SMED30011749

Overview
NameSMED30011749
Smed IDSMED30011749
Length (bp)1768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011749 (SMED30011749) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011749 (SMED30011749) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011749

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011749 SmedASXL_075658SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
non-ciliated epidermisSMED30011749 dd_Smed_v4_23188_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30011749 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000256:97455..99217 +8396
Homology
BLAST of SMED30011749 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 90.8929 bits (224), Expect = 6.070e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.070e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 90.8929 bits (224), Expect = 6.070e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.070e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 90.5077 bits (223), Expect = 9.652e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 9.652e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 90.5077 bits (223), Expect = 9.652e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 9.652e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 90.1225 bits (222), Expect = 9.813e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 9.813e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 91.2781 bits (225), Expect = 1.803e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   29 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAI 162          

HSP 2 Score: 40.817 bits (94), Expect = 1.803e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  163 LRLDLAGRDLTDYLMKILTERGYSFTT 189          
BLAST of SMED30011749 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 91.2781 bits (225), Expect = 2.159e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.159e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 91.2781 bits (225), Expect = 2.159e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.159e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 91.2781 bits (225), Expect = 2.159e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.159e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Celegans
Match: act-1 (Actin-1 [Source:UniProtKB/Swiss-Prot;Acc:P0DM41])

HSP 1 Score: 91.2781 bits (225), Expect = 2.159e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.159e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Fly
Match: Act57B (gene:FBgn0000044 transcript:FBtr0071519)

HSP 1 Score: 92.4337 bits (228), Expect = 1.391e-24
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 1.391e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Fly
Match: Act79B (gene:FBgn0000045 transcript:FBtr0334090)

HSP 1 Score: 91.6633 bits (226), Expect = 2.065e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E +WHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.065e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Fly
Match: Act79B (gene:FBgn0000045 transcript:FBtr0078478)

HSP 1 Score: 91.6633 bits (226), Expect = 2.065e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E +WHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDCYVGDEAQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.065e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Fly
Match: Act42A (gene:FBgn0000043 transcript:FBtr0086029)

HSP 1 Score: 91.2781 bits (225), Expect = 3.194e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 3.194e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 91.2781 bits (225), Expect = 3.194e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 3.194e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 90.8929 bits (224), Expect = 4.214e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 4.214e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 90.5077 bits (223), Expect = 6.477e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.477e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 90.5077 bits (223), Expect = 6.830e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.830e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 90.5077 bits (223), Expect = 6.830e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.830e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 90.5077 bits (223), Expect = 6.830e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.830e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 90.5077 bits (223), Expect = 9.818e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 9.818e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 90.5077 bits (223), Expect = 1.031e-23
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 1.031e-23
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 88.1965 bits (217), Expect = 1.400e-22
Identity = 59/141 (41.84%), Postives = 79/141 (56.03%), Query Frame = -1
Query:  650 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAISERI*LA 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHP LLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI +R+ LA
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI-QRLDLA 183          

HSP 2 Score: 39.2762 bits (90), Expect = 1.400e-22
Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = -3
Query:  576 RTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 668
            R DLAGR L+DYLMK LT+RG  F T   + 
Sbjct:  179 RLDLAGRDLTDYLMKILTERGYSFVTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 88.1965 bits (217), Expect = 1.480e-22
Identity = 59/141 (41.84%), Postives = 79/141 (56.03%), Query Frame = -1
Query:  650 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAISERI*LA 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHP LLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI +R+ LA
Sbjct:   57 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI-QRLDLA 196          

HSP 2 Score: 38.891 bits (89), Expect = 1.480e-22
Identity = 18/26 (69.23%), Postives = 20/26 (76.92%), Query Frame = -3
Query:  591 RTDLAGRHLSDYLMKKLTKRGCIFTT 668
            R DLAGR L+DYLMK LT+RG  F T
Sbjct:  192 RLDLAGRDLTDYLMKILTERGYSFVT 217          
BLAST of SMED30011749 vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 88.1965 bits (217), Expect = 1.569e-22
Identity = 59/141 (41.84%), Postives = 79/141 (56.03%), Query Frame = -1
Query:  650 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAISERI*LA 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHP LLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI +R+ LA
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI-QRLDLA 183          

