRSGS----DPPEIDEQEEQDLNIIAGYSPSQML--PSRRAHS------MSTSGSPNLTPGPSIPLTW-SSSSWHGRVKGGMKGFQSF-----------MVSDSNMNFTEFVELFKSFSVRSRKDLKDIFDVYAVACNRSGAESVPLYTNL-TIDENVVGVQPDLDLLTRNVSDLGLFIRSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDEVLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTK 1383          

HSP 2 Score: 264.618 bits (675), Expect = 8.741e-70
Identity = 193/593 (32.55%), Postives = 308/593 (51.94%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI-------EEIP--RLIGLQENIESIIE----KSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNF------LSKSSKDS 10489
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN +P+IFW  G+Q+VALNYQT+D  L +N AMF  +  CGYVLKP V W++   ++  F+P E++ E + P   ++ I+SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP W+E F F+I F DL F+RFAV++ NS+ +  Q++  +K LK+G RH+ L++     N+  +V+TLF+      +  R++                         +IP   T        L +  +  S+ R T A   K  VH     G+   E +T+ +I+  +TA     Q L   G   D I +Y L++E   I       +++P  R+I  +E+I  I+     +     R +LK    + + +      + ED   ++E+E +     ++F         V +++VSPEQP T++K    ST  +VI  AL KA+         +P+D+VL+EE+   A N + S         T K+ +R+L   ECV+  Q +   +GK +L  K   E+V +    K+   +       L+KSS+ S
Sbjct: 1624 PRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAIYSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYFEDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRN---LHNEPLEVSTLFI------NSRRME-------------------------EIPNGNT--------LPASLFFSSEERKTPATF-KATVH-----GIPGPEPFTVFEISLGTTA----KQLLDHVGNEAD-ITDYFLMEEKCFISKDKNECKKLPFQRVISPEEDILQILNSWFPEEGYVGRIVLKTREENMNDKN-----VQED---KEEKEVTVSSDEETF--------FVQVHDVSPEQPRTVIKALRFSTAQEVIQQALCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSS---------TSKTIQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQAARDDKRKGLSIASELKKLAKSSRQS 2135          

HSP 3 Score: 121.709 bits (304), Expect = 2.471e-26
Identity = 65/175 (37.14%), Postives = 104/175 (59.43%), Query Frame = 2
Query: 5111 EVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAG--VSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            +VSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL++ K+   W  +    ++++  +  L + +   E +  YR VVNRAL I    V+PF G+FL +L  +++   +I+ L P  DA    +  VSD+NG+D F+ RIG  GL N  K   V +I+  I
Sbjct:  489 KVSSWVTWLILTAGSMEEKREVFSHVVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQDNFLQRIGKDGLKNTEKESTVNSIMQTI 660          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:Xenbase;Acc:XB-GENE-1008596])

HSP 1 Score: 325.479 bits (833), Expect = 3.003e-88
Identity = 216/603 (35.82%), Postives = 321/603 (53.23%), Query Frame = 2
Query: 6152 MDG-QSGFIDIFTIKQIYYGN---GRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSC-------STSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQ--NILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            M+G   GF+D+F++K +Y G+         + + +     +EN        ++++YG   ++NK+++ V P   A+    GL +L  A + I+   DQ++ WL+  Y+ L+  ++  +   LA+  + FGGRRWS  N+S     +S        + +   +T   K +     +S  +   ++     KS  K S S++ S     PP     +EQ L   + ++   M+  PS   HS      M+ S     T   S         PL  S   S + RV    +    +   +   S +NF +F  LF+SF + SR D+K IFD  +   + S  ++    +N+  I +     + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  +  +Q  + L   QGE    ++   II+K E    +R QG+MS+EGFA +LMD+DNF  +      N + +  PLS+YFI SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ V+E I RSAF TS  P++LSIENHCSLPQQ+KMA IF  VFGEKLVT+
Sbjct:  841 MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEEN-------GVTLLYGLHTTDNKLLHFVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIELFGGRRWSTRNTSTGTLTKSTEKPNVQRNNTLGINTAKKKKKVLMRGESGDAADDEMATRKTKSC-KESRSRSGSD----PPEIDEQEEQDLNIIAGYSPSQML--PSRRAHS------MSTSGSPNLTPGPSI--------PLTWS-SSSWHGRVK-GGMKGFQSF--MVSDSNMNFTEFVELFKSFSVRSRKDLKDIFDVYAVACNRSGAESVPLYTNL-TIDENVVGVQPDLDLLTRNVSDLGLFIRSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDEVLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTK 1410          

HSP 2 Score: 260.766 bits (665), Expect = 1.334e-68
Identity = 191/594 (32.15%), Postives = 299/594 (50.34%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI-------EEIP--RLIGLQENIESIIE----KSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEV-------LSCSSHKKNNWNFLSKSSKDS 10489
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN +P+IFW  G+Q+VALNYQT+D  L +N AMF  +  CGYVLKP V W++   ++  F+P E++ E + P   ++ I+SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP W+E F F+I F DL F+RFAV++ NS+ +  Q++  +K LK+G RH+ L++     N+  +V+TLF+      +  R++                         +IP   T        L +  +  S+ R T A   K  VH     G+   E +T+ +I+  +TA  ++   L      +  I +Y L++E   I       +++P  R+I  +E+I  I+     +     R +LK             T+         +EE  F                V +++VSPEQP T++K    ST  +VI  AL KA+         +P+D+VL+EE+   A N + S         T K+ +R+L   ECV+  Q +   +GK +L  K  V+         LS +S  K     L+KSS+ S
Sbjct: 1659 PRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAIYSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYFEDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRN---LHNEPLEVSTLFI------NSRRME-------------------------EIPNGNT--------LPASLFFSSEERKTPA-TFKATVH-----GIPGPEPFTVFEISLGTTAKQLLDHILATIQGNEADITDYFLMEEKCFISKDKNECKKLPFQRVISPEEDILQILNSWFPEEGYVGRIVLKTREEVEDKEEKEVTV-------SSDEETFF----------------VQVHDVSPEQPRTVIKALRFSTAQEVIQQALCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSS---------TSKTIQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQAARDDKRKGLSIASELKK----LAKSSRQS 2168          

HSP 3 Score: 121.324 bits (303), Expect = 2.794e-26
Identity = 65/175 (37.14%), Postives = 104/175 (59.43%), Query Frame = 2
Query: 5111 EVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAG--VSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            +VSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL++ K+   W  +    ++++  +  L + +   E +  YR VVNRAL I    V+PF G+FL +L  +++   +I+ L P  DA    +  VSD+NG+D F+ RIG  GL N  K   V +I+  I
Sbjct:  516 KVSSWVTWLILTAGSMEEKREVFSHVVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQDNFLQRIGKDGLKNTEKESTVNSIMQTI 687          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:Xenbase;Acc:XB-GENE-1008596])

HSP 1 Score: 276.174 bits (705), Expect = 2.877e-73
Identity = 146/303 (48.18%), Postives = 195/303 (64.36%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQ--NILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S +NF +F  LF+SF + SR D+K IFD  +   + S  ++    +N+  I +     + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  +  +Q  + L   QGE    ++   II+K E    +R QG+MS+EGFA +LMD+DNF  +      N + +  PLS+YFI SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ V+E I RSAF TS  P++LSIENHCSLPQQ+KMA IF  VFGEKLVT+
Sbjct: 1065 SNMNFTEFVELFKSFSVRSRKDLKDIFDVYAVACNRSGAESVPLYTNL-TIDENVVGVQPDLDLLTRNVSDLGLFIRSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDEVLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTK 1366          

HSP 2 Score: 232.646 bits (592), Expect = 5.395e-60
Identity = 106/235 (45.11%), Postives = 160/235 (68.09%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN +P+IFW  G+Q+VALNYQT+D  L +N AMF  +  CGYVLKP V W++   ++  F+P E++ E + P   ++ I+SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP W+E F F+I F DL F+RFAV++ NS+ +  Q++  +K LK+G RH+ L++     N+  +V+TLF+
Sbjct: 1607 PRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAIYSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYFEDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRN---LHNEPLEVSTLFI 1838          

HSP 3 Score: 121.709 bits (304), Expect = 2.433e-26
Identity = 65/175 (37.14%), Postives = 104/175 (59.43%), Query Frame = 2
Query: 5111 EVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAG--VSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            +VSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL++ K+   W  +    ++++  +  L + +   E +  YR VVNRAL I    V+PF G+FL +L  +++   +I+ L P  DA    +  VSD+NG+D F+ RIG  GL N  K   V +I+  I
Sbjct:  488 KVSSWVTWLILTAGSMEEKREVFSHVVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQDNFLQRIGKDGLKNTEKESTVNSIMQTI 659          

HSP 4 Score: 78.1814 bits (191), Expect = 3.299e-13
Identity = 40/140 (28.57%), Postives = 75/140 (53.57%), Query Frame = 2
Query: 6152 MDG-QSGFIDIFTIKQIYYGN---GRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            M+G   GF+D+F++K +Y G+         + + +     +EN        ++++YG   ++NK+++ V P   A+    GL +L  A + I+   DQ++ WL+  Y+ L+  ++  +   LA+  + FGGRRWS  N+S
Sbjct:  813 MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEEN-------GVTLLYGLHTTDNKLLHFVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIELFGGRRWSTRNTS 945          

HSP 5 Score: 54.299 bits (129), Expect = 6.380e-6
Identity = 44/131 (33.59%), Postives = 65/131 (49.62%), Query Frame = 2
Query: 10091 SSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNW 10459
            S      V +++VSPEQP T++K    ST  +VI  AL KA+         +P+D+VL+EE+   A N + S         T K+ +R+L   ECV+  Q +   +GK +L  K    E + C S  K  W
Sbjct: 1974 SDEETFFVQVHDVSPEQPRTVIKALRFSTAQEVIQQALCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSS---------TSKTIQRVLLDQECVFQAQSKWKGAGKFILKLK----EQVQCRSVTKMKW 2091          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plce1 (phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:MGI:1921305])

HSP 1 Score: 441.425 bits (1134), Expect = 6.692e-124
Identity = 319/1058 (30.15%), Postives = 506/1058 (47.83%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS------VPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISM-FQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPH--------------------------CLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLF--NKSASKFSDSQNSSQVPISPPIRSR--SQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRI--IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DLSS      +P++   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  Y+ VV RAL I    V+PF G+FL +L  +++    +L L    S+    +  V+D++G+D F+ R+G  GL N  K   V  +  ++   S   +M   +S+             +  S  D    +F       I D+++  N +  + +  + DPH                            Q +  G TV+  D+D       FL+L   NS + W KP   +             +   P    L         ++ +  ++  PGN           A  +G        G +D+F++K +Y G+     +   +  +        L     ++++YG   ++N++++ V P   A+    GL +L  A + IR   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S  +S ++            K   + NN    S  ++   +    +S     D   + +  +    RSR  S  Q +          + N P+ L     YS   A S        L+        +  + S    I  R       +   ++  +  S++ F++   LF+SF I SR D+K IFD  S   + S ++++   +N+  I +   + + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  + + ++ + L   QGE    ++   II+K E    +  QG++S+EGFA +LMD+DNF  K      N + +  PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR IELDCWDG+DG P+IYHGHT T KI F+ VVE IDRSAF TS  P+I+SIENHCSLPQQ+KMA+IF  VFGEKLV +
Sbjct:  518 ELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLLKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEMEEEDSASEGSGS-------RKNSLKDKARWQFI------IGDLLDSENDIFEKSK--ECDPHGSEESQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASP------------AGARPKLGVLS--------NMAEPGKFPSPGN-----------AGVSGLA-----EGILDLFSVKAVYMGHPGIDIHTVCVQNKLSSM----LLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKN----------AEKPNMQRNNTLGISTTKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNPLHSRRAYSLTTAGSPN------LATGMSSPISAWSSSSWHGRI--RGGMQGFQSFMVSD--SNMSFVEFVE---LFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNL-TIEENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAK 1493          

HSP 2 Score: 270.781 bits (691), Expect = 1.118e-71
Identity = 187/600 (31.17%), Postives = 300/600 (50.00%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFIS---MEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPS 10531
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+K+  ++ KF+P E++ + + P   ++ IISGQN+   N +GSP +E++++G+ +D    +T+PI RN +NP W+E F F++ F DL F+RFAV++ NS+ I  Q++ P++ LK+G+RH+ L++     N++ ++++L  FI+   ME++                                  P  +++       ++  K S            + H + + GV   E + +  I   + A  ++ Q L        +  +Y L++E   I         +   R +G +E+I  I+             NS  P        +L       +E+   FD      S S      V +++VSPEQP T++K    ST   VI   L KA+         +P D+VL+EE+   A N + S         T KSS+RIL   ECV+  Q +   +GK +L  K   E+V +    K+   +F S+  K     + + +S+ +PS
Sbjct: 1746 PKCYHISSLNENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLRALKRGYRHLQLRNLH---NEILEISSL--FINSRRMEEN----------------------------------PSGSSMPASLMFNTEERKCS------------QTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQIL-------------NSWFPEEGYVGRIVLKPQQETLEEKSIVFDDKEVILS-SEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNNPNPCDYVLLEEVLKDAANKKSS---------TPKSSQRILLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKRRGISFASELKK---LTKSTKQSRGLPS 2265          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plce1 (phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:MGI:1921305])

HSP 1 Score: 441.039 bits (1133), Expect = 7.078e-124
Identity = 319/1058 (30.15%), Postives = 506/1058 (47.83%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS------VPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISM-FQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPH--------------------------CLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLF--NKSASKFSDSQNSSQVPISPPIRSR--SQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRI--IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DLSS      +P++   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  Y+ VV RAL I    V+PF G+FL +L  +++    +L L    S+    +  V+D++G+D F+ R+G  GL N  K   V  +  ++   S   +M   +S+             +  S  D    +F       I D+++  N +  + +  + DPH                            Q +  G TV+  D+D       FL+L   NS + W KP   +             +   P    L         ++ +  ++  PGN           A  +G        G +D+F++K +Y G+     +   +  +        L     ++++YG   ++N++++ V P   A+    GL +L  A + IR   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S  +S ++            K   + NN    S  ++   +    +S     D   + +  +    RSR  S  Q +          + N P+ L     YS   A S        L+        +  + S    I  R       +   ++  +  S++ F++   LF+SF I SR D+K IFD  S   + S ++++   +N+  I +   + + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  + + ++ + L   QGE    ++   II+K E    +  QG++S+EGFA +LMD+DNF  K      N + +  PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR IELDCWDG+DG P+IYHGHT T KI F+ VVE IDRSAF TS  P+I+SIENHCSLPQQ+KMA+IF  VFGEKLV +
Sbjct:  518 ELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLLKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEMEEEDSASEGSGS-------RKNSLKDKARWQFI------IGDLLDSENDIFEKSK--ECDPHGSEESQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASP------------AGARPKLGVLS--------NMAEPGKFPSPGN-----------AGVSGLA-----EGILDLFSVKAVYMGHPGIDIHTVCVQNKLSSM----LLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKN----------AEKPNMQRNNTLGISTTKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNPLHSRRAYSLTTAGSPN------LATGMSSPISAWSSSSWHGRI--RGGMQGFQSFMVSD--SNMSFVEFVE---LFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNL-TIEENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAK 1493          

HSP 2 Score: 270.396 bits (690), Expect = 1.207e-71
Identity = 187/600 (31.17%), Postives = 300/600 (50.00%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFIS---MEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPS 10531
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+K+  ++ KF+P E++ + + P   ++ IISGQN+   N +GSP +E++++G+ +D    +T+PI RN +NP W+E F F++ F DL F+RFAV++ NS+ I  Q++ P++ LK+G+RH+ L++     N++ ++++L  FI+   ME++                                  P  +++       ++  K S            + H + + GV   E + +  I   + A  ++ Q L        +  +Y L++E   I         +   R +G +E+I  I+             NS  P        +L       +E+   FD      S S      V +++VSPEQP T++K    ST   VI   L KA+         +P D+VL+EE+   A N + S         T KSS+RIL   ECV+  Q +   +GK +L  K   E+V +    K+   +F S+  K     + + +S+ +PS
Sbjct: 1732 PKCYHISSLNENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLRALKRGYRHLQLRNLH---NEILEISSL--FINSRRMEEN----------------------------------PSGSSMPASLMFNTEERKCS------------QTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQIL-------------NSWFPEEGYVGRIVLKPQQETLEEKSIVFDDKEVILS-SEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNNPNPCDYVLLEEVLKDAANKKSS---------TPKSSQRILLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKRRGISFASELKK---LTKSTKQSRGLPS 2251          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plce1 (phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:MGI:1921305])

HSP 1 Score: 441.039 bits (1133), Expect = 7.078e-124
Identity = 319/1058 (30.15%), Postives = 506/1058 (47.83%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS------VPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISM-FQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPH--------------------------CLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLF--NKSASKFSDSQNSSQVPISPPIRSR--SQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRI--IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DLSS      +P++   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  Y+ VV RAL I    V+PF G+FL +L  +++    +L L    S+    +  V+D++G+D F+ R+G  GL N  K   V  +  ++   S   +M   +S+             +  S  D    +F       I D+++  N +  + +  + DPH                            Q +  G TV+  D+D       FL+L   NS + W KP   +             +   P    L         ++ +  ++  PGN           A  +G        G +D+F++K +Y G+     +   +  +        L     ++++YG   ++N++++ V P   A+    GL +L  A + IR   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S  +S ++            K   + NN    S  ++   +    +S     D   + +  +    RSR  S  Q +          + N P+ L     YS   A S        L+        +  + S    I  R       +   ++  +  S++ F++   LF+SF I SR D+K IFD  S   + S ++++   +N+  I +   + + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  + + ++ + L   QGE    ++   II+K E    +  QG++S+EGFA +LMD+DNF  K      N + +  PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR IELDCWDG+DG P+IYHGHT T KI F+ VVE IDRSAF TS  P+I+SIENHCSLPQQ+KMA+IF  VFGEKLV +
Sbjct:  518 ELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLLKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEMEEEDSASEGSGS-------RKNSLKDKARWQFI------IGDLLDSENDIFEKSK--ECDPHGSEESQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASP------------AGARPKLGVLS--------NMAEPGKFPSPGN-----------AGVSGLA-----EGILDLFSVKAVYMGHPGIDIHTVCVQNKLSSM----LLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKN----------AEKPNMQRNNTLGISTTKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNPLHSRRAYSLTTAGSPN------LATGMSSPISAWSSSSWHGRI--RGGMQGFQSFMVSD--SNMSFVEFVE---LFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNL-TIEENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAK 1493          

HSP 2 Score: 270.396 bits (690), Expect = 1.207e-71
Identity = 187/600 (31.17%), Postives = 300/600 (50.00%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFIS---MEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPS 10531
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+K+  ++ KF+P E++ + + P   ++ IISGQN+   N +GSP +E++++G+ +D    +T+PI RN +NP W+E F F++ F DL F+RFAV++ NS+ I  Q++ P++ LK+G+RH+ L++     N++ ++++L  FI+   ME++                                  P  +++       ++  K S            + H + + GV   E + +  I   + A  ++ Q L        +  +Y L++E   I         +   R +G +E+I  I+             NS  P        +L       +E+   FD      S S      V +++VSPEQP T++K    ST   VI   L KA+         +P D+VL+EE+   A N + S         T KSS+RIL   ECV+  Q +   +GK +L  K   E+V +    K+   +F S+  K     + + +S+ +PS
Sbjct: 1732 PKCYHISSLNENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLRALKRGYRHLQLRNLH---NEILEISSL--FINSRRMEEN----------------------------------PSGSSMPASLMFNTEERKCS------------QTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQIL-------------NSWFPEEGYVGRIVLKPQQETLEEKSIVFDDKEVILS-SEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNNPNPCDYVLLEEVLKDAANKKSS---------TPKSSQRILLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKRRGISFASELKK---LTKSTKQSRGLPS 2251          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcg1 (phospholipase C, gamma 1 [Source:MGI Symbol;Acc:MGI:97615])

HSP 1 Score: 191.43 bits (485), Expect = 7.021e-51
Identity = 110/238 (46.22%), Postives = 148/238 (62.18%), Query Frame = 2
Query: 7304 EKSEKRIIPLTEIQNILQQFQGE--SGDKEDCWKIIEKHEVDPELRA--QGMMSYEGFACYLMDQDN-FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQ 8002
            E+ E   + L+E Q  L ++QGE  + D+    + +     DP LR   +     +    +L  ++N      LD     +M++PLSHY+I+SSHNTYL+G Q + ESS+E YA+ L  GCRCIELDCWDG DG PVIYHGHT T KI F  V+ TI   AF  S YPVILSIE+HCS+ QQ+ MAQ F +V G+ L+T+            LPSPNQL+ +ILIK+KKL ++ SA++
Sbjct:  242 ERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDP-LREIEEPYFFLDELVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQHFRKVLGDTLLTK----PVDIAADGLPSPNQLRRKILIKHKKL-AEGSAYE 473          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 196.438 bits (498), Expect = 3.644e-50
Identity = 107/203 (52.71%), Postives = 136/203 (67.00%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIE +E D EL+ +G++S +GF  YLM  +N     LD     Q MDHPL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLL+GCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS  QQ KM++    +FG+ L+ + L    L+    LPSPN LK +ILIKNK+L
Sbjct:  264 DAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDEN-APVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRL 465          

HSP 2 Score: 141.739 bits (356), Expect = 5.038e-33
Identity = 84/242 (34.71%), Postives = 142/242 (58.68%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWS-ETFQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            + ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LNYQT D A+++N   F  + +CGY+LKP  M   +      F+P+ E   +G++    ++Q+ISGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++ E+F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  602 YNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRT----FDPFSETPVDGVIAATCSVQVISGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNN-KLIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTIFCNIVLK 833          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q99P84|PLCE1_RAT (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus OX=10116 GN=Plce1 PE=1 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 8.296e-126
Identity = 325/1060 (30.66%), Postives = 511/1060 (48.21%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS------VPQVDK---------------GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISM-FQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPH--------------------------CLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLF--NKSASKFSDSQNSSQVPISPPIRSRS----QEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRN-------YPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRI--IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DLSS      +P++                  + +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  Y+ VV RAL I    V+PF G+FL +L  +++    +L L    S+    +  V+D++G+D F+ R+G  GL N  K   V  +  I+   S   +  + ES+             +  S  D    +F       I D+++  N +  + +  + DPH                            Q +  G TV+  D+D       FL+L   NS + W KP                            A  + +   L   +    PG +      ++G+A  +G +      G +D+F++K +Y G+     +   +  +        L     ++++YG   ++N++++ V P   AK    GL +L  A + IR   DQ+  WL+  Y+  +      +  TLA   + FGGRRWS  N S  +S ++            K   + NN    S  ++   +    +S     D   + +  +    RSRS    QE      S  N I+  N P+ L     YS   A S    +   +S+       S     +K  +    ++           +   S ++FI+F  LF+SF I SR D+K IFD  S   + S ++++   +N+  I +   + + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  + + ++ + L   QGE    ++   II+K E +  +  QG++S+EGFA +LMD+DNF  K      N + +  PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR IELDCWDG+DG P+IYHGHT T KI F+ VVE IDRSAF TS  P+I+SIENHCSLPQQ+KMA+IF  VFGEKLV +
Sbjct:  518 ELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKACISESILMSQSGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLLKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNPEKELTVNSIFQIIRSCSRSLETEDEESASEGSGS-------RKNSLKDKTRWQFI------IGDLLDSDNDIFEKSK--ECDPHGSEESQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPT--------------------------ASPAGARLKLGVLSNVAEPGKF-----PSLGNAGVSGLV-----EGILDLFSVKAVYMGHPGIDIHTVCVQNKLSSM----LLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTTAVRKIRKFPDQRQQWLRKQYVSFYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKN----------AEKPNMQRNNTLGISTTKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQEANEQEDSEANVIT--NPPNPLHSRRAYSLTTAGSPNLATG--MSSPISAWSSSSWHGRIKGGMKGFQSF-----------MVSDSNMSFIEFVELFKSFSIRSRKDLKDIFDIYSVPCNRSASESTPLYTNL-TIEENTNDLQPDLDLLTRNVSDLGLFMKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPNISMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKDLQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAK 1493          

