SMED30011747

Overview
NameSMED30011747
Smed IDSMED30011747
Length (bp)545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011747 (SMED30011747) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011747 (SMED30011747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30011747 (SMED30011747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30011747 (SMED30011747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30011747 Contig53088uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011747 Contig53088newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011747 Contig27414uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011747 Contig27414newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30011747 dd_Smed_v6_494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011747 dd_Smed_v4_494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30011747 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005636:14823..15608 -2644
Homology
BLAST of SMED30011747 vs. Ensembl Human
Match: MIEN1 (migration and invasion enhancer 1 [Source:HGNC Symbol;Acc:HGNC:28230])

HSP 1 Score: 72.7886 bits (177), Expect = 2.045e-16
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = -3
Query:  229 KMSEGIVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 513
            ++  G  +++ VEYC   G+   Y  L +A+  Q  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+I+ +R    GE    ITN +P
Sbjct:   16 EVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP 110          
BLAST of SMED30011747 vs. Ensembl Human
Match: MIEN1 (migration and invasion enhancer 1 [Source:HGNC Symbol;Acc:HGNC:28230])

HSP 1 Score: 60.4622 bits (145), Expect = 1.070e-11
Identity = 35/98 (35.71%), Postives = 53/98 (54.08%), Query Frame = -3
Query:  220 KMSEGIVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSS 513
            ++  G  +++ VEYC   G+   Y  L +A+  Q  GIE    +G T +FEI +N  LVFSKL+ GGFP Y+  + +    +T   PY  +    HS+
Sbjct:   16 EVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFP-YEKDVSIYSVGRTSWSPYPNSASSCHST 112          
BLAST of SMED30011747 vs. Ensembl Fly
Match: CG15456 (gene:FBgn0040650 transcript:FBtr0077323)

HSP 1 Score: 58.5362 bits (140), Expect = 1.442e-11
Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = -3
Query:  208 VLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 495
            ++KV VEYCG   ++ Q   LR  + A    ++ SC  GR  SFE++++  LV SKL C  FP +  V+  ++  + GE P      +P   C V+
Sbjct:    1 MVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGE-PVEKVLEQPIKDCVVM 95          
BLAST of SMED30011747 vs. Ensembl Fly
Match: CG15456 (gene:FBgn0040650 transcript:FBtr0340402)

HSP 1 Score: 58.5362 bits (140), Expect = 1.442e-11
Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = -3
Query:  208 VLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 495
            ++KV VEYCG   ++ Q   LR  + A    ++ SC  GR  SFE++++  LV SKL C  FP +  V+  ++  + GE P      +P   C V+
Sbjct:    1 MVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGE-PVEKVLEQPIKDCVVM 95          
BLAST of SMED30011747 vs. Ensembl Zebrafish
Match: selenow2b (selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-030428-2])

HSP 1 Score: 75.485 bits (184), Expect = 5.397e-18
Identity = 39/87 (44.83%), Postives = 52/87 (59.77%), Query Frame = -3
Query:  238 IVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITN 498
            +V+KV +EYCGA GY  ++  L+  I       E S  VGR   FEI +ND LVFSKL+ GGFP  +D+I+ +   + G KP  IT 
Sbjct:    1 MVVKVKIEYCGAUGYEPRFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDG-KPEKITR 86          
BLAST of SMED30011747 vs. Ensembl Zebrafish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 72.0182 bits (175), Expect = 1.480e-16
Identity = 34/88 (38.64%), Postives = 52/88 (59.09%), Query Frame = -3
Query:  229 LKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 492
            +++ VEYCG  GY  +Y  L+  + A+ T  + S  VGR  SFEI +N  L+FSKL+  GFP  DD++ +++    G+    IT  +P
Sbjct:    3 VQIKVEYCGGUGYEPRYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITKSQP 90          
BLAST of SMED30011747 vs. Ensembl Zebrafish
Match: selenow2b (selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-030428-2])