HSP 2 Score: 38.891 bits (89), Expect = 1.569e-22
Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = -3
Query:  576 RTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 668
            R DLAGR L+DYLMK LT+RG  F T   + 
Sbjct:  179 RLDLAGRDLTDYLMKILTERGYSFVTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 90.8929 bits (224), Expect = 4.591e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   99 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 232          

HSP 2 Score: 40.817 bits (94), Expect = 4.591e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  233 LRLDLAGRDLTDYLMKILTERGYSFTT 259          
BLAST of SMED30011749 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 90.8929 bits (224), Expect = 5.111e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 5.111e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 90.5077 bits (223), Expect = 6.991e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.991e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 90.1225 bits (222), Expect = 7.107e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 7.107e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 90.1225 bits (222), Expect = 7.107e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 7.107e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. UniProt/SwissProt
Match: sp|P53496|ACT11_ARATH (Actin-11 OS=Arabidopsis thaliana OX=3702 GN=ACT11 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.989e-24
Identity = 57/135 (42.22%), Postives = 77/135 (57.04%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I +N+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 TGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 177          

HSP 2 Score: 41.5874 bits (96), Expect = 3.989e-24
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT+  + 
Sbjct:  178 LRLDLAGRDLTDYLMKILTERGYSFTTSAERE 209          
BLAST of SMED30011749 vs. UniProt/SwissProt
Match: sp|P53472|ACTA_STRPU (Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus OX=7668 GN=CYIA PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.365e-24
Identity = 58/134 (43.28%), Postives = 73/134 (54.48%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYFFLCVWAYDGYVLGFWTYLKF--------IVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      ME  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +         Y  G  T + F         VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPMEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVFDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 5.365e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTT 203          
BLAST of SMED30011749 vs. UniProt/SwissProt
Match: sp|P53473|ACTB_STRPU (Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus OX=7668 GN=CYIB PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.409e-24
Identity = 58/134 (43.28%), Postives = 73/134 (54.48%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYFFLCVWAYDGYVLGFWTYLKF--------IVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      ME  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +         Y  G  T + F         VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPMEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVFDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 5.409e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTT 203          
BLAST of SMED30011749 vs. UniProt/SwissProt
Match: sp|Q10DV7|ACT1_ORYSJ (Actin-1 OS=Oryza sativa subsp. japonica OX=39947 GN=ACT1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.636e-24
Identity = 57/135 (42.22%), Postives = 77/135 (57.04%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I +N+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 TGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 177          

HSP 2 Score: 40.817 bits (94), Expect = 5.636e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  178 LRLDLAGRDLTDYLMKILTERGYSFTT 204          
BLAST of SMED30011749 vs. UniProt/SwissProt
Match: sp|A2XLF2|ACT1_ORYSI (Actin-1 OS=Oryza sativa subsp. indica OX=39946 GN=ACT1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.636e-24
Identity = 57/135 (42.22%), Postives = 77/135 (57.04%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I +N+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 TGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 177          

HSP 2 Score: 40.817 bits (94), Expect = 5.636e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  178 LRLDLAGRDLTDYLMKILTERGYSFTT 204          
BLAST of SMED30011749 vs. TrEMBL
Match: A0A0S7DEQ6 (Actin, gamma OS=Aspergillus lentulus OX=293939 GN=ALT_0877 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.484e-22
Identity = 62/154 (40.26%), Postives = 81/154 (52.60%), Query Frame = -1
Query:  668 TGMFVSLNCAEVYGEIR-------MGQKGIY-----------------MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNRI*FINYV--*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAIS 1027
            TG F+SLN   + G  R       MGQK  Y                 +E  + TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A +N K+NR      V   FN+  ++      L ++A     G VL     +  +VPI+EG+ALP AIS
Sbjct:   74 TGGFLSLNHPSIVGRPRHHGIMIGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAIS 227          