HSP 2 Score: 276.559 bits (706), Expect = 1.313e-72
Identity = 187/587 (31.86%), Postives = 295/587 (50.26%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV-FISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIE----KSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASK-ILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSK 10483
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+K+  ++ KF+P E++ + + P   ++ IISGQN+   N +GSP +E++++G+ +D    +T+PI RN +NP W+E F F++ F DL F+RFAV++ NS+ I  Q++ P+K LK+G+RH+ L++     N++ ++++LF+    MED+                                  P  +T        ++  K S            + H + + GV   E + +  I   + A  ++ Q L        + A+Y L++E   I         +   R +G +E+I  I+     +     R +LK                    ++   EE +  H      +SS  +   V +++VSPEQP T++K    ST   VI   L KA+         +P D+VL+EE+   APN + S         T KSS+RIL   ECV+  Q +   +GK +L  K   E+V +    K+   +F S+  K
Sbjct: 1731 PKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDAMDPATYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLKALKRGYRHLQLRNLH---NEILEISSLFINSRRMEDN----------------------------------PSGSTRPASLMFNTEERKCS------------QTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQILAVDQDTKLTAADYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGRIVLK-------------------PQQETLEEKNIVHDDREVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNNPNPCDYVLLEEVMKDAPNKKSS---------TPKSSQRILLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKRRGISFASELKK 2237          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q8K4S1|PLCE1_MOUSE (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus OX=10090 GN=Plce1 PE=1 SV=3)

HSP 1 Score: 441.039 bits (1133), Expect = 4.951e-123
Identity = 319/1058 (30.15%), Postives = 506/1058 (47.83%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS------VPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISM-FQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPH--------------------------CLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLF--NKSASKFSDSQNSSQVPISPPIRSR--SQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNS---SNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRI--IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DLSS      +P++   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  Y+ VV RAL I    V+PF G+FL +L  +++    +L L    S+    +  V+D++G+D F+ R+G  GL N  K   V  +  ++   S   +M   +S+             +  S  D    +F       I D+++  N +  + +  + DPH                            Q +  G TV+  D+D       FL+L   NS + W KP   +             +   P    L         ++ +  ++  PGN           A  +G        G +D+F++K +Y G+     +   +  +        L     ++++YG   ++N++++ V P   A+    GL +L  A + IR   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S  +S ++            K   + NN    S  ++   +    +S     D   + +  +    RSR  S  Q +          + N P+ L     YS   A S        L+        +  + S    I  R       +   ++  +  S++ F++   LF+SF I SR D+K IFD  S   + S ++++   +N+  I +   + + +   LTRN         S  +L+  QR ++ A+A ASIV N +G E +   I  + + ++ + L   QGE    ++   II+K E    +  QG++S+EGFA +LMD+DNF  K      N + +  PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR IELDCWDG+DG P+IYHGHT T KI F+ VVE IDRSAF TS  P+I+SIENHCSLPQQ+KMA+IF  VFGEKLV +
Sbjct:  518 ELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLLKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEMEEEDSASEGSGS-------RKNSLKDKARWQFI------IGDLLDSENDIFEKSK--ECDPHGSEESQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASP------------AGARPKLGVLS--------NMAEPGKFPSPGN-----------AGVSGLA-----EGILDLFSVKAVYMGHPGIDIHTVCVQNKLSSM----LLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKN----------AEKPNMQRNNTLGISTTKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNPLHSRRAYSLTTAGSPN------LATGMSSPISAWSSSSWHGRI--RGGMQGFQSFMVSD--SNMSFVEFVE---LFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNL-TIEENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAK 1493          

HSP 2 Score: 270.396 bits (690), Expect = 8.445e-71
Identity = 187/600 (31.17%), Postives = 300/600 (50.00%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFIS---MEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEI--SAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPS 10531
            P  + I+S+NE+ AK +CRR    LI H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+K+  ++ KF+P E++ + + P   ++ IISGQN+   N +GSP +E++++G+ +D    +T+PI RN +NP W+E F F++ F DL F+RFAV++ NS+ I  Q++ P++ LK+G+RH+ L++     N++ ++++L  FI+   ME++                                  P  +++       ++  K S            + H + + GV   E + +  I   + A  ++ Q L        +  +Y L++E   I         +   R +G +E+I  I+             NS  P        +L       +E+   FD      S S      V +++VSPEQP T++K    ST   VI   L KA+         +P D+VL+EE+   A N + S         T KSS+RIL   ECV+  Q +   +GK +L  K   E+V +    K+   +F S+  K     + + +S+ +PS
Sbjct: 1732 PKCYHISSLNENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLRALKRGYRHLQLRNLH---NEILEISSL--FINSRRMEEN----------------------------------PSGSSMPASLMFNTEERKCS------------QTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQIL-------------NSWFPEEGYVGRIVLKPQQETLEEKSIVFDDKEVILS-SEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNNPNPCDYVLLEEVLKDAANKKSS---------TPKSSQRILLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKRRGISFASELKK---LTKSTKQSRGLPS 2251          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|G5EFI8|PLCE1_CAEEL (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Caenorhabditis elegans OX=6239 GN=plc-1 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.783e-66
Identity = 199/596 (33.39%), Postives = 298/596 (50.00%), Query Frame = 2
Query: 6227 NISSIMRRFGYKE-NYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKA--FGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK-SRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYL-----------------------RHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIF-DHLSTKIS-------ESDTKNSSNIGKIFQKDFNYENEQF----YLTRNYPSTTK-LTSKQRHVTAAVAVASIVNNCSGF-EKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF--LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            +I +I RR   +E + P+    C  + +G   S+N+ I  + P   A++W  GL  +V + +  +   D++MLW+KN YL L+            EIT     G R +    + G+    + +T    S+ +S+    K+  K+ K+  Q+     ++  S+    Q     P SP +R  S +  ++S S   G    N+P YL                       R  T  SY   +   R      S   +    +P + S+  S    +    L   +  E   Q+  L  ++F  LFR F    R D++ +F D LST  +       E D ++S  +        N  N  F    +LTRN   T+  ++ KQ  +  A+A+AS VN+  G  + S   ++    ++  +   Q E  D++   K+I+ HE D   R +  MS+EGF  +L D  NF  +  T++  +++ + +PLSHY+I SSHNTYL+GHQ+ G SS EMY QVLL+GCRC+ELDCWDG+DG P+IYHGHT  +KI F+ VVE I +SAF TS  PVILSIENHCSL QQ KMAQ+F  V G+ LV+
Sbjct:  466 DIEAIYRRHSMEEMSVPV---SCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVYLSLY------------EITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQKKLRGASREGSRSQSPQ-----PHSPLVRPPSIKSQISSQSGPPGP---NSPGYLLKPRGEPANSDAGDIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGE----TPNSGSISSSGQMSIQVSGLSGPSGKE--FQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERD-RHSPRMQSRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALAS-VNSMGGLMDTSRSSMLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIE-PDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLLVS 1029          

HSP 2 Score: 233.802 bits (595), Expect = 1.067e-59
Identity = 139/350 (39.71%), Postives = 203/350 (58.00%), Query Frame = 2
Query: 4916 VYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKG--VWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKE---PTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQP-RLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTK 5944
            ++  ELE L  ++ FPEEVA  L+ TE +LF ++QP  YVRYVS DL+SVP  +    V NL+ RL EVSSWITH+I++QPTH++RK   + I+R+V   + IGNFNA VE+L GLKSEKL+PFWL++    + E S  D L E LL      P+++Y + V RAL++  + VIPFFG+FL  L  IVN  P I+++    +   +  +SD NGED F SRIGVGGL+N +K+  V  +L+++ +F  H+    K+ +       P      N+   +E    +  P+  +   S+ V + P      D   +Q +  GTTV+  + D  +     L+L  +   I W K
Sbjct:   52 LFRLELERLQYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEVSSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR---QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLPNIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRTMIKLLEEQA---VPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHK 395          

HSP 3 Score: 217.624 bits (553), Expect = 9.420e-55
Identity = 130/367 (35.42%), Postives = 196/367 (53.41%), Query Frame = 2
Query: 8420 ALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNST-HIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            A+++    K N   QI P LS++V+Y QA K +             P    I+ P + +   +  +LS   S   + S+ LN  +      +   LS             +  + G  R  +A    +Q+ S+NE+ AK + +R P   + +    L+RTYP+    DSSNFNP+  WA G+QMVALN+QT D  + VN AMF QS NCGY LKP  +W+++H+L+NKF P  K+  G     L + IISGQ++       S  +E+E+IGI  DC++ K++ +QRN +NP W+ T Q +IA  DLAF+R AV D      ++  +V PVK ++ GFRH+PL++     N   D A +F+    E +
Sbjct: 1191 AIRNQQPRKNNTGVQIAPELSDIVIYMQATKFKGF-----------PPVDGIQSPRIMEEGPASASLS-FSSRARTPSNLLNTPAPPRRQRSSTQLSQ----------ELAAEFLGSVRA-NATATCYQVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCIRPGFRHLPLRT---PTNLPIDNAMIFLRTRFEQE 1531          

HSP 4 Score: 90.8929 bits (224), Expect = 2.282e-16
Identity = 69/223 (30.94%), Postives = 108/223 (48.43%), Query Frame = 2
Query: 9710 KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--PSTIEEIP---RLIGLQENI-ESIIEKSNSTSRFILKRNSSDPSSRAWMTTI----------------LNEDSRRRKEEEYSFDHPS---DSF---------------SMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKD-DPNDFVLVEE 10255
            K+++  + ++G   +E    +   S ST   V+ QAL  +G+  D +  YVL++E  P+   E P   R++ L E I +++   + S  RF+L++  SDPSSRAW+T+I                L +D   +          S   D+F               + S     LVC++NVS +QPY IL+  I+ST   +I     KARR + D ++FVLVEE
Sbjct: 1568 KKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLIEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSGTSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGKWLNPRARSMGDTFLVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEE 1790          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q9P212|PLCE1_HUMAN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens OX=9606 GN=PLCE1 PE=1 SV=3)

HSP 1 Score: 243.432 bits (620), Expect = 1.628e-62
Identity = 133/351 (37.89%), Postives = 207/351 (58.97%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVK---LRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            ++ QI P LS+LV+Y QAVK   L +LN   S +  ++  + +I           G N   +    T++ +  + KS           S  GI  T   SS   +           P  + I+S+NE+ AK +CRR    L  H   QL+RTYPA  R+DSSN NP++FW  GIQ+VALNYQT+D  L +N AMF  +  CGYVLKP V+W+KN  ++ KF+P E++ + + P   ++ I+SGQN+   N  GSP +E++++G+ +D    +T+PI RN +NP W+E F F + F DL F+RFAV++ NS+ +  Q++ P+K LK+G+RH+ L++     N++ ++++LF+
Sbjct: 1657 ESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSI----------FGNNPGRMSPGETASFNKTSGKS-----------SCEGIRQTWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLH---NEVLEISSLFI 1983          

HSP 2 Score: 197.978 bits (502), Expect = 9.110e-49
Identity = 148/585 (25.30%), Postives = 259/585 (44.27%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDL------SSVPQVDKGV---------------WNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQ--MHNSEXXXXXXXXXXMDYPMKNKS-----------TNDPFFEEFFKPSCRPIVDMINI--SNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSS 6559
            + EL +L  LIQFPEEVA +L + E  +++ + P  Y+ +++ DL      SS+P +   +                +L+ R  EVSSW+T LI+T  + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +    ++++  +  L + +   E +  YR VV RAL I    V+PF G+FL +L  +++    ++ L    ++    +  V+D++G+D F+ R+G  GL N  K   V +I   I      +   E     + +      +K+KS           +++  FE+  +       D          +I   +  +     Q +  G TV+  D+D       FL+L   NS + W KPT  +                           SK+   ++  T    PG +    +  + S  +          G +D+F +K +Y G+     +   +  + G            ++++YG   ++N++++ V P   AK    GL +L  A + +R   DQ+  WL+  Y+ L+      +  TLA   + FGGRRWS  N S
Sbjct:  519 SKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD---QSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS------------------------PASSKAKLGVLNNT--AEPGKFPLLGNAGLSSLTE----------GVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSM----FLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPS 1060          

HSP 3 Score: 58.9214 bits (141), Expect = 1.160e-6
Identity = 81/323 (25.08%), Postives = 132/323 (40.87%), Query Frame = 2
Query: 9716 KVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTI---------EEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKEL--------EEEQSTSGLTPPQISDNPRYR 10615
            + H + + GV   E +T+  I   + A  ++ Q L     +     +Y L++E   I         +   R IG +E I  I+              SS      +M  I+ +  +   EE+       +    S      V +++VSPEQP T++K    ST   VI   L KA+         +P+D+VL+EE+      +          T KSS+R+L   ECV+  Q +   +GK +L  K   E+V +    KK   +F S+  K       +  +K+   +TS  +L        +EE+   GL+    SD   YR
Sbjct: 2012 QTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQIL--------------SSWFPEEGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKK-------TTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLK---EQVQASREDKKKGISFASELKK------LTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSS---SDTMDYR 2301          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q15147|PLCB4_HUMAN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 1.300e-48
Identity = 106/203 (52.22%), Postives = 136/203 (67.00%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIE +E D +L+ +G++S +GF  YLM  +N     LD     Q MDHPL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLL+GCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS  QQ KM++    +FG+ L+ + L    L+    LPSPN LK +ILIKNK+L
Sbjct:  264 DAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDEN-APVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRL 465          

HSP 2 Score: 143.665 bits (361), Expect = 1.889e-32
Identity = 84/242 (34.71%), Postives = 142/242 (58.68%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWS-ETFQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            + ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LNYQT D A+++N   F  + +CGY+LKP  M   +      F+P+ E   +G++    ++Q+ISGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++ E+F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  590 YNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRT----FDPFSETPVDGVIAATCSVQVISGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK-LIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTIFCNIVLK 821          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A087TCF5 (Phosphoinositide phospholipase C (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_11806 PE=4 SV=1)

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 779/2260 (34.47%), Postives = 1174/2260 (51.95%), Query Frame = 2
Query: 3710 SMSIQRPTSPNFSLGNESSIPESNFCYATKPCQ--VARNSGDIPNLQFSAMQLIDTWLHMSLIDFSL-IRDDIKEFLTRLSTQGTDQRLWCQNIWSFLKSRISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWP----ETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLS--RNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVL-DCDGSKSAKPAFRRSSLEFDLQN---KQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTN----DPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQL-ANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFY---LTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN--FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL-TSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMXXXXXXXXXXXXNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQIXXXXXXXXXXXXXXXXXXNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKS-SPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQE--------PSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASK-ILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASG 10387
            S S+ R T  + SL   S+  E  +C    P    ++R   +IP  + +A QL+  W  +   D  L +  + +EFL  L   G   R W   I +     I  ++ ++ + Q   E+   +Y++L++LV SGDLPC+K++AA LA + + I+ +WP    ETD     ++  +  D+ +S +    +    R+T +   S+    + +  S   +K++          L   + P Y  +K   + IKE+ +KL+H+  YE+E+ LK+LY++ CK LPAYGCR++QV+E       + V R+LG+    + L+D KS +L +SQ   D + W     R+     LEFRA+K W    TS  ++RS+++ LWEV+ D D            + + D+ N   K ++ R  +E   VY  ELE L  L+ FPE VAL+L + E  LF  + P  YVR ++L+LS     D  V  LI R +EVSSWITH+II+QPTHE+RK + SCI+R+    + + NFN  +EILAGLKSEKLKPFWL++ +  ++ ++ +++LS  LL+   +  YR+ +++AL      VIPFFG FL +LK I+   P++++L + +   +  +SD++GED F +RIGVGGLIN+ K+++   IL +I  F  H     + +  D   +   KN  +N    D    E    S  P V +  IS+               LQ +H G+TV+  D D  +   VFLKL   N  + W KP             S       P ++        S F L    +Y      YC+                  + GF+D+  +K++   N      +++ + RR G  +     D  C+ I+YG + S+N+ +  V PTI  + W  G+  +V   K  +   D ++ WLK  Y+ L++        T AE  K FGGR+W++ +  G  S    S     ++F   S  K   K  ++    I +   KS S  +         +SP ++S+     L+   S +     + PS +      S  +++S  ++     + D   L   P+                         IT  S ++F+ F  LFRSF++ SR D++ +F+ ++  +       + N  +       Y + + +   LTRN PS    + +++ +  A+A ASIV+NC+G + S   ++ L + Q  L   QGE   +E+   +I++HE D ELR +  +S+EGFA YLMD+ N  FL  T  N  + +MDHPLSHY+IASSHNTYL+GHQ+ GESSVE+Y+QVLL+GCRC+ELDCWDG+DG PVIYHGHT T KI F+SVV+ I++SAF TS YPVILSIENHC L QQQKMAQIF+ VFG++LV+R+LF+SD  D+P LPSPNQL+YR+LIKNKK+  S   A  TK + ++    +  +++ +   S    N ++++ E  D+D++   ++  N   +E D R      +K                                    SV+L  +   L  QD  + + +   +I  +       L +  +     +SQI P LS+LVVY QA+K R     S SP  + K KK + +R      HL+ +  +++  +                 L+ +S                   P   R   ++ P ++++SVNE+ AK +C+R P  L+ HCE QL+RTYPAG+R+DSSNFNPVIFWAFGIQMVALNYQT+D AL +N AMF QS +CGYVLKP VMW+K H+++ +FNPWEK F+G     LTI +ISGQ +     +GSP++E+EIIGI +DC + KT+ +QRN +NP W+E F F+I F +LAFIRFAV D+ S+H+  ++V P+  LK+G+RH+ L+SQ    NQ   ++TLF+    E++   V      S+      +           D P         K  LG+ P              K ++ ++ + GV   E  TILKI    T  DVI QAL KS    DS+ +YVL++E         S      R + + E       +     RF+LK+ + DPS+RAW+TTI    ++    E+ S D        +   +  LVCIYNV+P+QPY ILK  I ST   ++  AL KARR +DP+ F LVEE+  P   ES       K   +  +R L+  E V+L Q++    G
Sbjct:  180 SCSVPRVTLDSSSL-TRSATTEGTYCPVDFPLPDLMSRVRTEIPLEEKAAFQLLLEWGKVCPQDLLLDVGSEFEEFLAALCPLGDQYRKWASEIRNVYG--IQEDETNEEEKQA--EAIRRDYEKLQRLVVSGDLPCSKEEAALLAGIQLRIEETWPSASKETDK--RIKLRPISEDTKESAA----ESPDERMTFNTAVSKSTAIIRNWMSSNDNKDDSA--------LDDCVAPMYRTAKNMSKAIKEQKRKLFHSLVYENELHLKKLYIQNCKRLPAYGCRVYQVKE----RTKKKVNRLLGIGLEKLVLLDSKSLLLNKSQLTSDLEQWRTGGGRSHDQIVLEFRATK-WSFIATSPGALRSISTELWEVMQDLDAHFLEDHVI---ATKEDIDNEIRKSLSERQGLERYTVYKQELESLQTLLHFPEVVALLLTEVEYDLFYKVAPIHYVRQITLNLSHDHGGDNTVKRLIKRFQEVSSWITHIIISQPTHEDRKAVLSCILRIATTCWNLANFNTAMEILAGLKSEKLKPFWLSLPE--KDHITALEMLSNALLTPHVSPEYRAAIDKALSSPYVRVIPFFGTFLRELKSILKSIPSLVVLSTEENPKLEFISDYHGEDHFFTRIGVGGLINLEKIRKTHEILEEIETF--HEHAKVRNELKDSKKEDTTKNGRSNGGEEDESLYEVRSNSKDPFVSLFPISSKCETFQE--------LQFLHHGSTVIHIDDDGSRSALVFLKLERNNGTLTWAKPP-----------WSALKGNGAPDYNLTVYDPISSGFLL----KYETSDICYCST-----------------EEGFLDLSNVKEVSMLNCDICDVSVNHLARRQGIPD---FMDKSCLRILYGNTLSDNRTLEFVAPTIAIRLWHKGIQYVVGELKKQKILSDHRIFWLKEKYVHLYFENLACAGPTPAEAIKIFGGRKWTLDSLGGSSSSMDTSGFKRVASFGVNS-GKLRKKKSQTSLAAIRDCSPKSQSSLASETLGECSRMSPSLKSK-----LSHLKSRDTSDDSDVPSQI----IPSITLSSSYSKEKGH--TGDSPPLACGPV-------------------------ITHSSQMDFVQFTELFRSFLVRSRKDLRCLFEQVA--VPYKGLPENYNFDRSTSSKEPYGSSKKFLGLLTRNTPSDYVDSIQRKRIYDAIAAASIVSNCAGVDTSRTLVLRLEDFQRFLSDHQGEPKTEEEVAALIQRHEPDAELRNKCCLSFEGFARYLMDKCNYAFLPETF-NPGEGAMDHPLSHYYIASSHNTYLTGHQLKGESSVELYSQVLLTGCRCVELDCWDGDDGMPVIYHGHTLTTKIPFKSVVDAINKSAFVTSPYPVILSIENHCCLQQQQKMAQIFTNVFGDRLVSRFLFESDYGDEPQLPSPNQLRYRVLIKNKKMRVSITPALPTKSRGKLNSGRTNSIISTASTGS---FNDEEEDGEGSDDDEDDEYILDENFQHVEQDDRHSSGTVSK------------------------------------SVSLTARTESLSSQDESYREKSVISAIPGVPIEH--ELPNEDEKAKKSSSQIAPELSDLVVYCQAIKFRGFVQGSNSPTNSVKVKKISSRRN-----HLASSGATSLPGTPP---------------LSYES----------------KGEPSFWRRAASSAPCYKVSSVNETTAKKLCKRHPLALMSHCESQLMRTYPAGMRIDSSNFNPVIFWAFGIQMVALNYQTDDSALHLNTAMFEQSGSCGYVLKPRVMWDKTHMMYGRFNPWEKTFDGFHAINLTITVISGQYVCPSTFTGSPVVEIEIIGIPIDCNRQKTKLVQRNSLNPIWNEIFNFRITFSELAFIRFAVTDMGSSHVTSERVIPLTHLKQGYRHVRLRSQ---QNQPLPLSTLFIHSVWEEEGLEVAEASGDSAAGFMKGAGK---------DYP---------KSELGTIP-------------VKRRMFFLVVHGVLPEEPSTILKITQECTTRDVIAQALSKSNS-SDSVDDYVLIEEVQQGWDKKASEKNLHRRFLDINERPLEAQAQWRGDGRFVLKKLADDPSTRAWITTIRGTINK----EKRSKDMGGGLCGWTDGEEAFLVCIYNVAPDQPYAILKAPITSTSQDIVQQALLKARRMEDPSKFGLVEELEYPPLAESTAS---SKKRLQRQRRFLQDHENVFLAQQRWKGRG 2206          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A210QRR5 (Phosphoinositide phospholipase C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16890 PE=4 SV=1)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 576/1524 (37.80%), Postives = 839/1524 (55.05%), Query Frame = 2
Query: 3674 SNMPPIKKSEFDSMSIQRPTSPNFSLGNESSIPESNFCYATKPCQVARNSGDIPNLQFSAMQLIDTWLHMSLIDF---SLIRDDIKEFLTRLSTQGTDQRLWCQNIWSFLKSRISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPD-----SNKSLSY------------------LTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHL--SRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDK---GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFE-------EFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISP--PIRSRSQEQILTSSSSHNGISMI--NTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVK-----DSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKN------------SSNIGKIFQKDF-NYENEQFYLTRNYP-STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLK-GTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDS 8059
            +N      S F + S     SP  + G  +S P S  C +        +  +IP      +++I+TW+ +   D    SLI  ++++FL ++S  G + + WCQ I   L          +    +  ++ N +YK+L+QLV +GD+PC+K++AATLA++ +HI+ +WPE +    N  N+  PD       K + +                  L +     R+TSSR + R    ++ Q SCVS K+ +         L K++PP+++ SKK   +I+EK K+LWHTP+Y+SEIKLKQ Y+K+CKNLP++GC+L+QV+E+LRGN  +  +R+LG++   I L+D K+K+L+++Q+++D + W+    +      LEFR +KPW L+  +  +++S+T+ LW+ LD DG        RR S EFD   K   LRP +E G  Y+ ELE L  L+ FPEEVA++L   E  LF  + P  Y+R V+ DLS    V +    V +LI R  EVSSW+T LIITQPTHE+RK I SCI+RL    + +GNFN  +EI+AGLKSEKLKPFWL++   C  +LS + +LS  LLS+E T+ YR  V R L I    V+PFFG FL +L+ +    P+I++LPS +   +  +SDFNGED+F++RIGVGGLINM+K+++  TILNDIS+F  H        + ++++    +         E       +    S +P+  ++N   VVVI  +LA +  H LQ MH G+TV+  + D  +    +LKL L N+ + W KP+  +             +T  P +      DS S   L    RYT   + Y T                  + GF+D+  +K+I +GN   L +++ + +R    +     +  C  I+YG    ENK +  V P    K WL+GL +L+ AA  +R   D+++  LKN YL+L+Y  +     + AE  K FGGRRW V        D   S     S  TSK                IFN   KS++ FS+S+ SS        P  S S  Q ++S   H   S +  N  S L  S+    +  N ++ Q+T+  +     L   P +++        S  +R++       N    IT  S L F+DF  LF+SF +  R D+K +++ L+  +  +  K+            S++  K  Q    N  N    +TRN     TK + ++R +  A+AVASIV NC+G + S+ R I L E +  L   Q E  D E+   +I++HE D  LR    +S+EGFA YLMD+DN+         ND+ MDHPLSHY+IASSHNTYL+GHQ+TGESSV +Y+QVLL GCRC+ELDCWDG+DG P+IYHGHT T KI F++VVE I++SAF  S YPVI+SIENHCS+ QQQKMA IF  VFGEKLVT +LF+SD  +DP LPSP QLK++IL+K KK+  ++S    KV S    NS +   + S
Sbjct: 1515 ANQVATSSSNFLNPSPTSAVSPTVTTGPTTS-PWSPSCMSQSSITANVSHSEIPGDHRGVLRVIETWIRVCSNDLDCSSLIVHEMRDFLRKMSVLGHEYKAWCQKIGGLLHLEEKNVMKQRSQNADDPDNVNAQYKKLQQLVVAGDIPCSKEEAATLASIQLHIEEAWPEHNV--PNHANTNPPDLTFLQGGKLIDHKLWAKSTDPQENLRKRKELIRNNRAGRITSSRRKGR----LVRQLSCVSSKDLDIGSEVD---LTKFLPPDFNSSKKIRCIIQEKQKQLWHTPYYDSEIKLKQQYIKICKNLPSFGCKLYQVKELLRGNTQKKAVRLLGIATDKIVLLDNKTKLLLKTQSIRDLEEWNTGSGKYHDGLVLEFRGTKPWHLSMATLDNLKSVTAVLWDSLDMDGRFLNNGTLRRDSFEFDFHRKPPLLRPALEGGSKYSEELENLQRLLHFPEEVAILLTDMEHSLFNEIPPSHYIRQVTTDLSRGSTVYRKLSSVEDLIQRFNEVSSWVTQLIITQPTHEDRKAILSCILRLAFYCWCLGNFNTTMEIVAGLKSEKLKPFWLSL---CDEDLSTLHMLSNFLLSRELTQEYREAVGRGLDIPTCKVVPFFGGFLRELRALFINVPSIIVLPSKENQSLEFISDFNGEDRFMTRIGVGGLINMDKLQQTHTILNDISLFHHHGKGQETAQREEEEVKSKEEFVVEEVENEENDCESDYDLDLDSYQPVQPIMNDHEVVVITSKLAGLSHHWLQCMHHGSTVIHIEDDSCRTYVCYLKLELDNTTLTWRKPSWSS---------LMPGNTSYPDYMLKGESDSSSTQAL--SIRYTGGEDVYDT-----------------LEEGFVDLKLVKEISHGNEESL-DLNLVGKRHSMDDLEAKVNSIC--ILYGSGHLENKRLWFVAPKNVCKIWLLGLQRLIKAAHKLRRQTDKRIQLLKNQYLQLYYDNEKCVGPSPAEAIKVFGGRRWHVERQLMGTQDVPTSFKRTGSFVTSK----------------IFN--KKSSTGFSNSKESSPRGSGSIVPNMSSSDLQKMSSQKGHRTPSPLRKNKLSDLSKSSVPCSSDPNLHQNQTTQKPNGS-PRLGFRPRSMTFSFTNRYRSKRRRMSLGMRSTDNKMTPITDSSQLTFLDFVDLFKSFSLRCRRDLKDLYEQLALTMKPTPGKDIPTALRTHCNSASTDTCKQIQASLNNVLNISGIITRNNALDLTKDSQQRRKICDAIAVASIVANCAGVDTSQNRCIGLKEFREFLGDHQEEYLDDEEIIDLIQRHEPDRFLRETCCLSFEGFARYLMDKDNYAYLHEKTKHNDEDMDHPLSHYYIASSHNTYLTGHQLTGESSVGLYSQVLLMGCRCVELDCWDGDDGMPIIYHGHTLTTKIPFKAVVEAINKSAFVMSPYPVIMSIENHCSIIQQQKMALIFQSVFGEKLVTTFLFESDFCEDPQLPSPCQLKFKILVKYKKIRYQESYTLRKVPSCPRTNSMVSTESTS 2975          