HSP 1 Score: 65.4698 bits (158), Expect = 4.655e-14
Identity = 36/87 (41.38%), Postives = 49/87 (56.32%), Query Frame = -3
Query:  238 IVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITN 498
            +V+KV +EYCG      ++  L+  I       E S  VGR   FEI +ND LVFSKL+ GGFP  +D+I+ +   + G KP  IT 
Sbjct:    1 MVVKVKIEYCGP-----RFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDG-KPEKITR 81          
BLAST of SMED30011747 vs. Ensembl Zebrafish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 56.225 bits (134), Expect = 1.371e-10
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = -3
Query:  229 QYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 447
            +Y  L+  + A+ T  + S  VGR  SFEI +N  L+FSKL+  GFP  DD++ +++    G+    IT  +P
Sbjct:    8 RYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITKSQP 80          
BLAST of SMED30011747 vs. Ensembl Xenopus
Match: mien1 (migration and invasion enhancer 1 [Source:NCBI gene;Acc:548750])

HSP 1 Score: 62.003 bits (149), Expect = 1.363e-12
Identity = 32/81 (39.51%), Postives = 44/81 (54.32%), Query Frame = -3
Query:  238 VEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITN 480
            VEYC   G+ + Y  L +A+  +   +      G T +FEI +N  LVFSKL+ GGFP   D+I+ +R    GE    ITN
Sbjct:    7 VEYCEPCGFKSHYEELASAVLEEFPDVTIDSRPGGTGAFEIEINGQLVFSKLELGGFPYAKDLIEAIRKASNGEPVEKITN 87          
BLAST of SMED30011747 vs. Ensembl Mouse
Match: Mien1 (migration and invasion enhancer 1 [Source:MGI Symbol;Acc:MGI:1913678])

HSP 1 Score: 69.707 bits (169), Expect = 2.283e-15
Identity = 35/84 (41.67%), Postives = 48/84 (57.14%), Query Frame = -3
Query:  229 VEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 480
            VEYC   G+   Y  L +A+  +  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+++ +R    GE    ITN +P
Sbjct:   27 VEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITNSRP 110          
BLAST of SMED30011747 vs. UniProt/SwissProt
Match: sp|Q9BRT3|MIEN1_HUMAN (Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.823e-16
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = -3
Query:  229 KMSEGIVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 513
            ++  G  +++ VEYC   G+   Y  L +A+  Q  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+I+ +R    GE    ITN +P
Sbjct:   16 EVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP 110          
BLAST of SMED30011747 vs. UniProt/SwissProt
Match: sp|Q148C8|MIEN1_BOVIN (Migration and invasion enhancer 1 OS=Bos taurus OX=9913 GN=MIEN1 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.093e-15
Identity = 37/88 (42.05%), Postives = 51/88 (57.95%), Query Frame = -3
Query:  229 LKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 492
            +++ VEYC   G+   Y  L +A+  Q  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+I+ +R    GE    ITN +P
Sbjct:   23 VRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGEPLEKITNSRP 110          
BLAST of SMED30011747 vs. UniProt/SwissProt
Match: sp|Q9CQ86|MIEN1_MOUSE (Migration and invasion enhancer 1 OS=Mus musculus OX=10090 GN=Mien1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.597e-14
Identity = 35/84 (41.67%), Postives = 48/84 (57.14%), Query Frame = -3
Query:  229 VEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 480
            VEYC   G+   Y  L +A+  +  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+++ +R    GE    ITN +P
Sbjct:   27 VEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITNSRP 110          
BLAST of SMED30011747 vs. TrEMBL
Match: A7L483 (Selenoprotein W2 OS=Artemia franciscana OX=6661 PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 5.596e-19
Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = -3
Query:  208 VLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 495
            ++K+HVEYCGA GYA +Y  L   I       E S  VGR +SFE+TVN  L+ SKL   GFP +D+V++++ +V  G+KP  +   K HSSC +L
Sbjct:    1 MVKIHVEYCGAUGYAPRYQELAAKIRKAAPDAEVSGNVGRRSSFEVTVNGELIHSKLSTNGFPDFDEVVEIVISVTKGDKPRTVE--KTHSSCIIL 94          
BLAST of SMED30011747 vs. TrEMBL
Match: Q802G8 (Selenoprotein W2b OS=Danio rerio OX=7955 GN=selenow2b PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.960e-15
Identity = 38/89 (42.70%), Postives = 53/89 (59.55%), Query Frame = -3
Query:  232 IVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFK 498
            +V+KV +EYCGA GY  ++  L+  I       E S  VGR   FEI +ND LVFSKL+ GGFP  +D+I+ +   + G+   +I N K
Sbjct:    1 MVVKVKIEYCGAUGYEPRFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDGKPEKIIRNRK 89          
BLAST of SMED30011747 vs. TrEMBL
Match: A0A1I8S7K1 (Selenoprotein W, 2b OS=Danio rerio OX=7955 GN=selenow2b PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.208e-14
Identity = 39/87 (44.83%), Postives = 52/87 (59.77%), Query Frame = -3
Query:  238 IVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITN 498
            +V+KV +EYCGA GY  ++  L+  I       E S  VGR   FEI +ND LVFSKL+ GGFP  +D+I+ +   + G KP  IT 
Sbjct:    1 MVVKVKIEYCGACGYEPRFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDG-KPEKITR 86          
BLAST of SMED30011747 vs. TrEMBL
Match: V9L4J1 (Selenoprotein W, 2a OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.383e-14
Identity = 39/88 (44.32%), Postives = 52/88 (59.09%), Query Frame = -3
Query:  229 LKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 492
            LKV VEYCGA GY  +Y  L   I  +    + S  VGRT SFEI +N  L+FSKL+ GGFP  +D+ + ++    GE+   I N +P
Sbjct:    3 LKVFVEYCGAUGYEPRYQKLAIVIKDEFPDADVSGKVGRTGSFEIEINGQLIFSKLETGGFPYENDISEAVQKANNGEELQKIENSRP 90          
BLAST of SMED30011747 vs. TrEMBL
Match: L9JWM6 (Uncharacterized protein OS=Tupaia chinensis OX=246437 GN=TREES_T100004447 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.002e-14
Identity = 39/95 (41.05%), Postives = 55/95 (57.89%), Query Frame = -3
Query:  229 KMSEGIVLKVHVEYCGA*GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKP 513
            ++  G  +++ VEYC   G+   Y  L +A+  Q  GIE    +G T +FEI +N  LVFSKL+ GGFP   D+I+ +R   TGE    ITN +P
Sbjct:   16 EVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASTGEPLEKITNSRP 110          
BLAST of SMED30011747 vs. Ensembl Cavefish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 58.151 bits (139), Expect = 2.049e-11
Identity = 32/84 (38.10%), Postives = 44/84 (52.38%), Query Frame = -3
Query:  208 GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 459
            GY  +Y  L+  + A+      S  VGR  SFEI +N  LVFSKL+  GFP  DDV+  ++    G+    IT  +P   C +L
Sbjct:    1 GYEPRYQELKRVVVAEFPEAAVSGFVGRLGSFEIEINGQLVFSKLETSGFPYEDDVMDAIQKAHDGKPVEKITKSQPR--CVIL 82          
BLAST of SMED30011747 vs. Ensembl Nematostella
Match: EDO45053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUC6])