HSP 2 Score: 38.1206 bits (87), Expect = 3.484e-22
Identity = 16/31 (51.61%), Postives = 21/31 (67.74%), Query Frame = -3
Query:  576 RTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 668
            R D+AGR L+DYLMK L +RG  F+T   + 
Sbjct:  228 RVDMAGRDLTDYLMKILAERGYTFSTTAERE 258          
BLAST of SMED30011749 vs. TrEMBL
Match: A0A3L8DYF8 (PXA domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_003247 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.773e-22
Identity = 59/135 (43.70%), Postives = 77/135 (57.04%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:  408 TGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 542          

HSP 2 Score: 40.817 bits (94), Expect = 4.773e-22
Identity = 19/31 (61.29%), Postives = 22/31 (70.97%), Query Frame = -3
Query:  579 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPK 671
             R DLAGR L+DYLMK LT+RG  FTT   +
Sbjct:  543 LRLDLAGRDLTDYLMKILTERGYSFTTTAER 573          

HSP 3 Score: 92.8189 bits (229), Expect = 1.640e-21
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 4 Score: 40.817 bits (94), Expect = 1.640e-21
Identity = 19/31 (61.29%), Postives = 22/31 (70.97%), Query Frame = -3
Query:  579 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPK 671
             R DLAGR L+DYLMK LT+RG  FTT   +
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAER 207          
BLAST of SMED30011749 vs. TrEMBL
Match: A0A1B2LPX4 (Actin 3 (Fragment) OS=Pseudostellaria heterophylla OX=418402 GN=ACT 3 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.470e-22
Identity = 57/135 (42.22%), Postives = 76/135 (56.30%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I +N+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   12 TGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 146          

HSP 2 Score: 43.1282 bits (100), Expect = 5.470e-22
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG +FTT+  + 
Sbjct:  147 LRLDLAGRDLTDYLMKILTERGYMFTTSAERE 178          
BLAST of SMED30011749 vs. TrEMBL
Match: A0A2D3FB36 (Actin 7 (Fragment) OS=Atriplex hortensis OX=34272 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.480e-22
Identity = 57/135 (42.22%), Postives = 76/135 (56.30%), Query Frame = -1
Query:  671 TGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1027
            TG+ V +   + Y G+    ++GI      +E  I +N+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   19 TGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVATQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 153          

HSP 2 Score: 43.1282 bits (100), Expect = 5.480e-22
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG +FTT+  + 
Sbjct:  154 LRLDLAGRDLTDYLMKILTERGYMFTTSAERE 185          
BLAST of SMED30011749 vs. TrEMBL
Match: A0A0M8ZY43 (Actin, indirect flight muscle OS=Melipona quadrifasciata OX=166423 GN=WN51_03240 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.975e-22
Identity = 59/138 (42.75%), Postives = 79/138 (57.25%), Query Frame = -1
Query:  671 KMSTGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1036
            ++S G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:  408 QLSQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 545          

HSP 2 Score: 40.4318 bits (93), Expect = 5.975e-22
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  546 LRLDLAGRDLTDYLMKILTERGYSFTT 572          

HSP 3 Score: 91.6633 bits (226), Expect = 3.964e-21
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 176          

HSP 4 Score: 40.4318 bits (93), Expect = 3.964e-21
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTT 203          
BLAST of SMED30011749 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 90.5077 bits (223), Expect = 5.938e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 5.938e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 90.5077 bits (223), Expect = 5.938e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 5.938e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 90.1225 bits (222), Expect = 7.537e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 177          