HSP 2 Score: 389.808 bits (1000), Expect = 2.875e-104
Identity = 255/701 (36.38%), Postives = 384/701 (54.78%), Query Frame = 2
Query: 8354 DWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDI-PTPKTATLRRKYPLGSKPWKGSDNRDTIARKP-----KEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIP---RLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKI-LVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPN--DFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVE 10420
            DWQF+D                 +K+  K K  KASQI   LS+LV+Y QA+K R L +  SP T+ +      ++P   +V L G+N             G    +   T +N+ S                  Y  QRR  D+ PP + ++S+NESKAK  CRR P          L+RTYPAG+R+DSSNFNPVIFWAFGIQMVALNYQTED A+ +N AMF Q+   GYVLKPA MW+K+H+++N FNPW+K F+G+    LTI +ISGQ ++  N + S  +E+E++GI +D  K KT+ + RN +NP W++ F F + F DLAF+RF V+D N++H++ Q++ P+K L+ G+RH+ L+S     NQ  ++AT+F+    E++                        L  S+ DI     +A+ +R+        K  +++D     P     K ++ +I + GV   + Y ILK+   +T YD I QAL K+GR ++ + +YVL++E  +  E     R++ + E +     +     +F+L++ S DPSSRAWMTT+L+ + RR+ EE       +D+    S  ++ LVC+YNV+P+QPYTI K   +S+   +++ A+ KA R D  N    +LVEE+      ES G  +R+   +   +RIL   E VY  Q +   +GK ++M +   E
Sbjct: 3056 DWQFED-------------DIQEMKTPPKTKQKKASQIAKELSDLVIYLQAIKFRGLTV--SPNTSMR------RKPAGKKV-LLGSN------------PGTPPLTSDKTDMNMFS-----------------GYSRQRRP-DSTPPCYLVSSLNESKAKQHCRRNPI--------GLMRTYPAGMRIDSSNFNPVIFWAFGIQMVALNYQTEDTAMILNTAMFEQNGQSGYVLKPATMWDKSHMMYNHFNPWDKTFDGLHATVLTIHVISGQYVS-NNHTASTYIEVELLGIPVDSAKHKTKVVPRNALNPIWNDYFTFHVMFADLAFLRFVVVDANTSHMVSQRIIPLKCLRAGYRHVRLRS---PTNQPLELATVFINSKHEEE----------------------SLLTCSTHDINGCHDSASAKRRLVFAKN--KDINDKDAKELSPTGARVKRRMFFISVFGVNAPDKYVILKVTQDTTVYDTIAQALMKAGRAEEKVTDYVLVEEVQSGWERSMSQRILDMMEKVLIAQNQWKGAGKFLLRKLSDDPSSRAWMTTMLSIEHRRKVEES------ADTADWDSVEQVFLVCVYNVAPDQPYTIFKAPTSSSAQDIVTQAMMKAHRTDTDNLRKLLLVEELEMTG-TESLGVHTRRHSGEHLERRILAPDENVYHAQSEWITNGKFVIMDQAEYE 3661          

HSP 3 Score: 229.18 bits (583), Expect = 1.314e-55
Identity = 147/323 (45.51%), Postives = 190/323 (58.82%), Query Frame = 2
Query: 1565 IERINQADPGIILSVLHNRITMQKRTLGYRVKCSPSTRMRSCVSHCIQILSARMLTVMAQSSRVQRRLFTDGHFKTLVDAXXXXXXXXXXXXXXXXXATIALDPTYHKALLLTMIEDNLLHLILPSDEWYYTNYSTKYSPYVKYHASRILVYLGKFHCLAGRFDLFNSSVFDFMHGAGNFLTDNLEDVFIHNMAMGKHMIHRGDMALIGCSVESLIRMLL--------EDHGSTVDYIQVPEQFTKLFSFLGSDEVHFKCILTD-----------------RLREALIMVLPAIIHPLIIIRLLNHRLFGRSYKKKIRHLSTK 2458
            +E +   DP  ILSVLHN ITM KR +G R KC+PSTR R C  HC+QILSAR+L VM    +VQ R+   GH KTLV+ALDPNHDPHLLCLLLQ LA+IAL P++H+ L    I D L+ L+LPSDEWYYTN+STKY+ +VKYHA+RILVY+G  H L GR DLF+   F  +         + ED FI  MAMG+ ++   +  L   S+E L+  L+        E  G T D        + + S  G  + H   +LT                    RE L+M LP ++HP+II+RLL H++FG   ++K     TK
Sbjct:  817 LEFLTTCDPSQILSVLHNSITMHKRIIGTRQKCTPSTRSRFCTHHCLQILSARILVVMCHGLQVQYRIVGGGHIKTLVEALDPNHDPHLLCLLLQSLASIALTPSHHQVLNDADIADMLMQLLLPSDEWYYTNHSTKYAKFVKYHAARILVYMGLLHKLGGRVDLFDRKPFKELSTNAYLQVHSPEDSFIELMAMGQVVMWNDNQHLQAASLEGLVAKLIQEAMNDENEGTGKTYDLTLS----SSIQSICGLMDNHCSTMLTPFTSPACSLQFLAETDSKPFRELLLMGLPMLVHPVIILRLLAHKVFGNMIRRKSLFAETK 1135          

HSP 4 Score: 72.7886 bits (177), Expect = 2.534e-8
Identity = 36/115 (31.30%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  839 DLSFRMRYEDAESSLKTMIVLAKNPECLTQIIDGIDGFISMVISISQQANEEELESLISQLFNQIIKTISGKLR--DCPNNSSQAYVYMLQMTQLLDTSMDLLRQKQYIHYTALT 1177
            D S +   E+ E +L  +  LA+NPEC + ++DG+  ++ ++++++  +    +E  IS+L NQI++T   +L+  DC     + +   L +T+L+ T+++LLR  Q +H+TAL+
Sbjct:  572 DQSEKATLEETERTLYALKKLAQNPECTSSLVDGLANYMRIIVTVTDSSECPAIEKAISELLNQILQTCYDELQRIDC---FEEKFKIFLLLTKLMTTALELLRGGQSLHFTALS 683          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A2C9KBQ6 (Phosphoinositide phospholipase C OS=Biomphalaria glabrata OX=6526 GN=106080104 PE=4 SV=1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 524/1360 (38.53%), Postives = 768/1360 (56.47%), Query Frame = 2
Query: 4046 YESTNI--EYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAG---------PSNQMNSLFPDSNK---------------SLSYLTKKMAHSRLTSSRMRSRKPFR---------MMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFE---LEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS--VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKP------------SCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHE----LHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRH-VTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKY 7951
            Y++ NI     +L+QL+ +GDLPC+K++AATLA + +HI+ +WPETD           P++Q N+    +N                 L+  T+K+ + +     +RSR+  R         +     C SD E   ++      L++Y+PP Y  SKK  ELI++K KKLWHTP+YE+E+KLKQLY+K+CKNLP+YGC+LFQV+EILRGN  + V R+L +S   I L+D K+ +  + Q ++D  +W LS    A +   LEFR +K W L   S   ++S+T+++WE LD DG      A +R S EFD Q KQ+T RP++E    Y  ELE L  ++ FPEEVA+ML  TE KLF ++ PQ YVR+V+++LS   + +    V  LI R  EVSSWIT LI+TQ TH++RK + SCI+RL +  + +GNFN+ VEIL GL+SEKLKPFWL+I D    +LS +  LS+ +L+++ +  Y+  +NRAL I    V+PFFG FL +LK I    P+I++LPS +   +  VSD+NGED+F++RIGVGGLIN++K+++   +L DI +FQ H +++S I   +       ++ + +    E    P            S +P+  +    +V+V+ PRL +VD   LQI++ GTT+++ D+D  +     L+L   N+ + W +P                       +S L    S   F +    R+    +  C      G  +   +  +  + GF+D+  IK++Y G+  +  +++ I +R G + +   P   CI+I++G   S N     + P      W  GL +L AAA  +R  +D+++LWLK  YL+L+Y  +  Q  T AE  K FGGR WS    +  +++Q  S    A+                       NLF K     S S  +  V       +         S S++G S   TPS LR     S    + N   +   ++     L   P +L+   +   R           + + +  IT  + L+F+DF  LF+SF +  R D+K++FD +S+       +  ++     Q   N  +    +TR  P   KL S+QRH +  A+AV+SI++NC+G + S    +  +EI + L  FQ E  + E+  +++   E DP +R++  MS+EGFA  LMD++N+      +++ D+ MDHPL HY+IASSHNTYL+GHQ+ GESSVE+Y+QVLL GCRC+ELDCWDGEDG P+IYHGHT T KISF+ VVE I+RSAF TS YP+ILSIENHCSLPQQQKMAQIF  VFG+KLVT +LFDSD  DDP LPSPNQLKY
Sbjct:    4 YQADNIYTMTSKLQQLIVNGDLPCSKEEAATLAGIQLHIEEAWPETDEEEEEDLGAETPNHQNNNCGSPTNGLAGGDDGTAEQTRCFRLNTETEKLENLKHKKELIRSRRAHRITSTRRSTKLARSLLCTSDNEGRPREELD---LSRYLPPHYTTSKKVRELIEDKQKKLWHTPYYENEVKLKQLYIKICKNLPSYGCKLFQVKEILRGNTQKKVARLLAISNEKIMLLDTKTHLPAKMQQLKDMDDW-LSGTGKAHDSLVLEFRGTKAWTLAMPSVECLKSVTAAIWEALDMDGRFLNNGALQRESFEFDYQRKQLTPRPELEPVSQYTEELERLRKMLHFPEEVAMMLTSTEHKLFCSVPPQHYVRHVTMELSRPLLQKTQMSVEQLIQRFNEVSSWITQLIVTQATHDDRKAVLSCILRLAVYCWVLGNFNSAVEILCGLRSEKLKPFWLSIED---EDLSTLHSLSDMILTRDLSPEYKESINRALDIPECKVVPFFGSFLRELKSIFVGVPSIIVLPSEENHSLEFVSDYNGEDRFMTRIGVGGLINLDKLRQAHLVLGDIHLFQYHGNKASGITSSN-------QDDAVSSSSLEARPTPDDSDSDYDLDLDSYQPVKPLTCEHDVMVLTPRLLQVDLQTLQILNHGTTMIQWDEDAGRSSMCVLRLEADNATVTWCRPG----------------------WSALRGVTSPPDF-IFHSDRFHSSLHVLC---ARYGGGSDDNFNSL--EEGFLDVMNIKEVYLGD--ESVDLAGICKRHGLETSESEPK--CITIVHGNCMSANHKQCFIGPKGVTGAWYQGLCRLKAAAGKLRQQMDKRILWLKQQYLQLYYEGEKCQGPTPAEAIKVFGGRSWSSGLPTSAINEQGGSFRRSANFAVGPP-----------------NLFKKGKGTGSVSSKTDAVKGGGQTHAALASD---GSKSYSGKSK-RTPSPLR--KVRSEMNKSHNSDPTLNQIARGSPTLGFRPRSLTFSFTSRYRSRRRRMSLGCRSGDKSSSITHSTQLSFLDFVDLFKSFGLRCRKDLKELFDQVSSSKKPHVEEAPTSFDTTSQAPTN--DNICSITRITPQDLKLDSQQRHKICDAIAVSSIISNCAGVDTSHSSYLTPSEIHDFLVNFQEEHLNLEEIAELVRTFEPDPAMRSRCFMSFEGFARMLMDKNNYAHAYEKSSHTDEDMDHPLPHYYIASSHNTYLTGHQLKGESSVELYSQVLLMGCRCVELDCWDGEDGMPIIYHGHTLTTKISFKGVVEAINRSAFVTSPYPIILSIENHCSLPQQQKMAQIFVSVFGDKLVTDFLFDSDFIDDPVLPSPNQLKY 1292          

HSP 2 Score: 434.491 bits (1116), Expect = 9.554e-119
Identity = 272/705 (38.58%), Postives = 395/705 (56.03%), Query Frame = 2
Query: 8354 DWQFDD-ITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNR--DTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEE--------IPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRK--DDPNDFVLVEEISAPNYQESP---GGXXXXXXXXXXXXXILEGSECVYLIQKQ-SNASGKLLLMTKFNV 10417
            DWQF++ ITS              LK   K+KT KASQI   LS+LVVYT AVK R L++  SP T+ K KK   +R +L      GT+ S      T  +SGL+ K+D    + +  +    +                       P  + ++S+NE+KAK +CRR P   +CH E+QL+RTYPAG+R+DSSNFNPVIFWAFGIQMVALNYQTED A+ +N AMF Q+   GY+LKP+VMW+K HV+FN+FNPW+KEF+G+    LT+QIISGQ ++  + S +  +E+E+IGI +DC K KT+ + +N +NP W++ F F++ F DLAFIRF VID +++H++ Q+V P+K L+ G+RH+ L++      Q  +++TLFV+   E+++                   +     + +  + T K  ++  K    S   K       +T   K K ++ +I + GV   + Y ILK+   ST  D I QAL K GRLD+ IA+YVL+++  +  E          R++ + E + +   K     +FIL++ S DPSSRAWMTT+L E  ++R+ EE+S         M      LVC++NVSP+QPYTI K  + ST   +I+ A+ KA R   +DP DFVL+EE+S  +   S    GG              L   E VY  Q     A+G+ +LM +  +
Sbjct: 1409 DWQFEEEITS--------------LKVQPKVKTKKASQIAKELSDLVVYTHAVKFRGLSM--SPNTSLKQKKVPSRRSILTASM--GTSPST----PTLMASGLD-KTDSSLQVTIPKMKRPEV-----------------------PSCYLVSSLNENKAKQLCRRSPLATVCHTERQLMRTYPAGMRIDSSNFNPVIFWAFGIQMVALNYQTEDVAMSLNTAMFEQNGRSGYILKPSVMWDKTHVMFNRFNPWDKEFDGLHTTILTLQIISGQYVS-QHYSTNVQVEVEVIGIPVDCAKQKTKVVPKNALNPIWNDIFTFQVLFADLAFIRFVVIDASTSHLVTQRVIPLKCLRPGYRHVRLRN---GSGQPQELSTLFVYSKHEEEL-------------------LETRNGLENFSVSTSKRMSIFSKVRELSDTSKQDSKEVPNTAGTKLKRRMFFISVFGVTAPDEYIILKVTQDSTVADTIAQALTKVGRLDEKIADYVLVEDVQSGWEKKDQEKASCQRILDVGEKVLAAQNKWKGAGKFILRKLSDDPSSRAWMTTMLKE--QKRQMEEFSTTDWEGEEHM-----FLVCVFNVSPDQPYTIFKAPVTSTAQDIITQAMKKAHRANTEDPRDFVLLEEVSELHQSSSSKKLGGEKSDTSRT------LADDENVYQAQNDWRTAAGRFVLMNRSEI 2031          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A2C9KBQ5 (Phosphoinositide phospholipase C OS=Biomphalaria glabrata OX=6526 GN=106080104 PE=4 SV=1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 524/1360 (38.53%), Postives = 768/1360 (56.47%), Query Frame = 2
Query: 4046 YESTNI--EYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAG---------PSNQMNSLFPDSNK---------------SLSYLTKKMAHSRLTSSRMRSRKPFR---------MMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFE---LEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS--VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKP------------SCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHE----LHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRH-VTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTN-DQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKY 7951
            Y++ NI     +L+QL+ +GDLPC+K++AATLA + +HI+ +WPETD           P++Q N+    +N                 L+  T+K+ + +     +RSR+  R         +     C SD E   ++      L++Y+PP Y  SKK  ELI++K KKLWHTP+YE+E+KLKQLY+K+CKNLP+YGC+LFQV+EILRGN  + V R+L +S   I L+D K+ +  + Q ++D  +W LS    A +   LEFR +K W L   S   ++S+T+++WE LD DG      A +R S EFD Q KQ+T RP++E    Y  ELE L  ++ FPEEVA+ML  TE KLF ++ PQ YVR+V+++LS   + +    V  LI R  EVSSWIT LI+TQ TH++RK + SCI+RL +  + +GNFN+ VEIL GL+SEKLKPFWL+I D    +LS +  LS+ +L+++ +  Y+  +NRAL I    V+PFFG FL +LK I    P+I++LPS +   +  VSD+NGED+F++RIGVGGLIN++K+++   +L DI +FQ H +++S I   +       ++ + +    E    P            S +P+  +    +V+V+ PRL +VD   LQI++ GTT+++ D+D  +     L+L   N+ + W +P                       +S L    S   F +    R+    +  C      G  +   +  +  + GF+D+  IK++Y G+  +  +++ I +R G + +   P   CI+I++G   S N     + P      W  GL +L AAA  +R  +D+++LWLK  YL+L+Y  +  Q  T AE  K FGGR WS    +  +++Q  S    A+                       NLF K     S S  +  V       +         S S++G S   TPS LR     S    + N   +   ++     L   P +L+   +   R           + + +  IT  + L+F+DF  LF+SF +  R D+K++FD +S+       +  ++     Q   N  +    +TR  P   KL S+QRH +  A+AV+SI++NC+G + S    +  +EI + L  FQ E  + E+  +++   E DP +R++  MS+EGFA  LMD++N+      +++ D+ MDHPL HY+IASSHNTYL+GHQ+ GESSVE+Y+QVLL GCRC+ELDCWDGEDG P+IYHGHT T KISF+ VVE I+RSAF TS YP+ILSIENHCSLPQQQKMAQIF  VFG+KLVT +LFDSD  DDP LPSPNQLKY
Sbjct:    4 YQADNIYTMTSKLQQLIVNGDLPCSKEEAATLAGIQLHIEEAWPETDEEEEEDLGAETPNHQNNNCGSPTNGLAGGDDGTAEQTRCFRLNTETEKLENLKHKKELIRSRRAHRITSTRRSTKLARSLLCTSDNEGRPREELD---LSRYLPPHYTTSKKVRELIEDKQKKLWHTPYYENEVKLKQLYIKICKNLPSYGCKLFQVKEILRGNTQKKVARLLAISNEKIMLLDTKTHLPAKMQQLKDMDDW-LSGTGKAHDSLVLEFRGTKAWTLAMPSVECLKSVTAAIWEALDMDGRFLNNGALQRESFEFDYQRKQLTPRPELEPVSQYTEELERLRKMLHFPEEVAMMLTSTEHKLFCSVPPQHYVRHVTMELSRPLLQKTQMSVEQLIQRFNEVSSWITQLIVTQATHDDRKAVLSCILRLAVYCWVLGNFNSAVEILCGLRSEKLKPFWLSIED---EDLSTLHSLSDMILTRDLSPEYKESINRALDIPECKVVPFFGSFLRELKSIFVGVPSIIVLPSEENHSLEFVSDYNGEDRFMTRIGVGGLINLDKLRQAHLVLGDIHLFQYHGNKASGITSSN-------QDDAVSSSSLEARPTPDDSDSDYDLDLDSYQPVKPLTCEHDVMVLTPRLLQVDLQTLQILNHGTTMIQWDEDAGRSSMCVLRLEADNATVTWCRPG----------------------WSALRGVTSPPDF-IFHSDRFHSSLHVLC---ARYGGGSDDNFNSL--EEGFLDVMNIKEVYLGD--ESVDLAGICKRHGLETSESEPK--CITIVHGNCMSANHKQCFIGPKGVTGAWYQGLCRLKAAAGKLRQQMDKRILWLKQQYLQLYYEGEKCQGPTPAEAIKVFGGRSWSSGLPTSAINEQGGSFRRSANFAVGPP-----------------NLFKKGKGTGSVSSKTDAVKGGGQTHAALASD---GSKSYSGKSK-RTPSPLR--KVRSEMNKSHNSDPTLNQIARGSPTLGFRPRSLTFSFTSRYRSRRRRMSLGCRSGDKSSSITHSTQLSFLDFVDLFKSFGLRCRKDLKELFDQVSSSKKPHVEEAPTSFDTTSQAPTN--DNICSITRITPQDLKLDSQQRHKICDAIAVSSIISNCAGVDTSHSSYLTPSEIHDFLVNFQEEHLNLEEIAELVRTFEPDPAMRSRCFMSFEGFARMLMDKNNYAHAYEKSSHTDEDMDHPLPHYYIASSHNTYLTGHQLKGESSVELYSQVLLMGCRCVELDCWDGEDGMPIIYHGHTLTTKISFKGVVEAINRSAFVTSPYPIILSIENHCSLPQQQKMAQIFVSVFGDKLVTDFLFDSDFIDDPVLPSPNQLKY 1292          