HSP 1 Score: 52.7582 bits (125), Expect = 1.461e-9
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = -3
Query:  247 ANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVI-QLLRAVQTGEKPYL 453
            A++   LR+ I A+    +    VGR+ SFE+T+N   VFSKLK GGFPV D+V+  ++ A +  + P++
Sbjct:   32 ADRILGLRDEILAECPEAQVEGKVGRSGSFEVTINGKEVFSKLKQGGFPVCDEVVNSVIEACKGLDPPHV 101          
BLAST of SMED30011747 vs. Ensembl Medaka
Match: selenow2a (migration and invasion enhancer 1 [Source:NCBI gene;Acc:101155515])

HSP 1 Score: 55.4546 bits (132), Expect = 2.249e-10
Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = -3
Query:  208 GYANQYASLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 459
            GY  +Y  L + +  +    E S  VGR+ SFEI +N  LVFSKL+ GGFP  DDV+  ++    G+    IT  K  + C ++
Sbjct:    3 GYEPRYQDLASTVKDEFPEAEVSGFVGRS-SFEIQINGQLVFSKLELGGFPYEDDVLNAVQNAHDGKPVQKIT--KSRAPCVIM 83          
BLAST of SMED30011747 vs. Ensembl Medaka
Match: selenow2a (migration and invasion enhancer 1 [Source:NCBI gene;Acc:101155515])

HSP 1 Score: 52.7582 bits (125), Expect = 2.193e-9
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = -3
Query:  208 SLRNAINAQVTGIEWSCVVGRTTSFEITVNDILVFSKLKCGGFPVYDDVIQLLRAVQTGEKPYLITNFKPHSSCNVL 438
             L + +  +    E S  VGR+ SFEI +N  LVFSKL+ GGFP  DDV+  ++    G+    IT  K  + C ++
Sbjct:    7 DLASTVKDEFPEAEVSGFVGRSGSFEIQINGQLVFSKLELGGFPYEDDVLNAVQNAHDGKPVQKIT--KSRAPCVIM 81          
The following BLAST results are available for this feature:
BLAST of SMED30011747 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MIEN12.045e-1640.00migration and invasion enhancer 1 [Source:HGNC Sym... [more]
MIEN11.070e-1135.71migration and invasion enhancer 1 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011747 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG154561.442e-1134.38gene:FBgn0040650 transcript:FBtr0077323[more]
CG154561.442e-1134.38gene:FBgn0040650 transcript:FBtr0340402[more]
back to top
BLAST of SMED30011747 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
selenow2b5.397e-1844.83selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2a1.480e-1638.64selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2b4.655e-1441.38selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2a1.371e-1036.99selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mien11.363e-1239.51migration and invasion enhancer 1 [Source:NCBI gen... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mien12.283e-1541.67migration and invasion enhancer 1 [Source:MGI Symb... [more]
back to top
BLAST of SMED30011747 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9BRT3|MIEN1_HUMAN9.823e-1640.00Migration and invasion enhancer 1 OS=Homo sapiens ... [more]
sp|Q148C8|MIEN1_BOVIN1.093e-1542.05Migration and invasion enhancer 1 OS=Bos taurus OX... [more]
sp|Q9CQ86|MIEN1_MOUSE1.597e-1441.67Migration and invasion enhancer 1 OS=Mus musculus ... [more]
back to top
BLAST of SMED30011747 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7L4835.596e-1945.83Selenoprotein W2 OS=Artemia franciscana OX=6661 PE... [more]
Q802G83.960e-1542.70Selenoprotein W2b OS=Danio rerio OX=7955 GN=seleno... [more]
A0A1I8S7K11.208e-1444.83Selenoprotein W, 2b OS=Danio rerio OX=7955 GN=sele... [more]
V9L4J12.383e-1444.32Selenoprotein W, 2a OS=Callorhinchus milii OX=7868... [more]
L9JWM64.002e-1441.05Uncharacterized protein OS=Tupaia chinensis OX=246... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenow2a2.049e-1138.10selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011747 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011747 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450531.461e-940.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30011747 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
selenow2a2.249e-1038.10migration and invasion enhancer 1 [Source:NCBI gen... [more]
selenow2a2.193e-937.66migration and invasion enhancer 1 [Source:NCBI gen... [more]
back to top
BLAST of SMED30011747 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011747 ID=SMED30011747|Name=SMED30011747|organism=Schmidtea mediterranea sexual|type=transcript|length=545bp
TTTTATTCTATGTTCTCGTTTATTAGGTTAGAAATTAAGGAAATAATACA
AAATTTATCGATAAAATCCAAACATAAAATAGAAGCAATAAAATTATTGT
GTTTGTGCAGCAAAGTTGGTAAATCGTCACTAGTTGAGACCAAGCATCCA
ACAACCGATTGCAGAGCTCTCATCGATTGTCATCATTGAGGTCAACAGTG
AGCTTTACAAAACATTGCAAGATGAATGCGGCTTGAAGTTTGTGATCAAA
TATGGCTTCTCACCGGTTTGGACGGCGCGCAGCAATTGGATAACGTCGTC
ATAAACTGGAAATCCACCACATTTTAGCTTGGAGAACACTAGAATGTCAT
TAACCGTGATCTCAAACGAGGTTGTTCGGCCAACGACACAACTCCATTCA
ATGCCCGTCACTTGAGCATTGATGGCATTCCTCAAGCTGGCATATTGGTT
AGCGTAACCTCATGCCCCACAATATTCAACGTGAACTTTTAAAACAATTC
CTTCAGACATTTTGTATCAATTTGAAATGAATTTGTTTAGTTGGC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011893Selenoprotein_Rdx-typ
IPR012336Thioredoxin-like_fold