HSP 2 Score: 40.817 bits (94), Expect = 7.537e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  178 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Cavefish
Match: actc1c (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103039206])

HSP 1 Score: 87.8113 bits (216), Expect = 1.005e-22
Identity = 56/134 (41.79%), Postives = 75/134 (55.97%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VP++EGYALP AI
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAI 177          

HSP 2 Score: 39.2762 bits (90), Expect = 1.005e-22
Identity = 18/32 (56.25%), Postives = 21/32 (65.62%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  F T   + 
Sbjct:  178 MRLDLAGRDLTDYLMKILTERGYSFVTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Cavefish
Match: ENSAMXT00000003590.2 (actin, alpha cardiac-like [Source:NCBI gene;Acc:103024089])

HSP 1 Score: 87.0409 bits (214), Expect = 1.831e-22
Identity = 56/134 (41.79%), Postives = 74/134 (55.22%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHP LLT+A LN K NR  +  I +  FN    +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI 177          

HSP 2 Score: 39.2762 bits (90), Expect = 1.831e-22
Identity = 18/32 (56.25%), Postives = 21/32 (65.62%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  F T   + 
Sbjct:  178 MRLDLAGRDLTDYLMKILTERGYSFVTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 8.933e-25
Identity = 56/142 (39.44%), Postives = 79/142 (55.63%), Query Frame = -1
Query:  671 VIETKMSTGMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1048
            ++   +  G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   35 IVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 8.933e-25
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 9.081e-25
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 9.081e-25
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 9.657e-11
Identity = 34/105 (32.38%), Postives = 51/105 (48.57%), Query Frame = -1
Query:  671 MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNRI*FIN--YV*FNSSCYFF-----LCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 955
            +ER I T +DD+E +W H +  +     ++ PVLLT+A LN   NR       +  F +          L ++A     G  +G    +   VP+FEGY LPRA+
Sbjct:   82 VERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAV 186          

HSP 2 Score: 27.7202 bits (60), Expect = 9.657e-11
Identity = 11/28 (39.29%), Postives = 19/28 (67.86%), Query Frame = -3
Query:  588 FRTDLAGRHLSDYLMKKLTKRGCIFTTA 671
             R+D+AGR ++D L + L +RG  F ++
Sbjct:  187 LRSDVAGRDVTDNLGRILAERGHAFVSS 214          
BLAST of SMED30011749 vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 86.6557 bits (213), Expect = 2.857e-23
Identity = 53/135 (39.26%), Postives = 76/135 (56.30%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYFFLCVWAY---------DGYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A +N K+NR  +  I +  FN    F++ + A           G VL     +  +VPI+ G++LP AI
Sbjct:   42 GIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAI 175          

HSP 2 Score: 38.891 bits (89), Expect = 2.857e-23
Identity = 17/32 (53.12%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK L++RG  F+T   + 
Sbjct:  176 LRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 92.4337 bits (228), Expect = 4.633e-25
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 4.633e-25
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTT 203          
BLAST of SMED30011749 vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 92.0485 bits (227), Expect = 5.417e-25
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 5.417e-25
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 91.6633 bits (226), Expect = 6.765e-25
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 6.765e-25
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 91.6633 bits (226), Expect = 7.528e-25
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 7.528e-25
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 IRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 91.6633 bits (226), Expect = 8.241e-25
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 8.241e-25
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTT 203          
BLAST of SMED30011749 vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 92.0485 bits (227), Expect = 1.763e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 1.763e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 92.0485 bits (227), Expect = 2.107e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ R+A EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 2.107e-24
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3
Query:  591 FRTDLAGRHLSDYLMKKLTKRGCIFTT 671
             R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 91.2781 bits (225), Expect = 2.468e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ R+A EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 41.2022 bits (95), Expect = 2.468e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 90.8929 bits (224), Expect = 4.014e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ R+A EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   44 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 177          