HSP 2 Score: 434.106 bits (1115), Expect = 1.234e-118
Identity = 270/706 (38.24%), Postives = 396/706 (56.09%), Query Frame = 2
Query: 8354 DWQFDD-ITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATL---RRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEE--------IPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRK--DDPNDFVLVEEISAPNYQESP---GGXXXXXXXXXXXXXILEGSECVYLIQKQ-SNASGKLLLMTKFNV 10417
            DWQF++ ITS              LK   K+KT KASQI   LS+LVVYT AVK R L++  SP T+ K KK   +R +L        ++    S+ T  +SGL+ K+D    + +  +    +                       P  + ++S+NE+KAK +CRR P   +CH E+QL+RTYPAG+R+DSSNFNPVIFWAFGIQMVALNYQTED A+ +N AMF Q+   GY+LKP+VMW+K HV+FN+FNPW+KEF+G+    LT+QIISGQ ++  + S +  +E+E+IGI +DC K KT+ + +N +NP W++ F F++ F DLAFIRF VID +++H++ Q+V P+K L+ G+RH+ L++      Q  +++TLFV+   E+++                   +     + +  + T K  ++    R+    SK        +T   K K ++ +I + GV   + Y ILK+   ST  D I QAL K GRLD+ IA+YVL+++  +  E          R++ + E + +   K     +FIL++ S DPSSRAWMTT+L E  ++R+ EE+S         M      LVC++NVSP+QPYTI K  + ST   +I+ A+ KA R   +DP DFVL+EE+S  +   S    GG              L   E VY  Q     A+G+ +LM +  +
Sbjct: 1409 DWQFEEEITS--------------LKVQPKVKTKKASQIAKELSDLVVYTHAVKFRGLSM--SPNTSLKQKKVPSRRSILT------ASMGTSPSTPTLMASGLD-KTDSSLQVTIPKMKRPEV-----------------------PSCYLVSSLNENKAKQLCRRSPLATVCHTERQLMRTYPAGMRIDSSNFNPVIFWAFGIQMVALNYQTEDVAMSLNTAMFEQNGRSGYILKPSVMWDKTHVMFNRFNPWDKEFDGLHTTILTLQIISGQYVS-QHYSTNVQVEVEVIGIPVDCAKQKTKVVPKNALNPIWNDIFTFQVLFADLAFIRFVVIDASTSHLVTQRVIPLKCLRPGYRHVRLRN---GSGQPQELSTLFVYSKHEEEL-------------------LETRNGLENFSVSTSKRMSIFSKVRELSDTSKQDSKEQVPNTAGTKLKRRMFFISVFGVTAPDEYIILKVTQDSTVADTIAQALTKVGRLDEKIADYVLVEDVQSGWEKKDQEKASCQRILDVGEKVLAAQNKWKGAGKFILRKLSDDPSSRAWMTTMLKE--QKRQMEEFSTTDWEGEEHM-----FLVCVFNVSPDQPYTIFKAPVTSTAQDIITQAMKKAHRANTEDPRDFVLLEEVSELHQSSSSKKLGGEKSDTSRT------LADDENVYQAQNDWRTAAGRFVLMNRSEI 2032          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A0A9XDT7 (Phosphoinositide phospholipase C (Fragment) OS=Lygus hesperus OX=30085 GN=Plce1_4 PE=4 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 440/1235 (35.63%), Postives = 686/1235 (55.55%), Query Frame = 2
Query: 4376 LAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHL--SRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVL-DCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVD----------KGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL-PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKP------SCRPIVDMINISNVVVIQPRLAK--VDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYG-NGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKI-SESDTKNSSNIGKIFQKDFNYENEQFYLTRN-------YPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNF-LKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTS 7984
            L   +PP YH +K   +L+KE+ +KL+HT  YESE++LK+LY++ CK LPA+GC+++QV+E+LRG   +   R+LG+    I L+D K+KIL +SQ   D   W     R+    +LEFR ++ W L   S S+MR +  +LW +L D D     + A  R+ +   L+ + + +          +AELE L  L+ FPEEV+L LA+ E  LF  + P  Y+R V+LDL   P               V +LI R  EVSSW+THLII+QPTHE+RK++ SCI+R+ +  + IGNFN  +EI+AGLKS KLKPFWL+I++  +  + I+D LS+ LLS E    Y   ++RAL +    VIPFFG FL  L+ I++ TP++++L P+ D   +  +SD+NGED + +RIG GGLIN++K+ +   +++ I+ F  H     +      +    +   S   P+  E  +       S +P+  + N   V           ++ H LQ++H G+T V  + +  +   V+++L  + SL+ W++P                       +S L    ++ P + +       P    C   T  G  ++TG      + G +++ ++K+I  G   R+  ++++ +RR+G        +  C++++YG + S+N+I+ ++ P    + W  GL+ ++   K    + D++M WLK  YL+LFY ++        +  + FGGR W+   ++G ++  S               P  N   ++             ++KF   ++   +P   P   R   +    S SH+    +  P+ L  S        +S+  +         D+L+ S      ++   K V +   H  + +  IT ++ L+F+DF  LFRSF + +R D+K +FD  S    S SD+  +    K          +   LTRN       Y +T  +  K+  +  A+A +SIV+NC+G + S+ ++I ++     L+  Q E   +E+   +I++HE DP LR+   +S+EGFA +LMD++NF         +++ MD+PLSHY+IASSHNTYL+GHQ+ GESSV++Y+QVLL+GCRC+ELDCWDG+DG+P+IYHGHTFT KI+F+SVVE I+RSAF TS YPVILSIENHCS+ QQ +MAQIF  VFG+KLV+++LF++D  DDP LPSP QLKYRILIKNKKLT+
Sbjct:    8 LEDCLPPCYHGAKAMAKLVKEQKRKLFHTSIYESEVQLKKLYIQTCKRLPAHGCKVYQVKELLRGKTKKKASRLLGLGQDRIVLLDSKTKILAKSQNTADLVQWQQCGGRSHDRLQLEFRGTR-WSLVVPSASAMRDVGRALWTILQDLDSHFLDEYALTRTPVHCVLKGRGLEVGD--------SAELEGLQRLLHFPEEVSLRLAKEEDTLFYQVPPIDYLRQVTLDLGGTPPPAPHPSHHDPSRASVRSLIKRFNEVSSWVTHLIISQPTHEDRKSVLSCILRVALCCWNIGNFNGAMEIVAGLKSNKLKPFWLSITE--KEPVPILDFLSQALLSVE----YERALSRALAMPECRVIPFFGAFLRDLRDILSTTPSLVVLAPAGDRTHLEFISDYNGEDHYFTRIGPGGLINLDKIYKTQAVMDKIASFHQHYHARVRDIDTMREQFSSIHTVSIERPYMTEETEDTDNEMDSYKPVQPLSNDHGVSFFPISSPSSGLNHHVLQMLHHGSTAVHWEGEGGRACLVYVRLERSCSLLSWSRPA----------------------WSGLRTASAQGPDYNLGAN----PEEQVCGKWTGAG-VSETGL-----EEGSLELASVKEISVGPRDRENPDLANTLRRYGLDHPGYHLNEVCLALVYGQNLSDNRILFLLLPPTLCRLWYSGLSCVIRGLKRHLQSSDRRMFWLKEQYLQLFYEENNCSGPMTVDAIRVFGGRDWA---NTGHITGMS---------------PPDNGTLRRG-----------PSAKFKKKKSIGNIPTLKPESYREPSE--GGSMSHHTRRTLPGPAALPPSCPSRSRSISSDMERPGASPQGSSDHLDSSSPTHHHRERGKKDVIWPVGHIRHGS--ITHETQLDFVDFVALFRSFSLRARKDLKDLFDQFSMSCRSMSDSSLNDGSLKSSPDHSGRAPKIGLLTRNSSADLLDYKNTPAMQKKK--IFDAIATSSIVSNCAGVDTSKSQVITMSNFAKFLETKQLEQRTEEEVKDLIQRHEPDPTLRSHNCLSFEGFARFLMDKENFAFVNEKVAPDEREMDYPLSHYYIASSHNTYLTGHQLKGESSVDLYSQVLLTGCRCVELDCWDGDDGSPLIYHGHTFTTKIAFKSVVEAINRSAFVTSPYPVILSIENHCSVQQQARMAQIFQSVFGDKLVSKFLFEADFSDDPCLPSPGQLKYRILIKNKKLTA 1160          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:103036293])

HSP 1 Score: 270.781 bits (691), Expect = 7.758e-72
Identity = 201/732 (27.46%), Postives = 352/732 (48.09%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEP-------STIEEIPRLIGLQENIESIIEKSNS-------TSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPP 10588
            ++ QI   LS+L++Y QAVK   L+   SP    + K    ++ +   V + G+    +         G  +       L  Q+ S+ G   +  +                 P  + I+SVNE+ AK +CRR  + LI H   QL+RTYPA  R+DS+N NP+++W  GIQ+VALNYQT+D  +++N+A F  + +CGY+LKP V+W+++  L+ +F+P ++E E + P   T+ ++SGQN+   N SGSP +E+E++G+ +D    +T+PI RN +NP WSE F F++ F D+AF+R AV++ NS+ +  Q++ P+K LK G+RH+ L++Q    N+  +V++LF+F    ++                               +  P+ A +          +   + R  I        H + + G    E +T++ ++   TA  ++         + D+ A+Y L++E        S ++++P+   L  + ES+++  NS         R  L+    + + ++ +     E S   +EE +                  V +++VSPEQP+T++K    ST   +I   L+KA+          P+D+VL+EE+S    +E  G   +K  + K  +R+L+  E V+  Q +   +GK +L  K  +         K+   +F S+  K  L     S +   P +      ++E+ T    PP
Sbjct: 1651 ESRQIAQELSDLIIYCQAVKFPGLS-TLSPIGPGRAKDRKSRKSIFGTVPVRGSPGEPVTLVRGP---GKAVLEGVKGTLEEQAQSVSGSAPSLSAIIR-------------TPKCYHISSVNENAAKRLCRRYSSKLIQHTAAQLLRTYPAATRIDSANPNPLMYWLHGIQLVALNYQTDDLPMQLNSAFFEANGHCGYILKPPVLWDRSCPLYQQFSPMDRELEHMTPTVYTLTVVSGQNVCPGNSSGSPCVEVEVLGLPVDTCHFRTKPIHRNTLNPMWSENFSFQVHFEDMAFLRLAVVENNSSQMTAQRILPLKALKPGYRHVQLRNQH---NESLEVSSLFLFSRRTEESP-----------------------------VGGPRPAAVL---------FSSEERRARIQ-------HKVTVHGAPGPEPFTVVTVSEHITAKQLLDML------VPDTSADYFLMEEKIPLSKERSEVKKVPQQRPLTAD-ESVLKTVNSWQPEEGYVGRICLRNRKENVNEKSTVMEGAEEVSTGGEEEMF-----------------FVQVHDVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSILSNPKPSDYVLMEEVS----RELAG---KKMSSAKPCQRVLQDHESVFQAQSKWKGAGKFILKLKEQIAR-----EDKRRGVSFASELRK--LTGRSRSVTVNGPPLHEAAHSKDERGTWPAAPP 2279          

HSP 2 Score: 270.011 bits (689), Expect = 1.254e-71
Identity = 142/302 (47.02%), Postives = 193/302 (63.91%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISES--DTKNSSNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S  D+       +I  K    + +   LTRN         +  +++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DNF  K      N   M +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ VVE I R+AF  S  PVILSIENHCSLPQQ+KMA++F  VFG+KLVT+
Sbjct: 1195 SIMSFIEFVELFKSFSIRSRKDLKELFDTYAVPCSRSGPDSVPLYTTLRIDDKVTGLQPDLDLLTRNGSDLGLFIRTRQQMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQQEHLTYDEILSIIQKFEPSSSMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDEMQYPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVVEAISRTAFVNSEMPVILSIENHCSLPQQRKMAEMFKTVFGDKLVTK 1496          

HSP 3 Score: 150.214 bits (378), Expect = 3.145e-35
Identity = 88/258 (34.11%), Postives = 140/258 (54.26%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDK----------------------GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            EL +L  LIQFPEE+A +L + E +L++ + P  Y+ +++ DLSS P+  K                       V +L+TR  EVSSW+T LI+   + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +  T   ++  +  L + +   E +  Y+  VNRAL I    V+PF G+FL +L   ++ T +++ L    S+    +  VSD+NG+  F+ R+G  GL N+ K   V  IL  I
Sbjct:  503 ELADLRHLIQFPEEIASILTEQEQQLYRRVFPLDYLSFLTRDLSS-PECHKRHPHLKASLSAPTMPTQNTTHNTVEDLVTRFNEVSSWVTWLILAAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQT---DIDTMRRLKDAMAQHESSSEYKKAVNRALNIPGCKVVPFCGVFLKELSEALDGTASLIGLRFPFSSQEDSIEFVSDYNGQLHFLQRVGNDGLHNIEKEATVSNILQTI 756          

HSP 4 Score: 73.9442 bits (180), Expect = 3.845e-12
Identity = 39/130 (30.00%), Postives = 68/130 (52.31%), Query Frame = 2
Query: 6167 GFIDIFTIKQIYYGNGRQLANISSIMRRF---GYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSV 6547
            G +D+  +K ++ G+     N   +  +      +EN        IS++YG   ++NK+++ V PT  A     GL +L++A + I+N  DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW V
Sbjct:  911 GVLDLSVVKAVFMGHPAVDINFVCLQHKLCNMSAEENG-------ISLLYGAHTTDNKLLHFVAPTHTASVLYEGLQQLLSAIRKIKNFPDQRLQWLRRQYVGLYQEDCRFEGPTLAQAIELFGGRRWGV 1033          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:103036293])

HSP 1 Score: 270.781 bits (691), Expect = 7.828e-72
Identity = 201/732 (27.46%), Postives = 352/732 (48.09%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEP-------STIEEIPRLIGLQENIESIIEKSNS-------TSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPP 10588
            ++ QI   LS+L++Y QAVK   L+   SP    + K    ++ +   V + G+    +         G  +       L  Q+ S+ G   +  +                 P  + I+SVNE+ AK +CRR  + LI H   QL+RTYPA  R+DS+N NP+++W  GIQ+VALNYQT+D  +++N+A F  + +CGY+LKP V+W+++  L+ +F+P ++E E + P   T+ ++SGQN+   N SGSP +E+E++G+ +D    +T+PI RN +NP WSE F F++ F D+AF+R AV++ NS+ +  Q++ P+K LK G+RH+ L++Q    N+  +V++LF+F    ++                               +  P+ A +          +   + R  I        H + + G    E +T++ ++   TA  ++         + D+ A+Y L++E        S ++++P+   L  + ES+++  NS         R  L+    + + ++ +     E S   +EE +                  V +++VSPEQP+T++K    ST   +I   L+KA+          P+D+VL+EE+S    +E  G   +K  + K  +R+L+  E V+  Q +   +GK +L  K  +         K+   +F S+  K  L     S +   P +      ++E+ T    PP
Sbjct: 1637 ESRQIAQELSDLIIYCQAVKFPGLS-TLSPIGPGRAKDRKSRKSIFGTVPVRGSPGEPVTLVRGP---GKAVLEGVKGTLEEQAQSVSGSAPSLSAIIR-------------TPKCYHISSVNENAAKRLCRRYSSKLIQHTAAQLLRTYPAATRIDSANPNPLMYWLHGIQLVALNYQTDDLPMQLNSAFFEANGHCGYILKPPVLWDRSCPLYQQFSPMDRELEHMTPTVYTLTVVSGQNVCPGNSSGSPCVEVEVLGLPVDTCHFRTKPIHRNTLNPMWSENFSFQVHFEDMAFLRLAVVENNSSQMTAQRILPLKALKPGYRHVQLRNQH---NESLEVSSLFLFSRRTEESP-----------------------------VGGPRPAAVL---------FSSEERRARIQ-------HKVTVHGAPGPEPFTVVTVSEHITAKQLLDML------VPDTSADYFLMEEKIPLSKERSEVKKVPQQRPLTAD-ESVLKTVNSWQPEEGYVGRICLRNRKENVNEKSTVMEGAEEVSTGGEEEMF-----------------FVQVHDVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSILSNPKPSDYVLMEEVS----RELAG---KKMSSAKPCQRVLQDHESVFQAQSKWKGAGKFILKLKEQIAR-----EDKRRGVSFASELRK--LTGRSRSVTVNGPPLHEAAHSKDERGTWPAAPP 2265          

HSP 2 Score: 270.011 bits (689), Expect = 1.266e-71
Identity = 142/302 (47.02%), Postives = 193/302 (63.91%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISES--DTKNSSNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S  D+       +I  K    + +   LTRN         +  +++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DNF  K      N   M +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ VVE I R+AF  S  PVILSIENHCSLPQQ+KMA++F  VFG+KLVT+
Sbjct: 1195 SIMSFIEFVELFKSFSIRSRKDLKELFDTYAVPCSRSGPDSVPLYTTLRIDDKVTGLQPDLDLLTRNGSDLGLFIRTRQQMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQQEHLTYDEILSIIQKFEPSSSMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDEMQYPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVVEAISRTAFVNSEMPVILSIENHCSLPQQRKMAEMFKTVFGDKLVTK 1496          

HSP 3 Score: 150.214 bits (378), Expect = 3.558e-35
Identity = 88/258 (34.11%), Postives = 140/258 (54.26%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDK----------------------GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            EL +L  LIQFPEE+A +L + E +L++ + P  Y+ +++ DLSS P+  K                       V +L+TR  EVSSW+T LI+   + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +  T   ++  +  L + +   E +  Y+  VNRAL I    V+PF G+FL +L   ++ T +++ L    S+    +  VSD+NG+  F+ R+G  GL N+ K   V  IL  I
Sbjct:  503 ELADLRHLIQFPEEIASILTEQEQQLYRRVFPLDYLSFLTRDLSS-PECHKRHPHLKASLSAPTMPTQNTTHNTVEDLVTRFNEVSSWVTWLILAAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQT---DIDTMRRLKDAMAQHESSSEYKKAVNRALNIPGCKVVPFCGVFLKELSEALDGTASLIGLRFPFSSQEDSIEFVSDYNGQLHFLQRVGNDGLHNIEKEATVSNILQTI 756          

HSP 4 Score: 73.9442 bits (180), Expect = 3.906e-12
Identity = 39/130 (30.00%), Postives = 68/130 (52.31%), Query Frame = 2
Query: 6167 GFIDIFTIKQIYYGNGRQLANISSIMRRF---GYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSV 6547
            G +D+  +K ++ G+     N   +  +      +EN        IS++YG   ++NK+++ V PT  A     GL +L++A + I+N  DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW V
Sbjct:  911 GVLDLSVVKAVFMGHPAVDINFVCLQHKLCNMSAEENG-------ISLLYGAHTTDNKLLHFVAPTHTASVLYEGLQQLLSAIRKIKNFPDQRLQWLRRQYVGLYQEDCRFEGPTLAQAIELFGGRRWGV 1033          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:103036293])

