SMED30011746
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30011746 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 11
Alignments
SMED30011746 aligns in the following genomic locations:
Homology
BLAST of SMED30011746 vs. Ensembl Fly
Match: CG14483 (gene:FBgn0034248 transcript:FBtr0345525) HSP 1 Score: 42.743 bits (99), Expect = 9.890e-6 Identity = 16/43 (37.21%), Postives = 27/43 (62.79%), Query Frame = -2 Query: 247 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMY 375 MG W LEVA+M Y++FPV + +FN ++ K ++++Y Sbjct: 1 MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELY 43
BLAST of SMED30011746 vs. Ensembl Fly
Match: CG14483 (gene:FBgn0034248 transcript:FBtr0086902) HSP 1 Score: 42.743 bits (99), Expect = 9.890e-6 Identity = 16/43 (37.21%), Postives = 27/43 (62.79%), Query Frame = -2 Query: 247 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMY 375 MG W LEVA+M Y++FPV + +FN ++ K ++++Y Sbjct: 1 MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELY 43
BLAST of SMED30011746 vs. Ensembl Fly
Match: CG14483 (gene:FBgn0034248 transcript:FBtr0329863) HSP 1 Score: 42.743 bits (99), Expect = 9.890e-6 Identity = 16/43 (37.21%), Postives = 27/43 (62.79%), Query Frame = -2 Query: 247 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMY 375 MG W LEVA+M Y++FPV + +FN ++ K ++++Y Sbjct: 1 MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELY 43
BLAST of SMED30011746 vs. TrEMBL
Match: A0A5K3ETX6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 6.500e-6 Identity = 29/77 (37.66%), Postives = 44/77 (57.14%), Query Frame = -2 Query: 163 IFEILIMGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMYNELGIDFYSNDIVPLEEALAQKSIFDKL 393 IF I + GWK+E R+ YLS P+A + + N I + N YR D+Y G+D + +D+ + E L +K+ DKL Sbjct: 59 IFHIDLTMGWKMESLRLGLYLSIPLAAFTMSNWPSVIDHYHNAYRLDVYGRTGVDVFPSDVDSI-ETLQKKA--DKL 132
BLAST of SMED30011746 vs. TrEMBL
Match: A0A5B7HAC5 (Protein PET100, mitochondrial OS=Portunus trituberculatus OX=210409 GN=PET100 PE=4 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 9.820e-6 Identity = 21/46 (45.65%), Postives = 32/46 (69.57%), Query Frame = -2 Query: 238 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMYNEL 375 MGGWKLE+ +M+ Y+SFPV ++VFN K+ T + R+++Y L Sbjct: 1 MGGWKLEIGKMAMYMSFPVMLFYVFNQPKYFEEWTVRMRRELYPPL 46
BLAST of SMED30011746 vs. Planmine SMEST
Match: SMESG000036519.1 (SMESG000036519.1) HSP 1 Score: 154.066 bits (388), Expect = 4.254e-49 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = -2 Query: 157 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMYNELGIDFYSNDIVPLEEALAQKSIFDKLVK 375 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMYNELGIDFYSNDIVPLEEALAQKSIFDKLVK Sbjct: 1 MGGWKLEVARMSFYLSFPVACYFVFNSQKFITYCTNKYRQDMYNELGIDFYSNDIVPLEEALAQKSIFDKLVK 73 The following BLAST results are available for this feature:
BLAST of SMED30011746 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 3
BLAST of SMED30011746 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30011746 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30011746 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of SMED30011746 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30011746 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30011746 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30011746 ID=SMED30011746|Name=SMED30011746|organism=Schmidtea mediterranea sexual|type=transcript|length=565bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|