HSP 2 Score: 40.817 bits (94), Expect = 4.014e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  178 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 209          
BLAST of SMED30011749 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 90.8929 bits (224), Expect = 4.395e-24
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ R+A EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G V+     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 4.395e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  176 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 207          
BLAST of SMED30011749 vs. Planmine SMEST
Match: SMESG000012332.1 (SMESG000012332.1)

HSP 1 Score: 92.4337 bits (228), Expect = 9.702e-25
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 9.702e-25
Identity = 19/26 (73.08%), Postives = 21/26 (80.77%), Query Frame = -3
Query:  591 RTDLAGRHLSDYLMKKLTKRGCIFTT 668
            R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 RMDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Planmine SMEST
Match: SMESG000012317.1 (SMESG000012317.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.019e-24
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FNS   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   42 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 175          

HSP 2 Score: 40.817 bits (94), Expect = 1.019e-24
Identity = 19/26 (73.08%), Postives = 21/26 (80.77%), Query Frame = -3
Query:  591 RTDLAGRHLSDYLMKKLTKRGCIFTT 668
            R DLAGR L+DYLMK LT+RG  FTT
Sbjct:  177 RMDLAGRDLTDYLMKILTERGYSFTT 202          
BLAST of SMED30011749 vs. Planmine SMEST
Match: SMESG000066035.1 (SMESG000066035.1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.068e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.068e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Planmine SMEST
Match: SMESG000066029.1 (SMESG000066029.1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.102e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.102e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
BLAST of SMED30011749 vs. Planmine SMEST
Match: SMESG000066027.1 (SMESG000066027.1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.102e-24
Identity = 57/134 (42.54%), Postives = 76/134 (56.72%), Query Frame = -1
Query:  671 GMFVSLNCAEVY-GEIRMGQKGIY-----MERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLNSKTNR--I*FINYV*FNSSCYF-----FLCVWAYD---GYVLGFWTYLKFIVPIFEGYALPRAI 1024
            G+ V +   + Y G+    ++GI      +E  I TN+DD+E IWHHTFYN+ RVA EEHPVLLT+A LN K NR  +  I +  FN+   +      L ++A     G VL     +   VPI+EGYALP AI
Sbjct:   43 GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAI 176          