HSP 1 Score: 270.011 bits (689), Expect = 1.331e-71
Identity = 190/672 (28.27%), Postives = 332/672 (49.40%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEP-------STIEEIPRLIGLQENIESIIEKSNS-------TSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTK 10408
            ++ QI   LS+L++Y QAVK   L+   SP    + K    ++ +   V + G+    +         G  +       L  Q+ S+ G   +  +                 P  + I+SVNE+ AK +CRR  + LI H   QL+RTYPA  R+DS+N NP+++W  GIQ+VALNYQT+D  +++N+A F  + +CGY+LKP V+W+++  L+ +F+P ++E E + P   T+ ++SGQN+   N SGSP +E+E++G+ +D    +T+PI RN +NP WSE F F++ F D+AF+R AV++ NS+ +  Q++ P+K LK G+RH+ L++Q    N+  +V++LF+F    ++                               +  P+ A +          +   + R  I        H + + G    E +T++ ++   TA  ++         + D+ A+Y L++E        S ++++P+   L  + ES+++  NS         R  L+    + + ++ +     E S   +EE +                  V +++VSPEQP+T++K    ST   +I   L+KA+          P+D+VL+EE+S    +E  G   +K  + K  +R+L+  E V+  Q +   +GK +L  K
Sbjct: 1637 ESRQIAQELSDLIIYCQAVKFPGLS-TLSPIGPGRAKDRKSRKSIFGTVPVRGSPGEPVTLVRGP---GKAVLEGVKGTLEEQAQSVSGSAPSLSAIIR-------------TPKCYHISSVNENAAKRLCRRYSSKLIQHTAAQLLRTYPAATRIDSANPNPLMYWLHGIQLVALNYQTDDLPMQLNSAFFEANGHCGYILKPPVLWDRSCPLYQQFSPMDRELEHMTPTVYTLTVVSGQNVCPGNSSGSPCVEVEVLGLPVDTCHFRTKPIHRNTLNPMWSENFSFQVHFEDMAFLRLAVVENNSSQMTAQRILPLKALKPGYRHVQLRNQH---NESLEVSSLFLFSRRTEESP-----------------------------VGGPRPAAVL---------FSSEERRARIQ-------HKVTVHGAPGPEPFTVVTVSEHITAKQLLDML------VPDTSADYFLMEEKIPLSKERSEVKKVPQQRPLTAD-ESVLKTVNSWQPEEGYVGRICLRNRKENVNEKSTVMEGAEEVSTGGEEEMF-----------------FVQVHDVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSILSNPKPSDYVLMEEVS----RELAG---KKMSSAKPCQRVLQDHESVFQAQSKWKGAGKFILKLK 2212          

HSP 2 Score: 270.011 bits (689), Expect = 1.435e-71
Identity = 142/302 (47.02%), Postives = 193/302 (63.91%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISES--DTKNSSNIGKIFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S  D+       +I  K    + +   LTRN         +  +++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DNF  K      N   M +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+QVLL GCR +ELDCWDG+DG P+IYHGHT T KI F+ VVE I R+AF  S  PVILSIENHCSLPQQ+KMA++F  VFG+KLVT+
Sbjct: 1195 SIMSFIEFVELFKSFSIRSRKDLKELFDTYAVPCSRSGPDSVPLYTTLRIDDKVTGLQPDLDLLTRNGSDLGLFIRTRQQMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQQEHLTYDEILSIIQKFEPSSSMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDEMQYPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVVEAISRTAFVNSEMPVILSIENHCSLPQQRKMAEMFKTVFGDKLVTK 1496          

HSP 3 Score: 149.828 bits (377), Expect = 3.891e-35
Identity = 88/258 (34.11%), Postives = 140/258 (54.26%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDK----------------------GVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILP---SNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDI 5626
            EL +L  LIQFPEE+A +L + E +L++ + P  Y+ +++ DLSS P+  K                       V +L+TR  EVSSW+T LI+   + EE++ +FS +V +    + +GN+NAV+E LAGL+S K+   W  +  T   ++  +  L + +   E +  Y+  VNRAL I    V+PF G+FL +L   ++ T +++ L    S+    +  VSD+NG+  F+ R+G  GL N+ K   V  IL  I
Sbjct:  503 ELADLRHLIQFPEEIASILTEQEQQLYRRVFPLDYLSFLTRDLSS-PECHKRHPHLKASLSAPTMPTQNTTHNTVEDLVTRFNEVSSWVTWLILAAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQT---DIDTMRRLKDAMAQHESSSEYKKAVNRALNIPGCKVVPFCGVFLKELSEALDGTASLIGLRFPFSSQEDSIEFVSDYNGQLHFLQRVGNDGLHNIEKEATVSNILQTI 756          

HSP 4 Score: 73.9442 bits (180), Expect = 4.514e-12
Identity = 39/130 (30.00%), Postives = 68/130 (52.31%), Query Frame = 2
Query: 6167 GFIDIFTIKQIYYGNGRQLANISSIMRRF---GYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSV 6547
            G +D+  +K ++ G+     N   +  +      +EN        IS++YG   ++NK+++ V PT  A     GL +L++A + I+N  DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW V
Sbjct:  911 GVLDLSVVKAVFMGHPAVDINFVCLQHKLCNMSAEENG-------ISLLYGAHTTDNKLLHFVAPTHTASVLYEGLQQLLSAIRKIKNFPDQRLQWLRRQYVGLYQEDCRFEGPTLAQAIELFGGRRWGV 1033          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 204.142 bits (518), Expect = 1.647e-52
Identity = 112/205 (54.63%), Postives = 138/205 (67.32%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIEK+E D +L+ +G MS +GF  YLM  +N   FL   LD   D  MD PL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLLSGCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS PQQ KMA+    +FGE L+ + L    ++    LPSPN LK +ILIKNK+L
Sbjct:  262 DPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLD-RLDMCQD--MDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRL 463          

HSP 2 Score: 138.272 bits (347), Expect = 7.345e-32
Identity = 82/242 (33.88%), Postives = 139/242 (57.44%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            H ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LN+QT D A+++N   F  +  CGY+ KP  M   + +    F+P+ E   +G++    ++Q+ SGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++E  F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  547 HNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRM----FDPFSETPVDGVIAATCSVQVFSGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEPFVFRKVILPDLAVLRIAVYDDNN-KLIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTVFCNIVLK 778          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 205.682 bits (522), Expect = 1.737e-52
Identity = 112/205 (54.63%), Postives = 138/205 (67.32%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDN---FLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWD--GEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D +   +IIEK+E D +L+ +G MS +GF  YLM  +N   FL   LD   D  MD PL+HYFI+SSHNTYL+G Q  G+SSVEMY QVLLSGCRC+ELDCWD  GED  P+I HG      I F+ V++ I  +AF TS YPVILS ENHCS PQQ KMA+    +FGE L+ + L    ++    LPSPN LK +ILIKNK+L
Sbjct:  264 DPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFL-DRLDMCQD--MDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRL 465          

HSP 2 Score: 140.198 bits (352), Expect = 2.345e-32
Identity = 82/242 (33.88%), Postives = 139/242 (57.44%), Query Frame = 2
Query: 8801 HQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIK--CKTRPIQRNMINPNWSET-FQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISME 9511
            H ++S NES      +      + + ++Q+ R YP G R+DSSN+ P IFW  G QMV+LN+QT D A+++N   F  +  CGY+ KP  M   + +    F+P+ E   +G++    ++Q+ SGQ L+  +      +E+++ G+  D I+   +TR +  N +NP ++E  F F K+  PDLA +R AV D N+  +I Q++ P+  L+ G+RHI L+++   GN+   + T+F  I ++
Sbjct:  621 HNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRM----FDPFSETPVDGVIAATCSVQVFSGQFLS--DKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEPFVFRKVILPDLAVLRIAVYDDNN-KLIGQRILPLDGLQAGYRHISLRNE---GNKPLSLPTVFCNIVLK 852          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003967.1 (pep scaffold:Pmarinus_7.0:GL481506:613:30747:-1 gene:ENSPMAG00000003626.1 transcript:ENSPMAT00000003967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.523 bits (776), Expect = 2.370e-83
Identity = 208/584 (35.62%), Postives = 312/584 (53.42%), Query Frame = 2
Query: 6293 ISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSD-QSCSTSTYASTFTSKSRP---KTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKN---SSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSK-------QRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQS-MDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQS 7993
            +++++G   ++N+ +  + P   A      L     A + ++   DQ++ WL+  Y  LF  +            +A G R     +  G VS  + C  S   S F  ++ P    T   +  S+  ++  +  +S S    S N    P +P   SRS       + S N I +++   +LR  T    A A S+R   +   SA   +                 V++H+  N            ++F +F  LF+SFI+ SR D+K +F+  S   S  ++      S+     +     + E   +TRN        +        QR ++ A+A ASI++N +G E +  R++ +   ++ + L + QGE     +  ++I++ E    +R +G+MS+EGFA +L+D DNF     ++  D+S +  PLSHY+IASSHNTYL+GHQ+ G+SSVE+Y QVLL GCR +ELDCWDG+DG+P+IYHGHT T KI FQ VVE I+RSAF TS  PVILSIENHC L QQ+KMA+IF  VFGE+LVTR+LF+SD  DDP LPSP QL+ +ILIKN+KL +  +
Sbjct:  222 LTLLHGAGTTDNRALRFLAPKQTASQLTDALRLAATALRGLKRYPDQRLYWLRKQYAALFQVR-----------ARAGGWRGSRAGHGLGAVSSLEGCVQSR--SPFGDRAAPCRKLTLLLNDNSQPIRVLKIPTQSPSIAISSDNHVYPPCTPFGPSRSHAM----ADSFNIIVVVS--KWLRPKTRVYSANACSSRNSHSWHGSARSGFT----------------VSFHDFDN-----------SVSFTEFVELFKSFIVRSRKDLKDVFEVYSVPCSRCESPAVPVGSHADAAPRTPPGAQPEIDLITRNESEAGAAAAGAAAAGAYQRQISDAIAAASILSNGTGVESTSPRLLGMAPRQLADFLAKCQGEHLTYPELLRLIQRFEPSESMRQRGIMSFEGFARFLLDADNFACVLEESPPDESQLQRPLSHYYIASSHNTYLTGHQLKGDSSVELYLQVLLQGCRSVELDCWDGDDGSPIIYHGHTLTTKIPFQDVVEAINRSAFVTSELPVILSIENHCCLAQQRKMAEIFKNVFGERLVTRFLFESDFLDDPMLPSPWQLRGKILIKNRKLKAHHT 759          

HSP 2 Score: 196.823 bits (499), Expect = 2.928e-50
Identity = 94/245 (38.37%), Postives = 151/245 (61.63%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKC---KTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVID-VNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMED 9514
            P  + ++S+NE+ AK +CRR    +  H   QL+RTYPA  R++SSN +P+++W  GIQMVALNYQTED  + +N AMF Q+  CG+VLKP V+ ++   L   F P ++E EG+ P    I +ISGQ +   N +GSP +ELE+ G+ +D       +T+ + RN +NP W ETF   +    +AF+R +V+D      +  Q++ P+ +L+ G+RH+ L++     N+   +++LF+ +  E+
Sbjct:  947 PKCYHMSSMNENAAKRLCRRYGAKVPQHTMCQLLRTYPAATRIESSNPHPMLYWLHGIQMVALNYQTEDLPMALNAAMFEQNGGCGFVLKPPVLRDRTCPLQKTFRPMDREIEGVQPTTYHITVISGQYVCPGNTAGSPHVELELAGMPLDTCHAGHLRTKTVARNALNPLWGETFTLPVHLEAMAFLRLSVVDGGGGGGVTAQRMVPLASLRTGYRHLRLRN---VHNEALPISSLFLCVRREE 1188          

HSP 3 Score: 55.8398 bits (133), Expect = 2.187e-7
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 2
Query: 10097 ASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKAR------RKDDPNDFVLVEEISAPNYQESPG 10288
            +S  LV ++++ PEQP+TI++ +  ST   +I+  L+KA+      RK DP D+VLVEE+  P  + SPG
Sbjct: 1332 SSTFLVRVHDILPEQPHTIIRAECASTAQDIITQTLSKAKYSMTSLRKSDPADYVLVEELKDPK-RVSPG 1400          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003976.1 (pep scaffold:Pmarinus_7.0:GL481506:4575:23311:-1 gene:ENSPMAG00000003626.1 transcript:ENSPMAT00000003976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.802 bits (595), Expect = 1.929e-66
Identity = 124/216 (57.41%), Postives = 160/216 (74.07%), Query Frame = 2
Query: 7409 KHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQS-MDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVT 8053
            + E    +R +G+MS+EGFA +L+D DNF     ++  D+S +  PLSHY+IASSHNTYL+GHQ+ G+SSVE+Y  VLL GCR +ELDCWDG+DG+P+IYHGHT T KI FQ VVE I+RSAF TS  PVILSIENHC L QQ+KMA+IF  VFGE+LVTR+LF+SD  DDP LPSP QL+ +ILIKN+KL +  +      +  I    + G+++
Sbjct:    1 RFEPSESMRQRGIMSFEGFARFLLDADNFACVLEESPPDESQLQRPLSHYYIASSHNTYLTGHQLKGDSSVELYRTVLLQGCRSVELDCWDGDDGSPIIYHGHTLTTKIPFQDVVEAINRSAFVTSELPVILSIENHCCLAQQRKMAEIFKNVFGERLVTRFLFESDFLDDPMLPSPWQLRGKILIKNRKLKAHHTPVDLLKQKGISHKGTTGMLS 216          

HSP 2 Score: 175.252 bits (443), Expect = 1.799e-46
Identity = 83/194 (42.78%), Postives = 123/194 (63.40%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKC---KTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVID 9364
            P  + ++S+NE+ AK +CRR    +  H   QL+RTYPA  R++SSN +P+++W  GIQMVALNYQTED  + +N AMF Q+  CG+VLKP V+ ++   L   F P ++E EG+ P    I +ISGQ +   N +GSP +ELE+ G+ +D       +T+ + RN +NP W ETF   +    +AF+R +V+D
Sbjct:  290 PKCYHMSSMNENAAKRLCRRYGAKVPQHTMCQLLRTYPAATRIESSNPHPMLYWLHGIQMVALNYQTEDLPMALNAAMFEQNGGCGFVLKPPVLRDRTCPLQKTFRPMDREIEGVQPTTYHITVISGQYVCPGNTAGSPHVELELAGMPLDTCHAGHLRTKTVARNALNPLWGETFTLPVHLEAMAFLRLSVVD 483          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003983.1 (pep scaffold:Pmarinus_7.0:GL481506:4806:23311:-1 gene:ENSPMAG00000003626.1 transcript:ENSPMAT00000003983.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.417 bits (594), Expect = 2.374e-66
Identity = 122/196 (62.24%), Postives = 153/196 (78.06%), Query Frame = 2
Query: 7409 KHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQS-MDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQS 7993
            + E    +R +G+MS+EGFA +L+D DNF     ++  D+S +  PLSHY+IASSHNTYL+GHQ+ G+SSVE+Y  VLL GCR +ELDCWDG+DG+P+IYHGHT T KI FQ VVE I+RSAF TS  PVILSIENHC L QQ+KMA+IF  VFGE+LVTR+LF+SD  DDP LPSP QL+ +ILIKN+KL +  +
Sbjct:    1 RFEPSESMRQRGIMSFEGFARFLLDADNFACVLEESPPDESQLQRPLSHYYIASSHNTYLTGHQLKGDSSVELYRTVLLQGCRSVELDCWDGDDGSPIIYHGHTLTTKIPFQDVVEAINRSAFVTSELPVILSIENHCCLAQQRKMAEIFKNVFGERLVTRFLFESDFLDDPMLPSPWQLRGKILIKNRKLKAHHT 196          

HSP 2 Score: 145.206 bits (365), Expect = 2.526e-36
Identity = 77/194 (39.69%), Postives = 113/194 (58.25%), Query Frame = 2
Query: 8792 PPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKC---KTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVID 9364
            P  + ++S+NE+ AK +CRR    +  H   QL+RTYPA  R++SSN +P+++W  GIQMVALNYQTED  + +N AMF Q+  CG+VLKP V+      L +                   Q+ISGQ +   N +GSP +ELE+ G+ +D       +T+ + RN +NP W ETF   +    +AF+R +V+D
Sbjct:  291 PKCYHMSSMNENAAKRLCRRYGAKVPQHTMCQLLRTYPAATRIESSNPHPMLYWLHGIQMVALNYQTEDLPMALNAAMFEQNGGCGFVLKPPVLRRVRKRLRSACARAVVARRAR----ADAQVISGQYVCPGNTAGSPHVELELAGMPLDTCHAGHLRTKTVARNALNPLWGETFTLPVHLEAMAFLRLSVVD 480          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004386.1 (pep scaffold:Pmarinus_7.0:GL496322:1097:3585:1 gene:ENSPMAG00000004010.1 transcript:ENSPMAT00000004386.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 6.012e-53
Identity = 82/151 (54.30%), Postives = 106/151 (70.20%), Query Frame = 2
Query: 7433 RAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            + Q  M+ +GF  YLM  D  +         Q M HPLSHYFI+SSHNTYL   Q+ G SS E YA+ L  GCRC+ELDCWDG +G P++YHG+TFT+KI F+ V+E I++ AFQ+S +P+ILSIENHC++PQQ  MAQ    +FG KL+T
Sbjct:    2 KEQQSMTLDGFTMYLMSADGCIFNPSHGHVFQDMSHPLSHYFISSSHNTYLMEDQLRGPSSTEAYARALKRGCRCVELDCWDGPNGDPIVYHGYTFTSKILFRDVIEVINQYAFQSSEFPLILSIENHCTMPQQTVMAQYMRNIFGNKLLT 152          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: plcd3b (phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GENE-081222-2])

HSP 1 Score: 188.734 bits (478), Expect = 4.748e-49
Identity = 99/217 (45.62%), Postives = 132/217 (60.83%), Query Frame = 2
Query: 7325 IPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKK 7975
            +P   +   LQ  Q E   +     II +HE   E R++G+M+ +GF  YL   D  L     ++    M  PLSHYFI+SSHNTYL+  Q+ G SS E Y + L+ GCRC+ELDCWDG DG PVIYHG+T T++I F+ V+ +I   AF+ S+YPVILS+ENHC++ QQ  MA+    + GE+LVT             LPSP +LK + LIK KK
Sbjct:  226 LPAARLAQFLQDEQHEDDSEHRAACIIAEHEPLDEGRSKGLMTLDGFVRYLTSPDGSLWDQRHDSVSHDMTQPLSHYFISSSHNTYLTDDQLRGPSSTEAYVKSLMRGCRCVELDCWDGADGEPVIYHGYTLTSQILFRDVITSIAHEAFKASAYPVILSLENHCNVEQQIVMARHLRSILGERLVT---APLPGRPPTQLPSPEELKGKFLIKAKK 439          

HSP 2 Score: 140.969 bits (354), Expect = 9.654e-34
Identity = 87/249 (34.94%), Postives = 133/249 (53.41%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNL---------NIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNST---HIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISM 9508
             +++ S +E+K   +        + +  + L RTYP+G R+ S N+NP   W  G Q+VALN+QT  + +++ + +F Q+  CGYVLKP+ + +  H  F+  NP      G  P  L I +ISGQ L         +II+    PL+ +E+ G++ D    +T   + N +NP W E F F++  P+LA IRF V D + T     I Q   P   L++G+RH+ L S  + G  LF  ATLFV I +
Sbjct:  515 GNEMCSFSETKTMGLIETQGNAFVRYNMQHLSRTYPSGTRVGSGNYNPHDMWNAGCQIVALNFQTPGKEMDLYDGLFRQNGGCGYVLKPSFLRDP-HTDFDPGNPARG--TGRHPVKLAITVISGQQLPKERNSRRGSIID----PLVSVEVHGVRGDTAVRETHHQENNGLNPVWKEEFLFQLTVPELALIRFVVKDYDVTSRNDFIGQFSLPFSCLRQGYRHVHLLS--LDGRSLFP-ATLFVHIRI 753          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Yeast
Match: PLC1 (Phospholipase C; hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes; Plc1p and inositol polyphosphates are required for acetyl-CoA homeostasis which regulates global histone acetylation [Source:SGD;Acc:S000006189])

HSP 1 Score: 130.183 bits (326), Expect = 1.940e-30
Identity = 81/204 (39.71%), Postives = 116/204 (56.86%), Query Frame = 2
Query: 7364 QGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKK 7975
            Q E  D++  W    K+  +P    Q  M  +GF  +L +Q   ++       ++    PL+HYFIASSHNTYL G QI    SVE Y QVL  GCRC+E+D WDGE+G PV+ HG   T+ I  ++V+  I + AF TS YP+I+S+E +C+   Q+  + I  +V  E+L               LPSP +LK++IL+K+KK
Sbjct:  335 QHEQVDRQTAWSYFIKYR-EP---TQLTMGQDGFTKFLKEQPYLVE-----VKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDGENG-PVVCHGF-LTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQKLASLIMREVLAEQLY------FVGTRTDKLPSPRELKHKILLKSKK 521          

HSP 2 Score: 97.0561 bits (240), Expect = 3.552e-20
Identity = 89/270 (32.96%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 8792 PPAHQIA---SVNESKAKSVCR--RIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMF-------GQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKE-FE-GILPCYLTIQIISGQ---NLNIINPS---------------GSPLLELEI-IGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHI--ICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFV 9496
            P +  IA   S+NE K + + +   +   L  H  + L+R YP  +R  SSNFNP+ FW  G+QMVA N+QT D   ++N AMF         S+  GYVLKP  +     V   K  P   E FE G  P  + I+I+S Q    LN  +PS                 P + + I  G ++   +  T+  Q N  NP W       +   DL FI+F VI    T I  +C K   +  L+ G+RHIPL   F    + +   TLF+
Sbjct:  604 PESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPV--VTKAKMIPLIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDKGTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVIS-EETQIASVCLK---LNYLRMGYRHIPL---FNMEGEQYIFCTLFI 864          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO43813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXP6])

HSP 1 Score: 188.734 bits (478), Expect = 7.270e-49
Identity = 102/201 (50.75%), Postives = 131/201 (65.17%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDG--EDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKK 7975
            ++E   +II K+E + +   +G  S +G   YLM +DN        +  Q M  P+SHYFI SSHNTYL+GHQ+TG+SSVEMY Q LL+GCRCIELDCWDG  ED  PVI HG T   +ISF+ V+E I   AF+TS YPVILS ENHC+  QQ KMA     +FG+ L+++ L D  L++   LP    L  +I+IKNKK
Sbjct:  193 NEEKAREIIRKYEPNQDFVKKGHFSVQGLTRYLMSEDNAPIHPDRLSLHQDMTQPISHYFINSSHNTYLTGHQLTGKSSVEMYRQTLLAGCRCIELDCWDGKTEDQEPVITHGMTLCTEISFKDVIEAIAECAFKTSDYPVILSFENHCTPKQQLKMASYCVNIFGDMLLSKPLDDYPLEEGRPLPPLKVLMRKIVIKNKK 393          

HSP 2 Score: 131.724 bits (330), Expect = 1.316e-30
Identity = 82/244 (33.61%), Postives = 135/244 (55.33%), Query Frame = 2
Query: 8798 AHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPW-EKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCI--KCKTRPIQRNMINPNW-SETFQF-KIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMED 9514
            +++++S  E+ A +  +  P   + + ++QL R YP G R+ S N+ P IFW  G Q+VALN+QT D A+ +N  +F  +  CGY+LKP+ M   +      F+P+ E   +GI+   + +++ISGQ L          +E+E+ G+  D +  K +T+ +  N INP +  + F+F K+  P LA +R AV +  S  +I Q++ PV  L  G+RHI L++     N    +  LFV I  +D
Sbjct:  474 SYEMSSFVETVATTQLKEKPVEFVNYNKRQLSRIYPKGTRVGSENYMPQIFWNAGCQLVALNFQTLDLAMMLNLGIFEYNGRCGYILKPSFMRRSDRT----FDPFAESTVDGIIAGAVHVKVISGQLLT--EKKVGTYVEVEMYGLPADTVRKKYRTKVVPNNGINPVYDDDPFEFKKVVLPSLAVLRIAVYE-ESGKLIGQRILPVDGLNPGYRHIKLRND---CNLPLTLPVLFVHIITKD 707          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO28963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T501])

HSP 1 Score: 173.326 bits (438), Expect = 4.736e-47
Identity = 94/200 (47.00%), Postives = 125/200 (62.50%), Query Frame = 2
Query: 7379 DKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKL 7978
            D+E C  II+ +E     +   ++  +GF  YL+  D  +     +   Q M  PLSHYFIASSHNTYL+G Q+   SS++MY +VL SGCRC+ELDCWDG+DG PV+YHG+T T+K+ F+ V+  I+  AF  + YPVILS+ENHCS+ QQ+ MA      F + L         L D   LPSP +L  +ILIK KKL
Sbjct:  107 DEEYCSNIIQTYEPADSNKKNMLLGIDGFTSYLLSADGEIFNPEHSDVYQDMTRPLSHYFIASSHNTYLTGDQLASASSMDMYVRVLQSGCRCLELDCWDGKDGEPVVYHGYTMTSKVKFRYVILNINDFAFLNNRYPVILSLENHCSVEQQKFMANFMRDTFKDILCI---LFFMLFDGKDLPSPQELMGKILIKTKKL 303          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO48044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKT2])

HSP 1 Score: 175.252 bits (443), Expect = 1.033e-46
Identity = 94/198 (47.47%), Postives = 121/198 (61.11%), Query Frame = 2
Query: 7337 EIQNILQQFQGESGDKEDCWKIIEKHEV------------DPEL--RAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            E Q  L + Q ES     C K+I  H+             DP+   R++  +S  GF  +L  QDN +     N   Q MD PLS YFI SSHNTYL+GHQ+ G SS+E Y + LL GCRCIELD WDG D  P+I HG T T+KI F+ VV+ I   AF+ S YP+ILS+ENHC++ QQ +MA+IF + FG+ LVT+
Sbjct:  193 EFQAFLAKEQKESLSLAMCAKLIYAHDKLHTMFKRKCAGNDPDAFKRSKHFLSLHGFISFLRSQDNSIVKPEHNKVYQDMDQPLSDYFINSSHNTYLTGHQLKGLSSLEAYVRALLQGCRCIELDIWDGPD-EPIITHGRTLTSKIRFRDVVQIIKEYAFEVSEYPLILSLENHCNIQQQAQMAEIFLKDFGDMLVTQ 389          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO46546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ0])

HSP 1 Score: 182.185 bits (461), Expect = 6.120e-46
Identity = 100/201 (49.75%), Postives = 126/201 (62.69%), Query Frame = 2
Query: 7382 KEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTS 7984
            K  C +II + E   E R +  +  +GF  YLM+ D  +         Q M  PLSHYFIASSHNTYL  +Q++G SS+E Y   L  GCRC+ELDCWDG    P+IYHGHT T+KI F+  VE I+  AF  S YPVILSIENHC + QQQ MA+   ++  +KL T     +  +D+ +LPSP  LK RILIKNKKL +
Sbjct:  257 KHYCLEIISRCEPTEEGRKKKCLGIDGFTQYLMESDCDIFDPDQQNICQDMTQPLSHYFIASSHNTYLLDNQLSGRSSIEGYIAALQQGCRCVELDCWDGPYDEPIIYHGHTLTSKIMFKETVEAIEEHAFDVSPYPVILSIENHCCVKQQQIMAKYLKEILKDKLYTE----APGEDETFLPSPEALKGRILIKNKKLPA 453          

HSP 2 Score: 143.28 bits (360), Expect = 7.343e-34
Identity = 91/256 (35.55%), Postives = 140/256 (54.69%), Query Frame = 2
Query: 8774 RYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKE-FEGILPCYLTIQIISGQNLNIINPSGS--------PLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVN--STHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISM 9508
            +Y   N    ++ S+NE+ A+ +    P   + + ++ L R YP+G R+ SSN+NP   W  G Q+VALNYQT    + VN+  F ++  CGYVLKP+VM  ++ + +  FNP  K+   GI P  + I++ISGQ      P GS        P + +E+ GI  D  + +TR +  N  NP + ETF+F I  P++A  RF V D +      I Q   P+  +++G RH+ L +    G+ L D ATLFV +++
Sbjct:  508 QYSADNQKFWELCSLNEALARRLGNAYPEEFVNYNKRCLSRIYPSGKRVGSSNYNPQDMWNCGCQLVALNYQTPGIMMHVNSGKFLENGECGYVLKPSVM--RDEIAY--FNPNTKDAIPGISPQIVQIKVISGQQFP--KPKGSTAKGDVIDPYVTIEVFGIPSDIAQERTRTVPHNGFNPVFDETFEFHINLPEIALFRFVVQDDDFIGDGFIGQYTIPLNCMQQGDRHLRLLA--FDGDPL-DSATLFVHVTI 754          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO31556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK4])

HSP 1 Score: 176.022 bits (445), Expect = 6.157e-46
Identity = 82/165 (49.70%), Postives = 108/165 (65.45%), Query Frame = 2
Query: 7391 CWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVT 7885
            C ++I+K EV    +AQ  +  +GF  ++  Q   L         Q M+ PLSHYFIASSHNTYL GHQ+ G SSV+ Y  VL  GCRC+ELDCWDG+D  P++YHGHT T+K+ F+ +V+ I  SAF+ S YPVI+S+ENHCS+  Q KMA+    + G  L T
Sbjct:   47 CKELIKKFEVSQRGKAQLQLGIDGFLSFINSQHASLFNPAHEKIYQDMNQPLSHYFIASSHNTYLLGHQLKGSSSVQAYRDVLERGCRCVELDCWDGDDEEPIVYHGHTLTSKVLFKDIVQAIKESAFKVSPYPVIVSLENHCSVQFQIKMAEHLKGILGSLLYT 211          

HSP 2 Score: 115.931 bits (289), Expect = 4.466e-26
Identity = 73/226 (32.30%), Postives = 118/226 (52.21%), Query Frame = 2
Query: 8885 QLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGS-------PLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTH--IICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVA-------TLFVFISMED 9514
            Q+ R YP  +R+DSSN++P+  W  G Q+VALN+QT  + ++++   F Q+ N GYVLKP  + +   + F+  +P + +F GI P  L + +IS   L  I  S S       P +++E+ G+  D     T  +    +NP W+E FQ  +  P+LA ++F V D +      + Q V P ++L +G+R I          QL D++       TLFV + + D
Sbjct:  333 QISRIYPGNLRVDSSNYDPIKPWTVGCQIVALNHQTNSEEMQLHYGKFRQNGNTGYVLKPKFLRDPE-LTFDP-DPQDGKFPGIQPKRLQLTVISAFQLLEIEESWSLVRDEPDPYVQVEVHGVPADKATFTTHGLTDTTLNPVWNEEFQTIVHVPELAMVQFVVYDEDYGFDDFLGQVVIPFESLMEGYRQI----------QLLDMSGLPLPGTTLFVHVKISD 546          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:101164102])

HSP 1 Score: 270.781 bits (691), Expect = 8.744e-72
Identity = 141/302 (46.69%), Postives = 194/302 (64.24%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGK--IFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S +++     K  I   D   +++   LTRN         +   ++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DN   +      N + + +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+ VLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE ++RSAF  S  PVILSIENHCSLPQQ+KMA+IF  VFGE+LVTR
Sbjct: 1185 STMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTR 1486          

HSP 2 Score: 243.817 bits (621), Expect = 1.300e-63
Identity = 126/355 (35.49%), Postives = 206/355 (58.03%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            ++ QI   LS+LV+Y QAVK   L+  S   +++   +G  ++ +        +    + S + +   G    S++L+    Q+  ++               P         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+ FW  GIQ+VALNYQT+D ++++N A+F  +  CGYVLKPAV+W++   L+ +F P E++ E + P   ++ ++SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP WSE F F + F +L F+RFAV++ NS+    Q+  P+  LK G+RH+ L++Q    N+  +V++LF++    D+
Sbjct: 1632 ESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG---SSERLSWEEQQTSPVLNP-------------PTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGYRHVQLRTQH---NESLEVSSLFIYSRRTDE 1967          

HSP 3 Score: 193.356 bits (490), Expect = 2.458e-48
Identity = 148/608 (24.34%), Postives = 264/608 (43.42%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS-----------------------VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL---PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFF-KPSCR--PIVDMINISNVVVIQPRLAKVD--------------------------PHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDG-QSGFIDIFTIKQIYYGNGR---QLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGV 6565
            EL EL  LIQFPEE+A +L + E +L+Q + P  Y+ +++ DL S                        P+    V +L+ R  EVSSW+T L++T  T EE++ +FS +V +    + +GN+N V+E LAGL+S K+   W  +    ++++  I  L + +   E +  Y+ V+ RAL I    V+PF G+FL +L   ++ T +I+ L   P N    V  +SD++G+  F++R G  GL    K   V  +L I+   +     +                 ++ S  D +  +     SC    + D+ +    + ++P + +V+                          P   Q +  G TV+  D+D        L+L   N+ + W KP +                          A  ++ P  L                          G  +M G   G +D+  +K ++ G+     Q   + + + +   +EN        +S++YG S ++N++++ V P   A+    GL++LV A++ ++   DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW++  ++GV
Sbjct:  495 ELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMD---QSDIETIRSLKDAMAQHETSSEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYSGQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQMAPDTSCVLFTVGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGKPQSG------------------------GASPTEQPLGL--------------------------GQTVMAGLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENG-------LSLLYGLSTTDNRLLHFVAPNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNM-GTAGV 1041          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:101164102])

HSP 1 Score: 270.396 bits (690), Expect = 1.012e-71
Identity = 141/302 (46.69%), Postives = 194/302 (64.24%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGK--IFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S +++     K  I   D   +++   LTRN         +   ++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DN   +      N + + +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+ VLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE ++RSAF  S  PVILSIENHCSLPQQ+KMA+IF  VFGE+LVTR
Sbjct: 1176 STMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTR 1477          

HSP 2 Score: 243.432 bits (620), Expect = 1.481e-63
Identity = 126/355 (35.49%), Postives = 206/355 (58.03%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            ++ QI   LS+LV+Y QAVK   L+  S   +++   +G  ++ +        +    + S + +   G    S++L+    Q+  ++               P         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+ FW  GIQ+VALNYQT+D ++++N A+F  +  CGYVLKPAV+W++   L+ +F P E++ E + P   ++ ++SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP WSE F F + F +L F+RFAV++ NS+    Q+  P+  LK G+RH+ L++Q    N+  +V++LF++    D+
Sbjct: 1623 ESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG---SSERLSWEEQQTSPVLNP-------------PTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGYRHVQLRTQH---NESLEVSSLFIYSRRTDE 1958          

HSP 3 Score: 196.438 bits (498), Expect = 2.685e-49
Identity = 147/605 (24.30%), Postives = 263/605 (43.47%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS-----------------------VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL---PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVD--------------------------PHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDG-QSGFIDIFTIKQIYYGNGR---QLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGV 6565
            EL EL  LIQFPEE+A +L + E +L+Q + P  Y+ +++ DL S                        P+    V +L+ R  EVSSW+T L++T  T EE++ +FS +V +    + +GN+N V+E LAGL+S K+   W  +    ++++  I  L + +   E +  Y+ V+ RAL I    V+PF G+FL +L   ++ T +I+ L   P N    V  +SD++G+  F++R G  GL    K   V  +L I+   +     +                 ++ S  D +  +F       + D+ +    + ++P + +V+                          P   Q +  G TV+  D+D        L+L   N+ + W KP +                          A  ++ P  L                          G  +M G   G +D+  +K ++ G+     Q   + + + +   +EN        +S++YG S ++N++++ V P   A+    GL++LV A++ ++   DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW++  ++GV
Sbjct:  495 ELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMD---QSDIETIRSLKDAMAQHETSSEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYSGQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQFT------VGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGKPQSG------------------------GASPTEQPLGL--------------------------GQTVMAGLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENG-------LSLLYGLSTTDNRLLHFVAPNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNM-GTAGV 1032          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:101164102])

HSP 1 Score: 270.396 bits (690), Expect = 1.012e-71
Identity = 141/302 (46.69%), Postives = 194/302 (64.24%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGK--IFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S +++     K  I   D   +++   LTRN         +   ++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DN   +      N + + +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+ VLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE ++RSAF  S  PVILSIENHCSLPQQ+KMA+IF  VFGE+LVTR
Sbjct: 1176 STMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTR 1477          

HSP 2 Score: 243.432 bits (620), Expect = 1.481e-63
Identity = 126/355 (35.49%), Postives = 206/355 (58.03%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            ++ QI   LS+LV+Y QAVK   L+  S   +++   +G  ++ +        +    + S + +   G    S++L+    Q+  ++               P         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+ FW  GIQ+VALNYQT+D ++++N A+F  +  CGYVLKPAV+W++   L+ +F P E++ E + P   ++ ++SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP WSE F F + F +L F+RFAV++ NS+    Q+  P+  LK G+RH+ L++Q    N+  +V++LF++    D+
Sbjct: 1623 ESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG---SSERLSWEEQQTSPVLNP-------------PTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGYRHVQLRTQH---NESLEVSSLFIYSRRTDE 1958          

HSP 3 Score: 196.438 bits (498), Expect = 2.685e-49
Identity = 147/605 (24.30%), Postives = 263/605 (43.47%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS-----------------------VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL---PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVD--------------------------PHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDG-QSGFIDIFTIKQIYYGNGR---QLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGV 6565
            EL EL  LIQFPEE+A +L + E +L+Q + P  Y+ +++ DL S                        P+    V +L+ R  EVSSW+T L++T  T EE++ +FS +V +    + +GN+N V+E LAGL+S K+   W  +    ++++  I  L + +   E +  Y+ V+ RAL I    V+PF G+FL +L   ++ T +I+ L   P N    V  +SD++G+  F++R G  GL    K   V  +L I+   +     +                 ++ S  D +  +F       + D+ +    + ++P + +V+                          P   Q +  G TV+  D+D        L+L   N+ + W KP +                          A  ++ P  L                          G  +M G   G +D+  +K ++ G+     Q   + + + +   +EN        +S++YG S ++N++++ V P   A+    GL++LV A++ ++   DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW++  ++GV
Sbjct:  495 ELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMD---QSDIETIRSLKDAMAQHETSSEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYSGQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQFT------VGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGKPQSG------------------------GASPTEQPLGL--------------------------GQTVMAGLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENG-------LSLLYGLSTTDNRLLHFVAPNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNM-GTAGV 1032          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:101164102])

HSP 1 Score: 270.396 bits (690), Expect = 1.012e-71
Identity = 141/302 (46.69%), Postives = 194/302 (64.24%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGK--IFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S +++     K  I   D   +++   LTRN         +   ++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DN   +      N + + +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+ VLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE ++RSAF  S  PVILSIENHCSLPQQ+KMA+IF  VFGE+LVTR
Sbjct: 1176 STMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTR 1477          

HSP 2 Score: 243.432 bits (620), Expect = 1.481e-63
Identity = 126/355 (35.49%), Postives = 206/355 (58.03%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            ++ QI   LS+LV+Y QAVK   L+  S   +++   +G  ++ +        +    + S + +   G    S++L+    Q+  ++               P         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+ FW  GIQ+VALNYQT+D ++++N A+F  +  CGYVLKPAV+W++   L+ +F P E++ E + P   ++ ++SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP WSE F F + F +L F+RFAV++ NS+    Q+  P+  LK G+RH+ L++Q    N+  +V++LF++    D+
Sbjct: 1623 ESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG---SSERLSWEEQQTSPVLNP-------------PTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGYRHVQLRTQH---NESLEVSSLFIYSRRTDE 1958          

HSP 3 Score: 196.438 bits (498), Expect = 2.685e-49
Identity = 147/605 (24.30%), Postives = 263/605 (43.47%), Query Frame = 2
Query: 4928 ELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS-----------------------VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILIL---PSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVD--------------------------PHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDG-QSGFIDIFTIKQIYYGNGR---QLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGV 6565
            EL EL  LIQFPEE+A +L + E +L+Q + P  Y+ +++ DL S                        P+    V +L+ R  EVSSW+T L++T  T EE++ +FS +V +    + +GN+N V+E LAGL+S K+   W  +    ++++  I  L + +   E +  Y+ V+ RAL I    V+PF G+FL +L   ++ T +I+ L   P N    V  +SD++G+  F++R G  GL    K   V  +L I+   +     +                 ++ S  D +  +F       + D+ +    + ++P + +V+                          P   Q +  G TV+  D+D        L+L   N+ + W KP +                          A  ++ P  L                          G  +M G   G +D+  +K ++ G+     Q   + + + +   +EN        +S++YG S ++N++++ V P   A+    GL++LV A++ ++   DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW++  ++GV
Sbjct:  495 ELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMD---QSDIETIRSLKDAMAQHETSSEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYSGQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQFT------VGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGKPQSG------------------------GASPTEQPLGL--------------------------GQTVMAGLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENG-------LSLLYGLSTTDNRLLHFVAPNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNM-GTAGV 1032          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plce1 (phospholipase C epsilon 1 [Source:NCBI gene;Acc:101164102])

HSP 1 Score: 269.626 bits (688), Expect = 1.492e-71
Identity = 141/302 (46.69%), Postives = 194/302 (64.24%), Query Frame = 2
Query: 7019 SYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGK--IFQKDFNYENEQFYLTRNYP-------STTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLT--EIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFL-KGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTR 7888
            S ++FI+F  LF+SF I SR D+K++FD  +   S S +++     K  I   D   +++   LTRN         +   ++  Q+ ++ A+A ASIV N +G E +   ++ L   ++ + L   Q E    ++   II+K E    +R  G MS+EGFA +LMD+DN   +      N + + +PLS+Y+I SSHNTYL+GHQ+ GESSVE+Y+ VLL GCR +ELDCWDG+DG PVIYHGHT T KI F+ VVE ++RSAF  S  PVILSIENHCSLPQQ+KMA+IF  VFGE+LVTR
Sbjct: 1095 STMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTR 1396          

HSP 2 Score: 243.047 bits (619), Expect = 1.951e-63
Identity = 126/355 (35.49%), Postives = 206/355 (58.03%), Query Frame = 2
Query: 8453 KASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDD 9517
            ++ QI   LS+LV+Y QAVK   L+  S   +++   +G  ++ +        +    + S + +   G    S++L+    Q+  ++               P         P  + I+SVNE+ AK +CRR    LI H   QL+RTYPA  R+DS+N NP+ FW  GIQ+VALNYQT+D ++++N A+F  +  CGYVLKPAV+W++   L+ +F P E++ E + P   ++ ++SGQN+   N SGSP +E++++G+ +D    +T+PI RN +NP WSE F F + F +L F+RFAV++ NS+    Q+  P+  LK G+RH+ L++Q    N+  +V++LF++    D+
Sbjct: 1534 ESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG---SSERLSWEEQQTSPVLNP-------------PTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGYRHVQLRTQH---NESLEVSSLFIYSRRTDE 1869          

HSP 3 Score: 189.889 bits (481), Expect = 2.671e-47
Identity = 147/613 (23.98%), Postives = 263/613 (42.90%), Query Frame = 2
Query: 4922 AAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSS-----------------------VPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSC---VSDFNGEDKFISRIGVGGLINMNK---VKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVD--------------------------PHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQS-------GFIDIFTIKQIYYGNGR---QLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGV 6565
            + EL EL  LIQFPEE+A +L + E +L+Q + P  Y+ +++ DL S                        P+    V +L+ R  EVSSW+T L++T  T EE++ +FS +V +    + +GN+N V+E LAGL+S K+   W  +    ++++  I  L + +   E +  Y+ V+ RAL I    V+PF G+FL +L   ++ T   L+  S       C   +SD++G+  F++R G  GL    K   V  +L I+   +     +                 ++ S  D +  +F       + D+ +    + ++P + +V+                          P   Q +  G TV+  D+D        L+L   N+ + W +P                            +P S  P                       G A+ T   L  GQ+       G +D+  +K ++ G+     Q   + + + +   +EN        +S++YG S ++N++++ V P   A+    GL++LV A++ ++   DQ++ WL+  Y+ L+      +  TLA+  + FGGRRW++  ++GV
Sbjct:  455 SKELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMD---QSDIETIRSLKDAMAQHETSSEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTAKSLLQLSKTRMFCRCFQFMSDYSGQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQF------TVGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGRPQP--------------------------SPTSGKP---------------------QSGGASPTEQPLGLGQTVMAGLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENG-------LSLLYGLSTTDNRLLHFVAPNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNM-GTAGV 1003          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000070741.1 (SMESG000070741.1)

HSP 1 Score: 4229.48 bits (10968), Expect = 0.000e+0
Identity = 2234/2236 (99.91%), Postives = 2236/2236 (100.00%), Query Frame = 2
Query: 4073 RLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMXXXXXXXXXXXXNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQIXXXXXXXXXXXXXXXXXXNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISDNPRYRTYSCPTKYVSKINLPKQQSCPTDSKHSVIQSISQPPLGNLSGKLQKLSHFISGKK 10780
            +LKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK+RPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISDNPRYRTYSCPTKYVSKINLPKQQSCPTDSKHSVIQSISQPPLGNLSGKLQKLSHFISGKK
Sbjct:    9 KLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKTRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISDNPRYRTYSCPTKYVSKINLPKQQSCPTDSKHSVIQSISQPPLGNLSGKLQKLSHFISGKK 2244          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000070741.1 (SMESG000070741.1)

HSP 1 Score: 4155.13 bits (10775), Expect = 0.000e+0
Identity = 2198/2199 (99.95%), Postives = 2199/2199 (100.00%), Query Frame = 2
Query: 4004 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMXXXXXXXXXXXXNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQIXXXXXXXXXXXXXXXXXXNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 10600
            ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK+RPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD
Sbjct:    9 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKTRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 2207          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000070741.1 (SMESG000070741.1)

HSP 1 Score: 4154.36 bits (10773), Expect = 0.000e+0
Identity = 2198/2199 (99.95%), Postives = 2199/2199 (100.00%), Query Frame = 2
Query: 4004 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMXXXXXXXXXXXXNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQIXXXXXXXXXXXXXXXXXXNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 10600
            ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK+RPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD
Sbjct:    2 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKTRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 2200          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000070741.1 (SMESG000070741.1)

HSP 1 Score: 4152.44 bits (10768), Expect = 0.000e+0
Identity = 2198/2199 (99.95%), Postives = 2199/2199 (100.00%), Query Frame = 2
Query: 4004 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDXXXXXXXXXXXXMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCXXXXXXXXXXXXXWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSEXXXXXXXXXXMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFXXXXXXXXXXXXXGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRXXXXXXXXXXXXXXXXNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMXXXXXXXXXXXXNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQIXXXXXXXXXXXXXXXXXXNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVXXXXXXXXGLNIKSDQLTHLNVQSLSMIGIXXXXXXXXXXXXYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDXXXXXXXXXXXXXXXXXXXXXXXXLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGXXXXXXXXXXXXXILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 10600
            ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSK+RPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD
Sbjct:    9 ISTNKVSKPDGQETYESTNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQMNSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENERKKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLYMKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKILIRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWEVLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGLIQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLITRLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILAGLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALKISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKFISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMKNKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMGTTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNSTKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYILMDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISIIYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLKNDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYASTFTSKTRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIRSRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSADYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHLFRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFYLTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNILQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLKGTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGCRCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVILSIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKYRILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDEDEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKKKDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNINTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTNQKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQSLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRRIPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYLTIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWSETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQFVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAISSLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCENENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPRLIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEEEYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLALAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSECVYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDERSSKSKEIPSVTSTKELEEEQSTSGLTPPQISD 2207          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000070728.1 (SMESG000070728.1)