HSP 2 Score: 40.817 bits (94), Expect = 2.102e-24
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = -3
Query:  576 FRTDLAGRHLSDYLMKKLTKRGCIFTTAPPKR 671
             R DLAGR L+DYLMK LT+RG  FTT   + 
Sbjct:  177 LRLDLAGRDLTDYLMKILTERGYSFTTTAERE 208          
The following BLAST results are available for this feature:
BLAST of SMED30011749 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTG16.070e-2441.79actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG16.070e-2441.79actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTB9.652e-2441.79actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB9.652e-2441.79actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTG19.813e-2441.79actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of SMED30011749 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-41.803e-2442.54Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-32.159e-2442.54Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-32.159e-2442.54Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-32.159e-2442.54Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-12.159e-2442.54Actin-1 [Source:UniProtKB/Swiss-Prot;Acc:P0DM41][more]
back to top
BLAST of SMED30011749 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act57B1.391e-2443.28gene:FBgn0000044 transcript:FBtr0071519[more]
Act79B2.065e-2442.54gene:FBgn0000045 transcript:FBtr0334090[more]
Act79B2.065e-2442.54gene:FBgn0000045 transcript:FBtr0078478[more]
Act42A3.194e-2442.54gene:FBgn0000043 transcript:FBtr0086029[more]
Act5C3.194e-2442.54gene:FBgn0000042 transcript:FBtr0070822[more]
back to top
BLAST of SMED30011749 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb14.214e-2441.79actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb16.477e-2441.79actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb16.830e-2441.79actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb26.830e-2441.79actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb26.830e-2441.79actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of SMED30011749 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actg19.818e-2441.79actin gamma 1 [Source:NCBI gene;Acc:394957][more]
actb1.031e-2341.79actin, beta [Source:NCBI gene;Acc:407952][more]
act31.400e-2241.84actin alpha 4 [Source:NCBI gene;Acc:394673][more]
act31.480e-2241.84actin alpha 4 [Source:NCBI gene;Acc:394673][more]
act31.569e-2241.84actin alpha 4 [Source:NCBI gene;Acc:394673][more]
back to top
BLAST of SMED30011749 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actg14.591e-2441.79actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actb5.111e-2441.79actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actb6.991e-2441.79actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg17.107e-2441.79actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg17.107e-2441.79actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30011749 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53496|ACT11_ARATH3.989e-2442.22Actin-11 OS=Arabidopsis thaliana OX=3702 GN=ACT11 ... [more]
sp|P53472|ACTA_STRPU5.365e-2443.28Actin, cytoskeletal 1A OS=Strongylocentrotus purpu... [more]
sp|P53473|ACTB_STRPU5.409e-2443.28Actin, cytoskeletal 1B OS=Strongylocentrotus purpu... [more]
sp|Q10DV7|ACT1_ORYSJ5.636e-2442.22Actin-1 OS=Oryza sativa subsp. japonica OX=39947 G... [more]
sp|A2XLF2|ACT1_ORYSI5.636e-2442.22Actin-1 OS=Oryza sativa subsp. indica OX=39946 GN=... [more]
back to top
BLAST of SMED30011749 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S7DEQ63.484e-2240.26Actin, gamma OS=Aspergillus lentulus OX=293939 GN=... [more]
A0A3L8DYF84.773e-2243.70PXA domain-containing protein OS=Ooceraea biroi OX... [more]
A0A1B2LPX45.470e-2242.22Actin 3 (Fragment) OS=Pseudostellaria heterophylla... [more]
A0A2D3FB365.480e-2242.22Actin 7 (Fragment) OS=Atriplex hortensis OX=34272 ... [more]
A0A0M8ZY435.975e-2242.75Actin, indirect flight muscle OS=Melipona quadrifa... [more]
back to top
BLAST of SMED30011749 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb15.938e-2441.79actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb25.938e-2441.79actin beta [Source:NCBI gene;Acc:103030443][more]