HSP 1 Score: 2303.86 bits (5969), Expect = 0.000e+0
Identity = 1327/1335 (99.40%), Postives = 1332/1335 (99.78%), Query Frame = 2
Query:    2 RHIIQNVRISSFDFCKRVSILPLPDRIKCFQVLTLAILTNTINQENKQFLSPALFLGIYKANLCTVRLMLSESIMQSLQSRDCFGNTAAHICCLC*SLESMDLFEWXXXXXXXXXXXXXXAMLKLIITNGFRLGKQNRFNLKPVDIYPDIWTDLNKILKSLITFGNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKENNNKSDSQSFSVEMERTSSTSSNKVGSKEKESFVATERRQSNFSRKFSFKEKAQRSRDLSFRMRYEDAESSLKTMIVLAKNPECLTQIIDGIDGFISMVISISQQANEEELESLISQLFNQIIKTISGKLRDCPNNSSQAYVYMLQMTQLLDTSMDLLRQKQYIHYTALTIINKLLDLCFMNSVYEYVNIESCDIEKDLSEREMPGMGNVKSNLXXXXXXXXXXXXXXXRRQSVVNVINNIRSTGTKIIGSFEGGSLKAKGQXXXXXXXXXXXXXXPAANESDNSRIMDENRTLYRRILIERINQADPGIILSVLHNRITMQKRTLGYRVKCSPSTRMRSCVSHCIQILSARMLTVMAQSSRVQRRLFTDGHFKTLVDAXXXXXXXXXXXXXXXXXATIALDPTYHKALLLTMIEDNLLHLILPSDEWYYTNYSTKYSPYVKYHASRILVYLGKFHCLAGRFDLFNSSVFDFMHGAGNFLTDNLEDVFIHNMAMGKHMIHRGDMALIGCSVESLIRMLLEDHGSTVDYIQVPEQFTKLFSFLGSDEVHFKCILTDRLREALIMVLPAIIHPLIIIRLLNHRLFGRSYKKKIRHLSTKQSICSSTVIENNNIENPGGKKVNMRESNIMNIDSNETKIELQNNGKYNQEKYSIASDFPNIETRRPSFIYYETLKAEASGFKVICPWEGVVNSSYLEKGKKERKSKEIQRERSIDDSLLGLHNEKSIVESILEKNSKRFAKWRSSIKKKNKHVEEDTVLLEVDRGKKQKAIIVEKELLDLQRELVNLPKISLDPSHGDXXXXXXXXXXXXXXXXXXXXXEITPIGSFLINSSHEIPSIVTNDQDIGMNPINYMTELCRDHSLPEIFISPSLPNDANDLFRTVDVNTTNDDIHIKRIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKDKLTSSKTPQSNQSTMSLPIEMKIKQFRNTSLSSNSSNERPRSLLFLSENNANKSPTKMKDINTFSNMPPIKKSEFDSMSIQRPTSPNFSLGNESSIPESNFCYATKPCQVARNSGDIPNLQFSAMQLIDTWLHMSLIDFSLIRDDIKEFLTRLSTQGTDQRLWCQNIWSFLKSRI 4006
            RHIIQNVRISSFDFCKRVSILPLPDRIKCFQVLTLAILTNTIN ENKQFLSPALFLGIYKANLCTVRLMLSESIMQSLQSRDCFGNTAAHICCLC SLESMDLFEWNNITVNSNNTNNNNAMLKLIITNGFRLGKQNRFNLKPVDIYPDIWTDLNKILKSLITFGNLRLNSDRNSDSFNRDSSSKKQNQSQNRSKSRSNKTNKNNNSDQKSSSSGKDRKTKENNNKSDSQSFSVEMERTSSTSSNKVGSKEKESFVATERRQSNFSRKFSFKEKAQRSRDLSFRMRYEDAESSLKTMIVLAKNPECLTQIIDGID FISMVISISQQANEEELESLISQLFNQIIKTISGKLRDCPNNSSQAYVYMLQMTQLLDTSMDLLRQKQYIHYTALTIINKLLDLCFMNSVYEYVNIESCDIEKDLSEREMPGMGNVKSNLNNSHTNITPTTTTHNRRQSVVNVINNIRSTGTKIIGSFEGGSLKAKGQNGNNNTNTSTININPAANESDNSRI+DENRTLYRRILIERINQADPGIILSVLHNRITMQKRTLGYRVKCSPSTRMRSCVSHCIQILSARMLTVMAQSSRVQRRLFTDGHFKTLVDALDPNHDPHLLCLLLQCLATIALDPTYHKALLLTMIEDNLLHLILPSDEWYYTNYSTKYSPYVKYHASRILVYLGKFHCLAGRFDLFNSSVFDFMHGAGNFLTDNLEDVFIHNMAMGKHMIHRGDMALIGCSVESLIR+LLEDHGSTVDYIQVPEQFTKLFSFLGSDEVHFKCILTDRLREALIMVLPAIIHPLIIIRLLNHRLFGRSYKKKIRHLSTKQSICSSTVIENNNIENPGGKKVNMRESNIMNIDSNETKIELQNNGKYNQEKYSIASDFPNIETRRPSFIYYETLKAEASGFKVICPWEGVVNSSYLEKGKKERKSKEIQRERSIDDSLLGLHNEKSIVESILEKNSKRFAKWRSSIKKKNKHVEE+TVLLEVDRGKKQKAIIVEKELLDLQRELVNLPKISLDPSHGDSRSASPSLLLSRSNSLPNVNSEITPIGSFLINSSHEIPSIVTNDQDIGMNPINYMTELCRDHSLPEIFISPSLPNDANDLFRTVDVNTTNDDIHIKRIDSESSSKSISTLSTSNASVHSDSEKSKVSSVNKRSKKKVSQSMKDKLTSSKTPQSNQSTMSLPIEMKIKQFRNTSLSSNSSNERPRSLLFLSENNANKSPTKMKDINTFSNMPPIKKSEFDSMSIQRPTSPNFSLGNESSIPESNFCYATKPCQVARNSGDIPNLQFSAMQLIDTWLHMSLIDFSLIRDDIKEFLTRLSTQG+DQRLWCQNIWSFLKSR+
Sbjct:  346 RHIIQNVRISSFDFCKRVSILPLPDRIKCFQVLTLAILTNTINHENKQFLSPALFLGIYKANLCTVRLMLSESIMQSLQSRDCFGNTAAHICCLCKSLESMDLFEWNNITVNSNNTNNNNAMLKLIITNGFRLGKQNRFNLKPVDIYPDIWTDLNKILKSLITFGNLRLNSDRNSDSFNRDSSSKKQNQSQNRSKSRSNKTNKNNNSDQKSSSSGKDRKTKENNNKSDSQSFSVEMERTSSTSSNKVGSKEKESFVATERRQSNFSRKFSFKEKAQRSRDLSFRMRYEDAESSLKTMIVLAKNPECLTQIIDGIDSFISMVISISQQANEEELESLISQLFNQIIKTISGKLRDCPNNSSQAYVYMLQMTQLLDTSMDLLRQKQYIHYTALTIINKLLDLCFMNSVYEYVNIESCDIEKDLSEREMPGMGNVKSNLNNSHTNITPTTTTHNRRQSVVNVINNIRSTGTKIIGSFEGGSLKAKGQNGNNNTNTSTININPAANESDNSRILDENRTLYRRILIERINQADPGIILSVLHNRITMQKRTLGYRVKCSPSTRMRSCVSHCIQILSARMLTVMAQSSRVQRRLFTDGHFKTLVDALDPNHDPHLLCLLLQCLATIALDPTYHKALLLTMIEDNLLHLILPSDEWYYTNYSTKYSPYVKYHASRILVYLGKFHCLAGRFDLFNSSVFDFMHGAGNFLTDNLEDVFIHNMAMGKHMIHRGDMALIGCSVESLIRILLEDHGSTVDYIQVPEQFTKLFSFLGSDEVHFKCILTDRLREALIMVLPAIIHPLIIIRLLNHRLFGRSYKKKIRHLSTKQSICSSTVIENNNIENPGGKKVNMRESNIMNIDSNETKIELQNNGKYNQEKYSIASDFPNIETRRPSFIYYETLKAEASGFKVICPWEGVVNSSYLEKGKKERKSKEIQRERSIDDSLLGLHNEKSIVESILEKNSKRFAKWRSSIKKKNKHVEEETVLLEVDRGKKQKAIIVEKELLDLQRELVNLPKISLDPSHGDSRSASPSLLLSRSNSLPNVNSEITPIGSFLINSSHEIPSIVTNDQDIGMNPINYMTELCRDHSLPEIFISPSLPNDANDLFRTVDVNTTNDDIHIKRIDSESSSKSISTLSTSNASVHSDSEKSKVSSVNKRSKKKVSQSMKDKLTSSKTPQSNQSTMSLPIEMKIKQFRNTSLSSNSSNERPRSLLFLSENNANKSPTKMKDINTFSNMPPIKKSEFDSMSIQRPTSPNFSLGNESSIPESNFCYATKPCQVARNSGDIPNLQFSAMQLIDTWLHMSLIDFSLIRDDIKEFLTRLSTQGSDQRLWCQNIWSFLKSRV 1680          
The following BLAST results are available for this feature:
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCE13.389e-6337.89phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:... [more]
PLCE15.551e-6337.89phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:... [more]
PLCE15.551e-6337.89phospholipase C epsilon 1 [Source:HGNC Symbol;Acc:... [more]
PLCB42.707e-4952.22phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB42.707e-4952.22phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plc-11.578e-6933.951-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plc-12.584e-6732.941-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plc-12.702e-6732.941-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plc-12.765e-6733.391-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plc-12.909e-6733.391-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
norpA1.942e-4449.75gene:FBgn0262738 transcript:FBtr0070651[more]
norpA1.942e-4449.75gene:FBgn0262738 transcript:FBtr0301475[more]
norpA1.942e-4449.75gene:FBgn0262738 transcript:FBtr0070650[more]
norpA2.152e-4449.75gene:FBgn0262738 transcript:FBtr0343599[more]
norpA2.152e-4449.75gene:FBgn0262738 transcript:FBtr0100670[more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plce11.108e-7447.68phospholipase C, epsilon 1 [Source:ZFIN;Acc:ZDB-GE... [more]
plce18.113e-7347.68phospholipase C, epsilon 1 [Source:ZFIN;Acc:ZDB-GE... [more]
plcd1b1.711e-5043.29phospholipase C, delta 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
plcg15.108e-4854.70phospholipase C, gamma 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
plch2a7.816e-4851.81phospholipase C, eta 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gla1.401e-8934.18galactosidase alpha [Source:Xenbase;Acc:XB-GENE-10... [more]
gla1.498e-8835.32galactosidase alpha [Source:Xenbase;Acc:XB-GENE-10... [more]
gla2.488e-8835.49galactosidase alpha [Source:Xenbase;Acc:XB-GENE-10... [more]
gla3.003e-8835.82galactosidase alpha [Source:Xenbase;Acc:XB-GENE-10... [more]
gla2.877e-7348.18galactosidase alpha [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plce16.692e-12430.15phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:... [more]
Plce17.078e-12430.15phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:... [more]
Plce17.078e-12430.15phospholipase C, epsilon 1 [Source:MGI Symbol;Acc:... [more]
Plcg17.021e-5146.22phospholipase C, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Plcb43.644e-5052.71phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99P84|PLCE1_RAT8.296e-12630.661-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q8K4S1|PLCE1_MOUSE4.951e-12330.151-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|G5EFI8|PLCE1_CAEEL2.783e-6633.391-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q9P212|PLCE1_HUMAN1.628e-6237.891-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q15147|PLCB4_HUMAN1.300e-4852.221-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087TCF50.000e+034.47Phosphoinositide phospholipase C (Fragment) OS=Ste... [more]
A0A210QRR52.875e-10437.80Phosphoinositide phospholipase C OS=Mizuhopecten y... [more]
A0A2C9KBQ69.554e-11938.53Phosphoinositide phospholipase C OS=Biomphalaria g... [more]
A0A2C9KBQ51.234e-11838.53Phosphoinositide phospholipase C OS=Biomphalaria g... [more]
A0A0A9XDT70.000e+035.63Phosphoinositide phospholipase C (Fragment) OS=Lyg... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plce17.758e-7227.46phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce17.828e-7227.46phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce11.331e-7128.27phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
PLCB41.647e-5254.63phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
PLCB41.737e-5254.63phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003967.12.370e-8335.62pep scaffold:Pmarinus_7.0:GL481506:613:30747:-1 ge... [more]
ENSPMAT00000003976.11.929e-6657.41pep scaffold:Pmarinus_7.0:GL481506:4575:23311:-1 g... [more]
ENSPMAT00000003983.12.374e-6662.24pep scaffold:Pmarinus_7.0:GL481506:4806:23311:-1 g... [more]
ENSPMAT00000004386.16.012e-5354.30pep scaffold:Pmarinus_7.0:GL496322:1097:3585:1 gen... [more]
plcd3b4.748e-4945.62phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PLC11.940e-3039.71Phospholipase C; hydrolyzes phosphatidylinositol 4... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438137.270e-4950.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289634.736e-4747.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480441.033e-4647.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465466.120e-4649.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315566.157e-4649.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plce18.744e-7246.69phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce11.012e-7146.69phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce11.012e-7146.69phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce11.012e-7146.69phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
plce11.492e-7146.69phospholipase C epsilon 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070741.10.000e+099.91SMESG000070741.1[more]
SMESG000070741.10.000e+099.95SMESG000070741.1[more]
SMESG000070741.10.000e+099.95SMESG000070741.1[more]
SMESG000070741.10.000e+099.95SMESG000070741.1[more]
SMESG000070728.10.000e+099.40SMESG000070728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011750 ID=SMED30011750|Name=Phosphoinositide phospholipase C|organism=Schmidtea mediterranea sexual|type=transcript|length=11070bp
TCGACATATTATTCAAAACGTCAGAATAAGTTCTTTTGACTTTTGTAAAC
GGGTTTCTATTCTTCCTCTTCCAGACCGCATAAAATGTTTCCAGGTTCTT
ACTTTAGCCATCTTAACTAACACCATTAATCAGGAAAATAAACAATTTCT
GTCGCCGGCTTTATTTTTGGGAATTTATAAAGCTAATCTATGTACAGTTC
GTCTAATGCTCTCTGAATCTATAATGCAGAGTCTCCAGTCGAGAGACTGT
TTCGGCAATACTGCTGCTCATATTTGCTGTTTATGTTAGTCTCTAGAATC
TATGGACCTTTTTGAATGGAACAATATCACAGTTAATAGTAATAATACTA
ATAACAATAATGCCATGTTGAAATTGATAATTACAAATGGCTTTCGTTTG
GGTAAACAAAATAGATTCAATTTGAAACCGGTTGACATTTATCCTGATAT
TTGGACTGATTTGAATAAAATTTTAAAAAGTCTCATAACGTTCGGAAATT
TAAGATTGAATTCTGACAGAAATTCTGACAGTTTTAATCGAGATTCATCA
TCGAAGAAACAAAACCAATCGCAAAATCGAAGCAAATCTCGGTCTAATAA
AACAAACAAAAACAATAATTCTGATCAAAAATCGAGTTCGTCTGGGAAGG
ATAGGAAAACAAAAGAAAACAACAATAAAAGCGATTCTCAATCGTTTTCC
GTTGAAATGGAACGCACGTCATCTACTTCTTCAAATAAAGTAGGATCGAA
AGAAAAAGAATCTTTTGTCGCCACTGAAAGAAGACAGTCAAACTTTTCGA
GAAAATTCAGCTTCAAAGAAAAAGCTCAAAGATCAAGAGATCTGTCATTT
CGAATGAGGTATGAAGATGCGGAATCATCATTGAAAACAATGATAGTTTT
AGCGAAAAATCCTGAATGTCTAACACAGATAATTGATGGAATAGACGGCT
TCATTTCCATGGTTATTTCCATTAGCCAGCAAGCAAATGAGGAAGAGCTA
GAATCACTCATAAGTCAACTTTTCAATCAAATTATCAAAACAATATCAGG
GAAGCTTCGTGACTGCCCTAACAACAGTTCCCAGGCATACGTTTATATGC
TTCAAATGACACAACTGTTAGACACCTCAATGGATCTTTTGAGGCAAAAA
CAATACATTCACTATACTGCTCTTACAATAATCAACAAGCTTCTTGATCT
TTGCTTTATGAATTCTGTGTATGAGTATGTCAACATCGAAAGTTGTGATA
TTGAAAAGGACTTATCGGAAAGAGAAATGCCTGGAATGGGAAATGTTAAA
TCTAATCTTAACAATAGTCACACAAATATAACTCCAACAACTACTACTCA
TAACCGAAGACAATCGGTTGTCAACGTTATTAACAACATTCGAAGTACTG
GCACAAAAATAATAGGCTCATTCGAGGGTGGATCTTTGAAGGCAAAAGGT
CAAAACGGCAACAATAACACAAATACATCAACTATAAATATAAATCCAGC
TGCCAATGAATCTGATAACAGTCGAATTATGGATGAAAATCGTACATTGT
ATAGAAGAATATTGATAGAGAGAATAAATCAAGCTGACCCTGGAATAATT
TTAAGTGTGCTCCATAACCGAATTACAATGCAGAAAAGAACACTTGGCTA
TCGAGTAAAATGTTCTCCAAGTACTCGAATGCGATCTTGCGTCAGTCATT
GCATTCAAATATTAAGTGCAAGAATGTTAACAGTCATGGCTCAATCCAGC
CGAGTCCAAAGAAGATTGTTTACGGATGGTCATTTTAAAACTCTAGTAGA
TGCACTTGACCCTAACCATGATCCACATTTATTATGTTTATTATTGCAAT
GCTTGGCTACAATAGCTTTGGATCCAACATATCATAAGGCTCTTTTGCTT
ACAATGATTGAAGACAATTTGCTCCATTTGATTCTCCCTTCAGATGAATG
GTATTATACCAATTATTCTACTAAATATTCTCCGTATGTTAAGTATCATG
CATCACGGATTCTTGTTTATTTGGGAAAGTTTCATTGTTTAGCTGGACGA
TTTGATTTGTTTAATAGTTCTGTTTTTGATTTTATGCACGGAGCTGGCAA
TTTTCTGACAGATAACCTTGAAGATGTTTTTATTCACAATATGGCAATGG
GTAAACACATGATTCATAGAGGTGATATGGCACTTATCGGATGTTCAGTA
GAATCCTTAATTAGAATGTTATTAGAAGATCATGGTTCTACTGTCGATTA
CATTCAAGTTCCTGAGCAATTTACAAAACTCTTTTCGTTTCTAGGTTCTG
ACGAAGTCCACTTTAAATGTATCTTAACCGATCGTCTTCGAGAAGCCTTA
ATAATGGTTTTACCAGCCATTATACATCCATTAATTATTATTAGATTATT
AAATCATCGGTTATTTGGTAGATCATACAAAAAGAAGATTCGACACTTAT
CCACTAAACAGTCTATATGCAGTTCAACTGTAATCGAAAATAACAATATT
GAAAATCCTGGAGGAAAAAAAGTAAATATGAGGGAATCAAATATCATGAA
TATAGATTCGAACGAAACAAAAATCGAGTTGCAAAATAATGGTAAATATA
ATCAAGAGAAATATTCAATTGCAAGCGACTTTCCCAACATAGAGACTAGA
CGACCTTCTTTTATTTATTATGAAACACTGAAAGCGGAAGCTTCTGGATT
TAAGGTAATCTGTCCTTGGGAAGGTGTGGTCAATAGCAGTTATTTAGAAA
AAGGTAAAAAGGAGAGAAAATCTAAGGAAATCCAAAGAGAAAGATCGATA
GACGATTCTTTATTAGGTTTACATAATGAAAAATCAATTGTTGAAAGTAT
TTTAGAAAAGAATTCTAAAAGATTTGCAAAATGGCGTTCAAGCATAAAAA
AGAAAAATAAGCACGTCGAAGAAGATACAGTGCTTTTGGAAGTAGACCGA
GGAAAAAAACAAAAAGCCATAATTGTTGAAAAGGAATTATTGGATCTTCA
AAGAGAGCTGGTTAATTTACCGAAAATTTCTCTTGACCCATCGCATGGGG
ATTCAAGGTCTGCCTCACCTTCTCTTCTTTTATCTAGATCAAATTCTTTA
CCAAATGTCAATTCAGAAATTACTCCAATTGGAAGCTTTTTGATTAACAG
TTCACACGAAATTCCCAGTATTGTTACAAATGATCAAGATATTGGCATGA
ATCCGATCAATTATATGACAGAATTGTGTAGGGATCACAGCTTGCCTGAA
ATCTTTATATCTCCTTCATTACCGAATGATGCGAATGATTTGTTTAGGAC
AGTTGATGTTAACACCACAAACGACGATATTCATATCAAACGTATAGATT
CTGAGTCTAGTAGCAAGAGTATTTCTACGTTATCAACTTCTAATGCAAGT
GTTCATTCTGATTCAGAAAAATCTAAAGTTTCTAGCGTCAATAAACGCTC
TAAGAAAAAGGTTTCTCAATCAATGAAAGACAAACTGACCTCTTCTAAAA
CACCCCAATCAAATCAAAGCACAATGAGCTTACCAATCGAAATGAAAATA
AAACAATTTCGAAATACTTCACTTTCGTCTAACAGCAGTAACGAAAGACC
TAGGTCATTGTTATTCTTGTCAGAAAATAATGCGAATAAATCACCCACTA
AAATGAAGGATATTAATACTTTTAGTAACATGCCACCGATTAAAAAGTCT
GAATTTGATTCTATGTCTATTCAAAGACCTACAAGTCCAAACTTTTCTTT
GGGCAATGAAAGCTCTATTCCTGAGAGCAATTTTTGTTACGCAACAAAAC
CTTGTCAAGTTGCTAGAAATTCAGGCGATATCCCAAATTTACAGTTTTCT
GCGATGCAATTAATTGACACATGGCTACATATGAGTTTGATTGACTTTTC
CTTGATTCGAGATGATATCAAAGAATTTCTTACAAGACTTTCTACACAAG
GAACAGATCAAAGACTTTGGTGTCAAAATATTTGGTCTTTTCTCAAATCA
AGAATCAGCACTAACAAAGTCTCAAAGCCTGACGGGCAAGAAACTTACGA
ATCCACAAACATTGAGTATAAACGATTGAAACAACTCGTAACATCTGGAG
ACCTTCCATGCACCAAAGACGATGCGGCCACATTGGCAGCAGTGCACATG
CATATAGATAATTCATGGCCTGAAACAGATGCTGGGCCATCAAATCAAAT
GAATTCTTTATTCCCTGATAGCAATAAATCTTTATCCTATTTAACTAAAA
AGATGGCTCACTCCAGATTGACAAGCAGTAGAATGAGATCACGAAAGCCC
TTTCGAATGATGCATCAATTTTCTTGTGTTTCTGACAAGGAAAATGAAAG
GAAAAAACGAGAAATTAAGAGAATGCTAGCAAAATACATTCCACCAGAAT
ATCACGATTCCAAAAAAACTCATGAACTTATAAAGGAAAAATATAAAAAA
CTGTGGCATACACCTTTCTACGAGAGTGAAATCAAATTAAAGCAATTGTA
TATGAAGCTTTGTAAGAATCTCCCAGCCTATGGTTGTCGTTTATTTCAAG
TCCAAGAAATCCTAAGAGGCAATATTCATCAAAATGTGCTAAGAATCCTC
GGTGTCAGTCCTTCGAACATTACTTTAATCGATTACAAATCAAAAATTCT
CATCCGAAGTCAAACTGTTCAAGATTTTAAAAATTGGCATTTAAGTAGAA
ATTCTTCAGCATTTGAACTAGAATTCCGTGCAAGTAAACCATGGGTGTTA
AATTGCACATCAGAAAGTAGCATGCGCTCTTTGACATCTTCGTTATGGGA
AGTACTTGACTGCGATGGATCAAAGTCAGCTAAACCGGCTTTCAGGCGTA
GTAGCTTAGAATTTGATCTTCAAAATAAGCAAATCACCTTAAGACCCGAT
ATGGAAAACGGAATGGTGTACGCTGCTGAATTAGAAGAATTAATGGGATT
AATACAGTTTCCGGAAGAAGTAGCGTTAATGTTAGCTCAGACAGAATCGA
AATTATTTCAAGCATTACAACCTCAATCCTATGTAAGATATGTCAGTTTA
GACTTATCTTCAGTGCCTCAAGTTGATAAAGGAGTTTGGAATTTAATTAC
CCGACTTAAAGAAGTTAGTTCTTGGATTACGCATTTGATTATCACCCAAC
CTACTCACGAAGAACGAAAAAATATTTTTTCTTGTATTGTGAGATTGGTG
ATAATTAGTTATGGAATTGGTAATTTCAATGCGGTTGTCGAGATACTGGC
CGGTTTAAAGTCAGAAAAATTGAAACCGTTTTGGCTTACAATCAGTGATA
CTTGCAGGAATGAGTTGAGTATTATAGATCTTTTGTCCGAGCAGTTGCTC
AGCAAGGAACCGACAGAATCATATCGTTCCGTGGTAAACAGAGCATTGAA
GATCTCCAATACTGACGTGATTCCATTTTTTGGGTTGTTTTTGAGCCAAT
TAAAAATGATTGTTAATAAAACCCCAACAATTCTCATATTGCCTTCTAAT
GATGCTGCTGGTGTTTCGTGTGTTTCGGATTTTAACGGAGAAGACAAATT
TATTTCCAGAATCGGCGTCGGTGGACTCATCAATATGAATAAAGTTAAAG
AGGTTCTCACAATTTTAAATGATATATCAATGTTCCAAATGCACAATAGT
GAATCGTCTAAAATTGATAAAATTGACGACGACATGGATTATCCAATGAA
GAATAAATCTACAAATGATCCATTTTTTGAAGAGTTCTTTAAACCCTCTT
GCCGGCCAATTGTCGACATGATTAATATTTCCAATGTCGTAGTTATTCAA
CCGCGCTTGGCAAAGGTCGATCCTCACTGTCTTCAAATTATGCATATGGG
AACAACTGTGGTTAAACAGGATAAAGACTTACAAAAATGTGTTCCAGTAT
TTCTAAAACTCTCTTTGACAAATTCACTGATAATGTGGACAAAACCTACC
GCTAGAACTTCACAGTTTACTTCAACAAAAACCTCAAGTACCAACAATTC
AACGAAAGGTCCTCTGTTTTCTTTCTTGGATGCTCCTGACTCTAAATCTC
CGTTTCATCTTATACAGCAAACTAGATATACGATTCCTGGAAATTACTAT
TGTACAGATTCTACTACTATGGGCAGTGCTAATCAAACTGGGTATATTTT
GATGGATGGTCAAAGTGGATTTATTGACATCTTTACCATTAAACAAATAT
ATTACGGCAACGGAAGACAACTGGCAAACATATCTAGTATAATGCGTCGA
TTTGGTTACAAAGAAAATTATCCGCTTCCTGACCATTGCTGTATCAGTAT
TATATATGGATGTTCTGCCTCAGAAAATAAAATTATTAACATTGTTTTTC
CTACAATTAATGCAAAATATTGGTTGATTGGTTTAACTAAACTTGTTGCT
GCTGCCAAGCTTATTCGGAATAATGTTGATCAAAAAATGTTGTGGCTAAA
AAATGATTATTTGAGACTTTTCTACTCAAAAGATTTGGGACAAGCTTTAA
CTCTTGCAGAAATTACAAAAGCATTTGGTGGTCGCCGTTGGTCGGTTTCA
AATAGTTCGGGAGTAGTATCTGATCAAAGTTGTAGCACTTCCACATACGC
ATCAACATTTACGTCTAAAAGTAGACCTAAAACTAATAATAAATCGAAGA
AATCCGAACAACAACAAATATTTAATTTATTTAACAAAAGTGCATCAAAG
TTCAGTGATTCACAGAATTCCAGTCAAGTTCCAATTTCACCTCCAATCAG
ATCAAGAAGCCAAGAACAGATTTTAACATCATCTTCAAGTCATAATGGTA
TTTCGATGATTAACACTCCTTCCTATTTGAGACATTCGACTTTTTATTCT
TATGCTATGGCTAATTCTAATCGCCGTCAATCAACAAGAATGTTATCTGC
TGACTATGACTACCTTGAAATGTCTCCACTGGCTCTATCTGTGAAAGATT
CCATTAACAAACGGGTCAATTACCATGAACTACACAATATTAACACAACT
GAAGACATTACTCAGAAGAGCTATTTGAATTTCATAGATTTCTGTCATTT
ATTTCGAAGTTTTATCATTTACAGTCGGTTAGATATTAAGCAAATATTTG
ACCACCTTTCTACAAAAATATCTGAGTCAGATACGAAAAATAGCTCTAAT
ATTGGGAAAATATTTCAGAAAGATTTCAATTATGAAAATGAACAATTCTA
TCTAACAAGAAATTACCCAAGCACAACGAAATTAACATCGAAACAGAGAC
ATGTCACTGCTGCCGTAGCTGTGGCCAGTATTGTGAACAATTGTTCTGGT
TTCGAGAAATCGGAGAAAAGAATTATCCCTTTAACTGAAATTCAAAATAT
TCTTCAACAGTTCCAAGGTGAATCTGGTGATAAAGAAGATTGTTGGAAAA
TCATTGAAAAACATGAAGTGGATCCGGAATTACGGGCCCAAGGAATGATG
AGCTATGAAGGATTTGCTTGTTACTTAATGGACCAAGATAACTTTTTAAA
AGGAACACTTGATAACACTAATGATCAATCAATGGACCATCCTTTATCTC
ATTATTTTATCGCTTCATCTCACAATACATATCTTTCTGGACATCAAATA
ACTGGTGAAAGTTCCGTTGAGATGTACGCTCAGGTTCTTTTAAGTGGTTG
TCGGTGCATTGAGTTAGATTGTTGGGACGGAGAAGATGGAACACCTGTCA
TATACCATGGTCATACTTTTACAAACAAAATATCTTTTCAAAGTGTGGTT
GAAACGATTGACAGATCTGCATTTCAGACTAGCTCTTATCCAGTAATATT
GTCAATAGAAAACCATTGCTCTCTGCCACAACAACAAAAAATGGCACAAA
TATTTTCTCAAGTATTTGGCGAGAAACTTGTAACTCGTTATTTATTTGAC
TCCGATCTTGATGATGATCCATATTTGCCGTCTCCAAATCAACTGAAATA
TCGAATTTTAATCAAAAACAAAAAATTAACATCAAAGCAGTCAGCTTTTC
AAACGAAAGTGAAGTCTCAAATATTGAGAAATAGTAGTATTGGTGTAGTA
ACTGACAGTGGCCTAGCATCTGAAGATATTGGCAATATGGATGATGACGA
AGATGAAGATGAAGATGAGGATGATAACTCAGGAACTGTAGTGTCAACGA
ACAAAGATTCGTTAGAAGTCGATTCGAGAAAATTGATGGATTTAACAAAT
AAAGACTCTGTGCCTACCCAAATTAGTTCCGATTTAGTTTTGTTAAAGAA
AAAAGATCTTCCAAGTTCTCTGGTTGTGAATAAATCCGATTTAAGGAATA
GTACTGCCTCGTCAGTAAACCTGGACATCCAAGGTGGGAAACTCGGTATT
CAGGATTGGCAGTTTGATGATATTACCAGTACCCATTCGATTGGAAATAT
TAATACTACAAGCACTCCAGCTTTAAAATCAACTACAAAAATAAAAACTA
ATAAAGCCAGTCAAATCGATCCAGGGTTATCGGAACTCGTTGTATACACA
CAAGCTGTAAAATTGCGTTCGTTGAATTTAAAAAGTAGTCCTCAAACTAA
TCAAAAACCCAAGAAAGGAACAATTAAAAGACCTGTCTTGCCACAGGTGC
ATTTATCTGGAACAAATCTATCTGCTATTGTTAGTAGTACAACTTCAACT
TCTTCGGGACTAAATATAAAAAGCGATCAGCTTACTCATTTAAATGTTCA
ATCTCTGTCAATGATTGGAATTAATTCGACAAATCCGAGTTCAAGTCCTT
CTTTTTCTTATCCTGGACAAAGAAGATACTATGATGCAAATCCACCTGCT
CATCAGATCGCTTCAGTAAATGAAAGCAAAGCGAAATCTGTTTGCAGAAG
AATACCTACATTTTTAATATGTCATTGTGAAAAACAATTAGTTAGAACTT
ATCCGGCGGGAATAAGATTGGATTCGTCTAATTTCAATCCGGTAATATTT
TGGGCTTTCGGAATTCAAATGGTTGCATTGAATTATCAAACTGAAGATCA
GGCATTAGAAGTCAATAATGCTATGTTTGGCCAGTCATATAATTGTGGAT
ATGTGCTTAAGCCTGCAGTTATGTGGAACAAAAATCATGTGCTATTTAAT
AAATTCAATCCATGGGAGAAAGAATTCGAAGGGATACTTCCGTGTTATTT
AACAATTCAAATAATATCTGGTCAAAATCTTAATATTATTAATCCGAGTG
GAAGTCCATTATTGGAGCTTGAGATAATTGGTATTCAAATGGATTGTATT
AAATGCAAAACGAGACCAATTCAAAGAAATATGATAAATCCAAATTGGTC
AGAAACTTTTCAGTTTAAGATTGCTTTTCCGGATCTCGCATTTATTCGGT
TTGCTGTTATTGATGTTAACAGCACCCATATAATTTGTCAGAAAGTATAT
CCTGTGAAAACTCTTAAAAAAGGATTTAGACATATTCCTTTGAAATCTCA
ATTTGTTGCAGGAAATCAATTATTTGATGTAGCTACATTGTTTGTTTTCA
TCAGTATGGAAGATGATATATCCCGGGTCGATAGCGAGCCCAATCAGTCT
TCTCAAGAAGGCGGATCAAGTAGTTCTATGAGTTACTCTCTTGCCATTTC
TTCACTAGATATACCGACTCCAAAAACTGCTACTTTAAGGCGAAAATATC
CATTGGGATCTAAGCCATGGAAAGGATCCGATAATCGAGATACAATTGCT
CGAAAACCAAAAGAAAAAGTTCATTATATATTTTTGAGTGGAGTTTGTGA
AAACGAAAATTATACAATATTGAAAATAGCAAGTACATCTACTGCGTATG
ATGTAATTTATCAAGCTCTTCATAAATCCGGACGTCTAGATGACAGTATT
GCTAATTATGTTTTACTGCAAGAGCCAAGTACTATTGAAGAAATACCAAG
GCTTATTGGACTTCAAGAGAATATTGAATCGATAATTGAAAAGTCTAATA
GTACTAGTCGATTTATTTTAAAGCGAAATAGCAGTGATCCTTCTAGTCGT
GCATGGATGACTACTATATTAAATGAAGATTCTCGACGCAGAAAAGAAGA
AGAATATAGTTTTGATCATCCCTCAGATAGTTTTTCTATGTCCAGTGCTT
CAAAGATTTTAGTTTGCATTTATAATGTTTCTCCAGAACAACCTTACACT
ATTTTGAAAACTGATATTAATAGTACAGTTGATCAGGTTATTTCTCTGGC
ATTGGCGAAAGCTAGAAGAAAGGATGATCCGAATGATTTTGTGCTAGTTG
AAGAAATATCAGCTCCGAACTATCAAGAAAGTCCAGGTGGTACTAGTAGA
AAAAAATTTACCAAGAAAAGCAGTAAACGGATTTTGGAGGGAAGTGAATG
TGTATATTTAATACAGAAGCAATCAAATGCTTCTGGAAAATTACTGCTTA
TGACGAAATTTAATGTCGAAGAAGTTTTATCGTGTTCTTCTCACAAAAAA
AACAATTGGAATTTTTTATCTAAATCAAGTAAAGACAGCTTATTTGATGA
AAGATCTTCTAAATCGAAAGAAATTCCTAGTGTGACATCTACAAAAGAGT
TAGAAGAAGAACAATCGACTTCTGGTTTAACACCACCTCAAATATCAGAC
AATCCACGATATCGTACTTATAGCTGTCCCACAAAATATGTCAGCAAAAT
CAACCTCCCAAAGCAACAAAGTTGCCCAACAGATTCCAAACATTCGGTAA
TTCAAAGCATTTCACAGCCGCCACTTGGTAACTTAAGTGGAAAATTACAG
AAATTGAGTCATTTTATCAGTGGCAAAAAATAACCTATCGATTCATATTT
TTAAGAATCATTTTAACATTTTTTTGTTATTTTTCCACTATTAAGAAAAT
CGTATTTTTCAATTTAAATAAATTTTGTTTTCTATTTTATAAACGATCGA
TTATTGATTTTACCAAAAAATTGTTTTTTATTTTCTATGTTTGTAAATTT
GTGATAACATTTTGATTGTATCAATTACAATTTGTAATAAATTCGATTTT
ATTCGCAGTGAATTTCTTGGTTTCGAGGAGATTTCCTTACTTGTCATTGA
TTATTGATCCATCTCTGCAC
back to top