actb17.537e-2441.79actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actc1c1.005e-2241.79actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
ENSAMXT00000003590.21.831e-2241.79actin, alpha cardiac-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30011749 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004586.18.933e-2539.44pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011113.19.081e-2541.79pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000011230.19.657e-1132.38pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
back to top
BLAST of SMED30011749 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ACT12.857e-2339.26Actin; structural protein involved in cell polariz... [more]
back to top
BLAST of SMED30011749 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379764.633e-2542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380065.417e-2542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450136.765e-2542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426467.528e-2542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385208.241e-2542.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30011749 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021726.21.763e-2442.54actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb2.107e-2441.79cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb2.468e-2441.79cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb4.014e-2441.79cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb4.395e-2441.79cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of SMED30011749 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012332.19.702e-2543.28SMESG000012332.1[more]
SMESG000012317.11.019e-2443.28SMESG000012317.1[more]
SMESG000066035.12.068e-2442.54SMESG000066035.1[more]
SMESG000066029.12.102e-2442.54SMESG000066029.1[more]
SMESG000066027.12.102e-2442.54SMESG000066027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011749 ID=SMED30011749|Name=SMED30011749|organism=Schmidtea mediterranea sexual|type=transcript|length=1768bp
AATTTTTTTTTGAAACGGACTAGTCTGTATCTGATGACAGTGAATAAGTT
TTATTAAGATAATTAAAAATATGTAAAATGAATTGATATTTATGTTTGTT
ACGGTACTTTATGAATTATTGTTTTGTTATTTTATAAATATCAAATTTTA
TTAACATTTGGGATTTTAGATCAAAATAGTTGCTTTAAGGTTACTTGACA
AATTTTTAAAATACTTTATCATACTGCTATTATACTGTAAATTCTCTTAA
TTGTTTAAAAAGGTACGCATAGAAGGTATTTGGTGACCTCGTAACTGACA
TCGAATTCAATGTATTTTCTAATTTGATTATTAAAACTTTAAAATCGGTC
CCCAAACAAGAGAACTACTGATATCAGTTTCCGTTTTTCCAAACCCTACA
AAAAATGCATTAAAATAATACATTAAAACACATATAACCTTTTCTTGATC
ATTTAAAATATGTGAATTGCGGTAGTAAGATTCTACAGAATCATTTTTGA
TTGCCACACTTTACTAGTTTTATTTAACAATTATGAGCACACAATACTAA
TAATTCACAAATGTTGATTTGGCTTTCGTTTGGGAGGAGCAGTTGTGAAA
ATGCACCCTCGTTTAGTCAGTTTTTTCATTAAATAATCTGATAAATGTCT
GCCAGCTAAATCCGTTCGGAAATTGCTCGAGGTAATGCATAACCTTCAAA
TATTGGCACAATAAATTTCAAATAAGTCCAGAATCCCAAAACATACCCGT
CGTATGCCCAGACGCATAGAAAGAAATAACAGCTTGAATTGAATCATACA
TAGTTAATGAATTAAATGCGGTTCGTCTTGGAATTCAATAGAGCTTTAGT
CAACAAAACTGGATGTTCTTCGAGTGCTACTCTTTGCTTATTATAAAATG
TGTGATGCCAAATATTTTCCAAATCATCATAATTTGTCCAAATATCGCGT
TCCATATAAATACCTTTTTGGCCCATTCTTATTTCTCCATATACTTCAGC
ACAATTCAGCGATACAAACATTCCAGTAGACATTTTCGTTTCAATAACCA
CAAACTTTAATAAATAACAACGTAATTCACAAATTTTTATTTTAAATTCA
AAAAAATTGTCAAAATCCAAAAAAGAACTCATCAATCAAATTCCACCAAA
ATTTCTTTATATTAAACTAAATTAACACAAATAAACAAATCAATAAATAA
TGCCATAATTTCCGAAATTCAAAAAGTTCTTTTCAGACATAAATTCCACT
GCGCACAATGACACTATACCACCAAACTTGCTCATACAGGCGCGTAACTA
TGATTCACAATTTAACAGTACTTATAGTTCACAACTGTCAAGAATTCAGT
ACAAATTGTTACACAAGGTTTTGGTCATTGATTCTTTTACAATTCTCAAA
AATACCAGAGTTCATTATGAGTAATGTTCTTAACACGAGGCAAAGTCACA
AAGAGTAGTCACCACGAAAAAAATAAGATTAAAACACAATGAAGACATGA
TATTGTAGCCTCTTTTTTTCAAAAGTATTTTTCATAATTGACGAGTCTTG
AATAGATATAAGCTTGTTAGTGGATGTTTTCCAATAGTAAGAATTTAATG
GAGACCAATATATTAGCATTACGGGCCTCTAGTCTCTAACCTAGTTCTTT
AGATCCTTCTTTGCTTACAATGACAAACTTTTTAATTAATTTGAAATTAA
TTGTGAAATTAATGCATAGTTCTTTAATAAATTTGAGATTTTTAGGCTCA
AAACAGTCGGCCAACAAA
back to top

protein sequence of SMED30011749-orf-1

>SMED30011749-orf-1 ID=SMED30011749-orf-1|Name=SMED30011749-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MSSFLDFDNFFEFKIKICELRCYLLKFVVIETKMSTGMFVSLNCAEVYGE
IRMGQKGIYMERDIWTNYDDLENIWHHTFYNKQRVALEEHPVLLTKALLN
SKTNRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR004000Actin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..42