protein sequence of SMED30011750-orf-1

>SMED30011750-orf-1 ID=SMED30011750-orf-1|Name=SMED30011750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3494bp
MDLFEWNNITVNSNNTNNNNAMLKLIITNGFRLGKQNRFNLKPVDIYPDI
WTDLNKILKSLITFGNLRLNSDRNSDSFNRDSSSKKQNQSQNRSKSRSNK
TNKNNNSDQKSSSSGKDRKTKENNNKSDSQSFSVEMERTSSTSSNKVGSK
EKESFVATERRQSNFSRKFSFKEKAQRSRDLSFRMRYEDAESSLKTMIVL
AKNPECLTQIIDGIDGFISMVISISQQANEEELESLISQLFNQIIKTISG
KLRDCPNNSSQAYVYMLQMTQLLDTSMDLLRQKQYIHYTALTIINKLLDL
CFMNSVYEYVNIESCDIEKDLSEREMPGMGNVKSNLNNSHTNITPTTTTH
NRRQSVVNVINNIRSTGTKIIGSFEGGSLKAKGQNGNNNTNTSTININPA
ANESDNSRIMDENRTLYRRILIERINQADPGIILSVLHNRITMQKRTLGY
RVKCSPSTRMRSCVSHCIQILSARMLTVMAQSSRVQRRLFTDGHFKTLVD
ALDPNHDPHLLCLLLQCLATIALDPTYHKALLLTMIEDNLLHLILPSDEW
YYTNYSTKYSPYVKYHASRILVYLGKFHCLAGRFDLFNSSVFDFMHGAGN
FLTDNLEDVFIHNMAMGKHMIHRGDMALIGCSVESLIRMLLEDHGSTVDY
IQVPEQFTKLFSFLGSDEVHFKCILTDRLREALIMVLPAIIHPLIIIRLL
NHRLFGRSYKKKIRHLSTKQSICSSTVIENNNIENPGGKKVNMRESNIMN
IDSNETKIELQNNGKYNQEKYSIASDFPNIETRRPSFIYYETLKAEASGF
KVICPWEGVVNSSYLEKGKKERKSKEIQRERSIDDSLLGLHNEKSIVESI
LEKNSKRFAKWRSSIKKKNKHVEEDTVLLEVDRGKKQKAIIVEKELLDLQ
RELVNLPKISLDPSHGDSRSASPSLLLSRSNSLPNVNSEITPIGSFLINS
SHEIPSIVTNDQDIGMNPINYMTELCRDHSLPEIFISPSLPNDANDLFRT
VDVNTTNDDIHIKRIDSESSSKSISTLSTSNASVHSDSEKSKVSSVNKRS
KKKVSQSMKDKLTSSKTPQSNQSTMSLPIEMKIKQFRNTSLSSNSSNERP
RSLLFLSENNANKSPTKMKDINTFSNMPPIKKSEFDSMSIQRPTSPNFSL
GNESSIPESNFCYATKPCQVARNSGDIPNLQFSAMQLIDTWLHMSLIDFS
LIRDDIKEFLTRLSTQGTDQRLWCQNIWSFLKSRISTNKVSKPDGQETYE
STNIEYKRLKQLVTSGDLPCTKDDAATLAAVHMHIDNSWPETDAGPSNQM
NSLFPDSNKSLSYLTKKMAHSRLTSSRMRSRKPFRMMHQFSCVSDKENER
KKREIKRMLAKYIPPEYHDSKKTHELIKEKYKKLWHTPFYESEIKLKQLY
MKLCKNLPAYGCRLFQVQEILRGNIHQNVLRILGVSPSNITLIDYKSKIL
IRSQTVQDFKNWHLSRNSSAFELEFRASKPWVLNCTSESSMRSLTSSLWE
VLDCDGSKSAKPAFRRSSLEFDLQNKQITLRPDMENGMVYAAELEELMGL
IQFPEEVALMLAQTESKLFQALQPQSYVRYVSLDLSSVPQVDKGVWNLIT
RLKEVSSWITHLIITQPTHEERKNIFSCIVRLVIISYGIGNFNAVVEILA
GLKSEKLKPFWLTISDTCRNELSIIDLLSEQLLSKEPTESYRSVVNRALK
ISNTDVIPFFGLFLSQLKMIVNKTPTILILPSNDAAGVSCVSDFNGEDKF
ISRIGVGGLINMNKVKEVLTILNDISMFQMHNSESSKIDKIDDDMDYPMK
NKSTNDPFFEEFFKPSCRPIVDMINISNVVVIQPRLAKVDPHCLQIMHMG
TTVVKQDKDLQKCVPVFLKLSLTNSLIMWTKPTARTSQFTSTKTSSTNNS
TKGPLFSFLDAPDSKSPFHLIQQTRYTIPGNYYCTDSTTMGSANQTGYIL
MDGQSGFIDIFTIKQIYYGNGRQLANISSIMRRFGYKENYPLPDHCCISI
IYGCSASENKIINIVFPTINAKYWLIGLTKLVAAAKLIRNNVDQKMLWLK
NDYLRLFYSKDLGQALTLAEITKAFGGRRWSVSNSSGVVSDQSCSTSTYA
STFTSKSRPKTNNKSKKSEQQQIFNLFNKSASKFSDSQNSSQVPISPPIR
SRSQEQILTSSSSHNGISMINTPSYLRHSTFYSYAMANSNRRQSTRMLSA
DYDYLEMSPLALSVKDSINKRVNYHELHNINTTEDITQKSYLNFIDFCHL
FRSFIIYSRLDIKQIFDHLSTKISESDTKNSSNIGKIFQKDFNYENEQFY
LTRNYPSTTKLTSKQRHVTAAVAVASIVNNCSGFEKSEKRIIPLTEIQNI
LQQFQGESGDKEDCWKIIEKHEVDPELRAQGMMSYEGFACYLMDQDNFLK
GTLDNTNDQSMDHPLSHYFIASSHNTYLSGHQITGESSVEMYAQVLLSGC
RCIELDCWDGEDGTPVIYHGHTFTNKISFQSVVETIDRSAFQTSSYPVIL
SIENHCSLPQQQKMAQIFSQVFGEKLVTRYLFDSDLDDDPYLPSPNQLKY
RILIKNKKLTSKQSAFQTKVKSQILRNSSIGVVTDSGLASEDIGNMDDDE
DEDEDEDDNSGTVVSTNKDSLEVDSRKLMDLTNKDSVPTQISSDLVLLKK
KDLPSSLVVNKSDLRNSTASSVNLDIQGGKLGIQDWQFDDITSTHSIGNI
NTTSTPALKSTTKIKTNKASQIDPGLSELVVYTQAVKLRSLNLKSSPQTN
QKPKKGTIKRPVLPQVHLSGTNLSAIVSSTTSTSSGLNIKSDQLTHLNVQ
SLSMIGINSTNPSSSPSFSYPGQRRYYDANPPAHQIASVNESKAKSVCRR
IPTFLICHCEKQLVRTYPAGIRLDSSNFNPVIFWAFGIQMVALNYQTEDQ
ALEVNNAMFGQSYNCGYVLKPAVMWNKNHVLFNKFNPWEKEFEGILPCYL
TIQIISGQNLNIINPSGSPLLELEIIGIQMDCIKCKTRPIQRNMINPNWS
ETFQFKIAFPDLAFIRFAVIDVNSTHIICQKVYPVKTLKKGFRHIPLKSQ
FVAGNQLFDVATLFVFISMEDDISRVDSEPNQSSQEGGSSSSMSYSLAIS
SLDIPTPKTATLRRKYPLGSKPWKGSDNRDTIARKPKEKVHYIFLSGVCE
NENYTILKIASTSTAYDVIYQALHKSGRLDDSIANYVLLQEPSTIEEIPR
LIGLQENIESIIEKSNSTSRFILKRNSSDPSSRAWMTTILNEDSRRRKEE
EYSFDHPSDSFSMSSASKILVCIYNVSPEQPYTILKTDINSTVDQVISLA
LAKARRKDDPNDFVLVEEISAPNYQESPGGTSRKKFTKKSSKRILEGSEC
VYLIQKQSNASGKLLLMTKFNVEEVLSCSSHKKNNWNFLSKSSKDSLFDE
RSSKSKEIPSVTSTKELEEEQSTSGLTPPQISDNPRYRTYSCPTKYVSKI
NLPKQQSCPTDSKHSVIQSISQPPLGNLSGKLQKLSHFISGKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015359PLC_EF-hand-like
IPR023578Ras_GEF_dom_sf
IPR016024ARM-type_fold
IPR029071Ubiquitin-like_domsf
IPR001192PI-PLC_fam
IPR000008C2_dom
IPR001895RASGEF_cat_dom
IPR001711PLipase_C_Pinositol-sp_Y
IPR000159RA_dom
IPR000909PLipase_C_PInositol-sp_X_dom
IPR011992EF-hand-dom_pair
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR017946PLC-like_Pdiesterase_TIM-brl
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007264small GTPase mediated signal transduction
GO:0006629lipid metabolic process
GO:0007165signal transduction
GO:0016042lipid catabolic process
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0004435phosphatidylinositol phospholipase C activity
GO:0008081phosphoric diester hydrolase activity
GO:0005488binding
GO:0004871signal transducer activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular