Furin-1

Overview
NameFurin-1
Smed IDSMED30011738
Length (bp)2237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Furin-1 (SMED30011738) t-SNE clustered cells

Violin plots show distribution of expression levels for Furin-1 (SMED30011738) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Furin-1 (SMED30011738) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Furin-1 (SMED30011738) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30011738h1SMcG0009156 dd_Smed_v4_10832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011738h1SMcG0009156 Contig48594newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011738h1SMcG0009156 Contig48594uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30011738h1SMcG0009156 dd_Smed_v4_10832_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Furin-1 vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 307/594 (51.68%), Postives = 398/594 (67.00%), Query Frame = 1
Query:  160 SQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            S    R  YT+ WAVQ+ G   +A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR +         NDP W  MWYL+  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T AC+++S +RV YLEHV  + S+   +RG+++++L+SPS + S+LL KR  D+++ GF +W FM+VH WGE+A G W L I    ++V        L  WSLILYGT   P H  ++  ++S+
Sbjct:   62 SAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMC--VAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSR 648          
BLAST of Furin-1 vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 306/589 (51.95%), Postives = 397/589 (67.40%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            R  YT+ WAVQ+ G   +A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR +         NDP W  MWYL+  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T AC+++S +RV YLEHV  + S+   +RG+++++L+SPS + S+LL KR  D+++ GF +W FM+VH WGE+A G W L I    ++V        L  WSLILYGT   P H  ++  ++S+
Sbjct:   67 RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMC--VAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSR 648          
BLAST of Furin-1 vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 307/594 (51.68%), Postives = 398/594 (67.00%), Query Frame = 1
Query:  160 SQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            S    R  YT+ WAVQ+ G   +A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR +         NDP W  MWYL+  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T AC+++S +RV YLEHV  + S+   +RG+++++L+SPS + S+LL KR  D+++ GF +W FM+VH WGE+A G W L I    ++V        L  WSLILYGT   P H  ++  ++S+
Sbjct:   62 SAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMC--VAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSR 648          
BLAST of Furin-1 vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 307/594 (51.68%), Postives = 398/594 (67.00%), Query Frame = 1
Query:  160 SQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            S    R  YT+ WAVQ+ G   +A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR +         NDP W  MWYL+  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T AC+++S +RV YLEHV  + S+   +RG+++++L+SPS + S+LL KR  D+++ GF +W FM+VH WGE+A G W L I    ++V        L  WSLILYGT   P H  ++  ++S+
Sbjct:   62 SAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMC--VAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSR 648          
BLAST of Furin-1 vs. Ensembl Human
Match: FURIN (furin, paired basic amino acid cleaving enzyme [Source:HGNC Symbol;Acc:HGNC:8568])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 303/597 (50.75%), Postives = 399/597 (66.83%), Query Frame = 1
Query:  121 VILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAE---VTLINWSLILYGT--DTLPSHRQNS---THTKSQ 1878
            V    +L    A +Q +    +T+TWAV+I G    A  +A  +GF+ L +I    Y F HR V+KRS+ P     S L  +P+V WLEQQ AK R KR +     DPK+ + WYL+ + + + +N+ +AW +GY G  +VVSILDDGIEK+HPDL  NYDP AS+D+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D+VE+ SL L   HI IYSASWGPEDDGKTVDGP  LA+ AF  G+ +GR GLGSIFVWASGNGG+ HD+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+ +E+ I+TTD+  +CTE H+GTSASAP AAGI AL L AN+ LTWRDMQHLVV T++ A+L A DW+TN  G++ SHS+G+GL+DAGAMV LA NWTTV  Q  C  +  +   P  +        ++T  AC        R LEH QA+++L   +RG++ + L+SP  + S LL  R +D ++ GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT  + LP   ++S   T T SQ
Sbjct:   11 VAATGTLVLLAADAQGQKV--FTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRD-LNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRY-----TQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKC--IIDILTEPKDIGKRLEVRKTVT--ACLGEPNHITR-LEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQ 594          
BLAST of Furin-1 vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 302/603 (50.08%), Postives = 386/603 (64.01%), Query Frame = 1
Query:  166 SESRGHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPS--IYSFKHRRVSKRSIYPSNYYQSN-LSDDPRVIWLEQQFAKVRVKRHIV--------------------------------NDPKWYKMWYLNKMNKENSM------NIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEV-LSITTDACSDNS-KKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTD 1833
            S  R  YT+ WAV+I  G V++A  LA  YG+  L  I+P    Y F+  R   RS   +    +N L  +  V+W+EQQ AK RVKR                                   NDP W  MWYLN+    +        N+  AW  GY G+ VVV+ILDDG+E+ HPD+  NYD  ASYD+   DN+P PRY  S+     +N HGTRCAG+VAA  NN +C VG+AY ANIGGIRMLDG+V+D+VE+ S+     +IDIYSASWGP+DDG+TVDGP +L + AFE GI  GR G GSIFVWASGNGGK+ D+CNCDGYTNSI+TL +++ +E G+ PWY+E CSSTLA TYSSG+  E+ I+TTD++H CT  H+GTSASAP AAGI ALAL AN  LTWRD+QH+V+ TA+  NLRA DW+TN  G+  SHSFG+GLMDAGAMV LA  W  V EQH C    P +   I   P  N + L + +D C   + + +V Y+EHVQA ++L++ KRG+++++L SPS + S LLTKR  D + +GF  W FM+ H WGE+A G W L I +    DAE  L+ W L+LYGTD
Sbjct:   52 SPMRRTYTNEWAVRIAGGKVEEANRLANKYGYTNLGPIIPGDEYYLFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRHTDDNDIFEEDDDGTQISKSRNRKHPDPNDPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDNDPMPRYEFSD-----ENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGDVTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGATGEKMILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAKPINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCRQFYPSRYKNI---PNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRARDTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDGWDDAE--LVKWELVLYGTD 644          
BLAST of Furin-1 vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 302/603 (50.08%), Postives = 386/603 (64.01%), Query Frame = 1
Query:  166 SESRGHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPS--IYSFKHRRVSKRSIYPSNYYQSN-LSDDPRVIWLEQQFAKVRVKRHIV--------------------------------NDPKWYKMWYLNKMNKENSM------NIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEV-LSITTDACSDNS-KKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTD 1833
            S  R  YT+ WAV+I  G V++A  LA  YG+  L  I+P    Y F+  R   RS   +    +N L  +  V+W+EQQ AK RVKR                                   NDP W  MWYLN+    +        N+  AW  GY G+ VVV+ILDDG+E+ HPD+  NYD  ASYD+   DN+P PRY  S+     +N HGTRCAG+VAA  NN +C VG+AY ANIGGIRMLDG+V+D+VE+ S+     +IDIYSASWGP+DDG+TVDGP +L + AFE GI  GR G GSIFVWASGNGGK+ D+CNCDGYTNSI+TL +++ +E G+ PWY+E CSSTLA TYSSG+  E+ I+TTD++H CT  H+GTSASAP AAGI ALAL AN  LTWRD+QH+V+ TA+  NLRA DW+TN  G+  SHSFG+GLMDAGAMV LA  W  V EQH C    P +   I   P  N + L + +D C   + + +V Y+EHVQA ++L++ KRG+++++L SPS + S LLTKR  D + +GF  W FM+ H WGE+A G W L I +    DAE  L+ W L+LYGTD
Sbjct:   52 SPMRRTYTNEWAVRIAGGKVEEANRLANKYGYTNLGPIIPGDEYYLFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRHTDDNDIFEEDDDGTQISKSRNRKHPDPNDPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDNDPMPRYEFSD-----ENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGDVTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGATGEKMILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAKPINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCRQFYPSRYKNI---PNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRARDTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDGWDDAE--LVKWELVLYGTD 644          
BLAST of Furin-1 vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 477.248 bits (1227), Expect = 1.947e-159
Identity = 269/584 (46.06%), Postives = 338/584 (57.88%), Query Frame = 1
Query:  229 ARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV-----------------------------------------NDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYD----AEVTLINWSLILYGT 1830
            AR +AA +      +     + F +   + R+          L   P V W+E+Q  K RVKR  +                                          DP +   WYL+        MN+  AW +GY G+NV VSILDDGI++DHPDL  NYDP AS DI  +D++P P+    NN    DN HGTRCAG+VAA A N  CGVGVA+KA IGG+RMLDG VSDSVE+ SL L   HIDIYSASWGPEDDGKT DGPG LA+ AF  GI  GR G G+IFVWASGNGG   D+C+ DGYT S++TL +++ +     PWY E+C S++A TYSS    + AI+T DV   CT++H+GTSASAP AAGI ALAL AN  LTWRDMQHLV+   R AN + ++    WS N  G+  S+ FG+GL+D GA+V++A  W TVPEQHIC Y   +   P          L+ T D     S   V YLEHVQ   ++R  KRG+++L L SPS + S LL  R  D  + GFH WPF+SV  WGE+  GTW L + S      A  T  +W+L+LYGT
Sbjct:   54 ARRIAADHDMHVKGDPFLDTHYFLYHSETTRTRRHKRAIVERLDSHPAVEWVEEQRPKKRVKRDYILLDNDVHHSNPFRRSVLNRDGTRRAQRQQPQSPREIPSLPFPDPLYKDQWYLHGGAVGGYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDDDPTPQ----NN---GDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLDGAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATTYSSADFRQPAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVL---RTANWKPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRL-ANPNPRPIVGRFQLNFTLDVNGCESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTWLLMVESVTTNPAATGTFHDWTLLLYGT 626          
BLAST of Furin-1 vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 477.248 bits (1227), Expect = 1.947e-159
Identity = 269/584 (46.06%), Postives = 338/584 (57.88%), Query Frame = 1
Query:  229 ARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV-----------------------------------------NDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYD----AEVTLINWSLILYGT 1830
            AR +AA +      +     + F +   + R+          L   P V W+E+Q  K RVKR  +                                          DP +   WYL+        MN+  AW +GY G+NV VSILDDGI++DHPDL  NYDP AS DI  +D++P P+    NN    DN HGTRCAG+VAA A N  CGVGVA+KA IGG+RMLDG VSDSVE+ SL L   HIDIYSASWGPEDDGKT DGPG LA+ AF  GI  GR G G+IFVWASGNGG   D+C+ DGYT S++TL +++ +     PWY E+C S++A TYSS    + AI+T DV   CT++H+GTSASAP AAGI ALAL AN  LTWRDMQHLV+   R AN + ++    WS N  G+  S+ FG+GL+D GA+V++A  W TVPEQHIC Y   +   P          L+ T D     S   V YLEHVQ   ++R  KRG+++L L SPS + S LL  R  D  + GFH WPF+SV  WGE+  GTW L + S      A  T  +W+L+LYGT
Sbjct:   54 ARRIAADHDMHVKGDPFLDTHYFLYHSETTRTRRHKRAIVERLDSHPAVEWVEEQRPKKRVKRDYILLDNDVHHSNPFRRSVLNRDGTRRAQRQQPQSPREIPSLPFPDPLYKDQWYLHGGAVGGYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDDDPTPQ----NN---GDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLDGAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATTYSSADFRQPAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVL---RTANWKPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRL-ANPNPRPIVGRFQLNFTLDVNGCESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTWLLMVESVTTNPAATGTFHDWTLLLYGT 626          
BLAST of Furin-1 vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 477.248 bits (1227), Expect = 2.734e-159
Identity = 269/584 (46.06%), Postives = 338/584 (57.88%), Query Frame = 1
Query:  229 ARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV-----------------------------------------NDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVD----WSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYD----AEVTLINWSLILYGT 1830
            AR +AA +      +     + F +   + R+          L   P V W+E+Q  K RVKR  +                                          DP +   WYL+        MN+  AW +GY G+NV VSILDDGI++DHPDL  NYDP AS DI  +D++P P+    NN    DN HGTRCAG+VAA A N  CGVGVA+KA IGG+RMLDG VSDSVE+ SL L   HIDIYSASWGPEDDGKT DGPG LA+ AF  GI  GR G G+IFVWASGNGG   D+C+ DGYT S++TL +++ +     PWY E+C S++A TYSS    + AI+T DV   CT++H+GTSASAP AAGI ALAL AN  LTWRDMQHLV+   R AN + ++    WS N  G+  S+ FG+GL+D GA+V++A  W TVPEQHIC Y   +   P          L+ T D     S   V YLEHVQ   ++R  KRG+++L L SPS + S LL  R  D  + GFH WPF+SV  WGE+  GTW L + S      A  T  +W+L+LYGT
Sbjct:   54 ARRIAADHDMHVKGDPFLDTHYFLYHSETTRTRRHKRAIVERLDSHPAVEWVEEQRPKKRVKRDYILLDNDVHHSNPFRRSVLNRDGTRRAQRQQPQSPREIPSLPFPDPLYKDQWYLHGGAVGGYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDDDPTPQ----NN---GDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLDGAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATTYSSADFRQPAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVL---RTANWKPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRL-ANPNPRPIVGRFQLNFTLDVNGCESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTWLLMVESVTTNPAATGTFHDWTLLLYGT 626          
BLAST of Furin-1 vs. Ensembl Fly
Match: Fur1 (gene:FBgn0004509 transcript:FBtr0336806)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 310/575 (53.91%), Postives = 392/575 (68.17%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGT 1830
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y     L  WSLI YGT
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMGHALLREWSLIFYGT 790          
BLAST of Furin-1 vs. Ensembl Fly
Match: Fur1 (gene:FBgn0004509 transcript:FBtr0089983)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 310/575 (53.91%), Postives = 392/575 (68.17%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGT 1830
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y     L  WSLI YGT
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMGHALLREWSLIFYGT 790          
BLAST of Furin-1 vs. Ensembl Fly
Match: Fur1 (gene:FBgn0004509 transcript:FBtr0089982)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 310/577 (53.73%), Postives = 396/577 (68.63%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTDT 1836
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y A++T   W +I YGT+T
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQIT--QWDMIFYGTET 790          
BLAST of Furin-1 vs. Ensembl Fly
Match: Fur1 (gene:FBgn0004509 transcript:FBtr0336805)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 310/577 (53.73%), Postives = 396/577 (68.63%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTDT 1836
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y A++T   W +I YGT+T
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQIT--QWDMIFYGTET 790          
BLAST of Furin-1 vs. Ensembl Fly
Match: Fur1 (gene:FBgn0004509 transcript:FBtr0336804)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 310/577 (53.73%), Postives = 396/577 (68.63%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTDT 1836
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y A++T   W +I YGT+T
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQIT--QWDMIFYGTET 790          
BLAST of Furin-1 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 300/571 (52.54%), Postives = 391/571 (68.48%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            YT+TWAV I G  ++A  +A  + FV    +    Y F+HR V KRS+         L  +P+V+W EQQ  K R KR +     DPK+ + WYL   +  + +N+ +AWK+G  GQ VVVSILDDGIEK+HPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA A+N ICGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHIDIYSASWGPEDDGKTVDGP +LAK AF+ G+++GR G GSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG ++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L   DW  N  G+  SHS+G+GL+DAGA+V LA NWT V  QH C  V  +   P ++  Y   V++ T DAC+  +   V  LEHVQA+++L   +RG + ++LISP  + S LL  R +D +S GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT +  S  ++ST   SQ
Sbjct:   30 YTNTWAVHIEGGEEEADRIARKHSFVNHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKRDVYYEPTDPKFAQQWYLYNQDHLD-LNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGEVTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGVNEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSNPAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKC--VLSLVSEPRNIGSYL--VINKTVDACTGMA-NFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPHDYSSEGFNDWAFMTTHSWDEDPRGEWTLEIKNVAGTSDYGTLTQFTLVLYGTAS--SLSRSSTAGSSQ 587          
BLAST of Furin-1 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 300/571 (52.54%), Postives = 391/571 (68.48%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            YT+TWAV I G  ++A  +A  + FV    +    Y F+HR V KRS+         L  +P+V+W EQQ  K R KR +     DPK+ + WYL   +  + +N+ +AWK+G  GQ VVVSILDDGIEK+HPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA A+N ICGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHIDIYSASWGPEDDGKTVDGP +LAK AF+ G+++GR G GSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG ++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L   DW  N  G+  SHS+G+GL+DAGA+V LA NWT V  QH C  V  +   P ++  Y   V++ T DAC+  +   V  LEHVQA+++L   +RG + ++LISP  + S LL  R +D +S GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT +  S  ++ST   SQ
Sbjct:   30 YTNTWAVHIEGGEEEADRIARKHSFVNHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKRDVYYEPTDPKFAQQWYLYNQDHLD-LNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGEVTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGVNEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSNPAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKC--VLSLVSEPRNIGSYL--VINKTVDACTGMA-NFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPHDYSSEGFNDWAFMTTHSWDEDPRGEWTLEIKNVAGTSDYGTLTQFTLVLYGTAS--SLSRSSTAGSSQ 587          
BLAST of Furin-1 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 300/571 (52.54%), Postives = 391/571 (68.48%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            YT+TWAV I G  ++A  +A  + FV    +    Y F+HR V KRS+         L  +P+V+W EQQ  K R KR +     DPK+ + WYL   +  + +N+ +AWK+G  GQ VVVSILDDGIEK+HPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA A+N ICGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHIDIYSASWGPEDDGKTVDGP +LAK AF+ G+++GR G GSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG ++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L   DW  N  G+  SHS+G+GL+DAGA+V LA NWT V  QH C  V  +   P ++  Y   V++ T DAC+  +   V  LEHVQA+++L   +RG + ++LISP  + S LL  R +D +S GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT +  S  ++ST   SQ
Sbjct:   30 YTNTWAVHIEGGEEEADRIARKHSFVNHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKRDVYYEPTDPKFAQQWYLYNQDHLD-LNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGEVTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGVNEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSNPAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKC--VLSLVSEPRNIGSYL--VINKTVDACTGMA-NFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPHDYSSEGFNDWAFMTTHSWDEDPRGEWTLEIKNVAGTSDYGTLTQFTLVLYGTAS--SLSRSSTAGSSQ 587          
BLAST of Furin-1 vs. Ensembl Zebrafish
Match: furinb (furin (paired basic amino acid cleaving enzyme) b [Source:ZFIN;Acc:ZDB-GENE-040901-2])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 298/572 (52.10%), Postives = 385/572 (67.31%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTI---YSYDAEVTLINWSLILYGTDTLPSHRQNSTHTK 1872
            +G Y +TWAV I G V++A  +A  +GFV   ++    Y F+HR V +RS+         L  +P+V+W EQQ AK R KR I     DPK+ + WYL   +    +N+  AW +G+ G+ VVV+ILDDGIEKDHPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHI IYSASWGPEDDGKTVDGP +LAK AF  G+ +GR+GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G  PWY+E CSSTLA TYSSG+++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN  LTWRDMQHLVV T+R A+L   DW TN  G+  SHS+G+GL+DA AMV LA NWT++  QH C  V  M   P  +K +     S + +ACS      V  LEHVQA+++L    RG + + LISP  + S LL  R  D ++ GF+ W FM+ H W E+  G W L I      +    L  ++LILYGT +  +    S +T+
Sbjct:   28 QGIYINTWAVHIEGGVEEAERIAQKHGFVSHGQVFGDFYHFQHRGVVRRSLSSHRGVHVRLHTEPQVLWAEQQIAKRRRKRDIHMEPTDPKFPQQWYLYNPS-HGDLNVKEAWAQGFTGRGVVVTILDDGIEKDHPDLAKNYDPDASYDVNDRDPDPQPRY-----TQLNDNRHGTRCAGEVAAAANNGVCGVGVAYNAKIGGVRMLDGEVTDVVEAQSLSLNSQHIHIYSASWGPEDDGKTVDGPAKLAKEAFLQGVTEGRSGLGSIFVWASGNGGRERDSCNCDGYTNSIYTLSISSTTQYGSVPWYSEACSSTLATTYSSGNLNEKQIVTTDLRKKCTDSHTGTSASAPLAAGIIALALEANMNLTWRDMQHLVVRTSRPAHLITNDWRTNGVGRLVSHSYGYGLLDATAMVALAQNWTSMGPQHKC--VINMLTEPRDIKNHL--TFSRSVEACS-GQPDFVSSLEHVQARLTLSYNHRGNLAVHLISPLGTRSTLLAPRPQDNSAEGFNDWAFMTTHSWDEDPRGEWTLEIENVAGLNDYGVLSQFTLILYGTGSSATDPSVSDYTR 588          
BLAST of Furin-1 vs. Ensembl Zebrafish
Match: CR383678.1 (proprotein convertase subtilisin/kexin type 5a [Source:NCBI gene;Acc:571235])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 292/593 (49.24%), Postives = 381/593 (64.25%), Query Frame = 1
Query:  121 VILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---------NDPKWYKMWYLN-KMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDA-------EVTLINWSLILYGTDTLP 1842
             I F     FG   Q      YT+ WAV+I G  + A ++A  YGFV + +I  +   Y F+H  + KRS   S    S ++ + +V W++QQ  + RVKR            NDPKW  MWY++   N    MNI +AW++GY G+ VVVSILDDGIE+ HPDLK+NYD  ASYD+  ND +P PRY  +N     +N HGTRCAG VAA+ANN +C VG+AY A IGG+RMLDG+++D VE+ SL L  Q+IDIYS+SWGP+DDG+TVDGPG LA++A E+GI KGR G GSIFVWASGNGG++ D+C+CDGYTNSI+T+ V + ++ G  PWY E+CSSTLA TYSSG      ++TTD+   CT++HSGTSASAP AAGI AL L AN  LTWRD+QH++V T+ + +L A DW +N AG + SH +GFGL++A AMV  A  W  VP QHIC          IS +     VL   +  CS    +RV YLEHV  ++++    RG++ + L SPS +TS+LL  R ND +S GF  W FM+ H WGE + G W L I    +       +  L+ WSL+LYGT T P
Sbjct:    4 TIFFPYALFFGIGLQCVQMRLYTNRWAVKITGGPEAADLIAEKYGFVNMGQIGGLVDHYQFQHSGIIKRSTIKSKGNHSLITMETKVEWIQQQMVQKRVKRTETMDQTHDGSFNDPKWDSMWYIHCDHNCLTDMNIQAAWRRGYTGKGVVVSILDDGIERQHPDLKQNYDARASYDVNGNDPDPTPRYDVTN-----ENKHGTRCAGVVAASANNSLCIVGIAYNAKIGGVRMLDGDMTDMVEAQSLNLRQQYIDIYSSSWGPDDDGRTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQSQDHCSCDGYTNSIYTISVGSTTQSGRKPWYLEECSSTLATTYSSGDSHSPGVVTTDLRQRCTDEHSGTSASAPMAAGIIALTLEANPALTWRDIQHIIVKTSSRGHLSASDWQSNGAGYDVSHLYGFGLLNAEAMVKNAETWKQVPSQHICEENIGQNARIISPERVLRSVLK--SSGCSAQRLQRVVYLEHVIVRVTITHPHRGDLSITLTSPSGTTSQLLANRPNDHSSEGFIKWEFMTTHCWGERSAGDWILDIRDTPSPQRNTRLQGKLVEWSLVLYGTSTHP 589          
BLAST of Furin-1 vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 299/587 (50.94%), Postives = 399/587 (67.97%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTK 1872
            R  +++ WAV+I G  + A  LAA YG++ L +I  + + Y F H R  KRS Y S    S L   P+V W++QQ  K RVKRH+         NDP W  MWYL+  +K     + MN++SAW++GY G+NVVVSILDDG+EK+HPDL +NYDP+AS+D+  +D +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYS+SWGP+DDGKTVDGPG LA+ AFEDGI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ +++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L WRD+QHL+V T+R  +LRA DW TN AG++ SH +GFGL+DA AMV  A  W TVP QH+C  +      P  ++       +  T+AC DN+   V YLEHV  ++++   +RG+++++LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L I+   +++        L  W+LI YGT   P +   + H++
Sbjct:   22 RTVFSNHWAVRIPGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKRHVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRSEMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASN-----ENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVC--IGASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSR 601          
BLAST of Furin-1 vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 299/587 (50.94%), Postives = 399/587 (67.97%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTK 1872
            R  +++ WAV+I G  + A  LAA YG++ L +I  + + Y F H R  KRS Y S    S L   P+V W++QQ  K RVKRH+         NDP W  MWYL+  +K     + MN++SAW++GY G+NVVVSILDDG+EK+HPDL +NYDP+AS+D+  +D +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYS+SWGP+DDGKTVDGPG LA+ AFEDGI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ +++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L WRD+QHL+V T+R  +LRA DW TN AG++ SH +GFGL+DA AMV  A  W TVP QH+C  +      P  ++       +  T+AC DN+   V YLEHV  ++++   +RG+++++LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L I+   +++        L  W+LI YGT   P +   + H++
Sbjct:   43 RTVFSNHWAVRIPGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKRHVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRSEMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASN-----ENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVC--IGASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSR 622          
BLAST of Furin-1 vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 299/587 (50.94%), Postives = 399/587 (67.97%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTK 1872
            R  +++ WAV+I G  + A  LAA YG++ L +I  + + Y F H R  KRS Y S    S L   P+V W++QQ  K RVKRH+         NDP W  MWYL+  +K     + MN++SAW++GY G+NVVVSILDDG+EK+HPDL +NYDP+AS+D+  +D +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYS+SWGP+DDGKTVDGPG LA+ AFEDGI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ +++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L WRD+QHL+V T+R  +LRA DW TN AG++ SH +GFGL+DA AMV  A  W TVP QH+C  +      P  ++       +  T+AC DN+   V YLEHV  ++++   +RG+++++LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L I+   +++        L  W+LI YGT   P +   + H++
Sbjct:   31 RTVFSNHWAVRIPGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKRHVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRSEMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASN-----ENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVC--IGASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSR 610          
BLAST of Furin-1 vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 299/587 (50.94%), Postives = 399/587 (67.97%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTK 1872
            R  +++ WAV+I G  + A  LAA YG++ L +I  + + Y F H R  KRS Y S    S L   P+V W++QQ  K RVKRH+         NDP W  MWYL+  +K     + MN++SAW++GY G+NVVVSILDDG+EK+HPDL +NYDP+AS+D+  +D +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYS+SWGP+DDGKTVDGPG LA+ AFEDGI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ +++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L WRD+QHL+V T+R  +LRA DW TN AG++ SH +GFGL+DA AMV  A  W TVP QH+C  +      P  ++       +  T+AC DN+   V YLEHV  ++++   +RG+++++LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L I+   +++        L  W+LI YGT   P +   + H++
Sbjct:   27 RTVFSNHWAVRIPGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKRHVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRSEMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASN-----ENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVC--IGASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSR 606          
BLAST of Furin-1 vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 299/587 (50.94%), Postives = 399/587 (67.97%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTK 1872
            R  +++ WAV+I G  + A  LAA YG++ L +I  + + Y F H R  KRS Y S    S L   P+V W++QQ  K RVKRH+         NDP W  MWYL+  +K     + MN++SAW++GY G+NVVVSILDDG+EK+HPDL +NYDP+AS+D+  +D +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYS+SWGP+DDGKTVDGPG LA+ AFEDGI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ +++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L WRD+QHL+V T+R  +LRA DW TN AG++ SH +GFGL+DA AMV  A  W TVP QH+C  +      P  ++       +  T+AC DN+   V YLEHV  ++++   +RG+++++LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L I+   +++        L  W+LI YGT   P +   + H++
Sbjct:   22 RTVFSNHWAVRIPGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKRHVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRSEMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASN-----ENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVC--IGASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSR 601          
BLAST of Furin-1 vs. Ensembl Mouse
Match: Pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:MGI Symbol;Acc:MGI:102897])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 309/592 (52.20%), Postives = 397/592 (67.06%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVP 1902
            YT+ WAVQ+ G    A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR         NDP W  MWY++  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D+C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T+AC+D+S +RV YLEHV  +IS+   +RG++++ LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L +    ++V        L  WSLILYGT   P +R  S+H    +    +VP
Sbjct:   62 YTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHCTDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHVC--VATADKRPRSIPIVQVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHP-YRTFSSHQSRSRMLELSVP 645          
BLAST of Furin-1 vs. Ensembl Mouse
Match: Pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:MGI Symbol;Acc:MGI:102897])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 309/592 (52.20%), Postives = 397/592 (67.06%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVP 1902
            YT+ WAVQ+ G    A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR         NDP W  MWY++  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D+C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T+AC+D+S +RV YLEHV  +IS+   +RG++++ LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L +    ++V        L  WSLILYGT   P +R  S+H    +    +VP
Sbjct:   62 YTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHCTDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHVC--VATADKRPRSIPIVQVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHP-YRTFSSHQSRSRMLELSVP 645          
BLAST of Furin-1 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 298/576 (51.74%), Postives = 386/576 (67.01%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAE---VTLINWSLILYGT-----DTLPSHRQNSTHTKSQ 1878
            +T+TWAV I G    A  +A  +GF  L +I    Y F HR V+KRS+ P     S L  +P+V WLEQQ AK R KR +     DPK+ + WYL+ + + + +N+  AW +G+ G  +VVSILDDGIEK+HPDL  NYDP AS+D+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D+VE+ SL L   HI IYSASWGPEDDGKTVDGP  LA+ AF  G+ +GR GLGSIFVWASGNGG+ HD+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+ +E+ I+TTD+  +CTE H+GTSASAP AAGI AL L AN+ LTWRDMQHLVV T++ A+L A DW+TN  G++ SHS+G+GL+DAGAMV LA NWTTV  Q  C     ++   I  +    + ++    AC        R LEHVQA+++L   +RG++ + LISP  + S LL  R +D ++ GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT      T P      T T SQ
Sbjct:   30 FTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRD-LNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRY-----TQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT----ACLGEPNHITR-LEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQ 594          
BLAST of Furin-1 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 298/576 (51.74%), Postives = 386/576 (67.01%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAE---VTLINWSLILYGT-----DTLPSHRQNSTHTKSQ 1878
            +T+TWAV I G    A  +A  +GF  L +I    Y F HR V+KRS+ P     S L  +P+V WLEQQ AK R KR +     DPK+ + WYL+ + + + +N+  AW +G+ G  +VVSILDDGIEK+HPDL  NYDP AS+D+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D+VE+ SL L   HI IYSASWGPEDDGKTVDGP  LA+ AF  G+ +GR GLGSIFVWASGNGG+ HD+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+ +E+ I+TTD+  +CTE H+GTSASAP AAGI AL L AN+ LTWRDMQHLVV T++ A+L A DW+TN  G++ SHS+G+GL+DAGAMV LA NWTTV  Q  C     ++   I  +    + ++    AC        R LEHVQA+++L   +RG++ + LISP  + S LL  R +D ++ GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT      T P      T T SQ
Sbjct:   30 FTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRD-LNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRY-----TQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT----ACLGEPNHITR-LEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQ 594          
BLAST of Furin-1 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 298/576 (51.74%), Postives = 386/576 (67.01%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAE---VTLINWSLILYGT-----DTLPSHRQNSTHTKSQ 1878
            +T+TWAV I G    A  +A  +GF  L +I    Y F HR V+KRS+ P     S L  +P+V WLEQQ AK R KR +     DPK+ + WYL+ + + + +N+  AW +G+ G  +VVSILDDGIEK+HPDL  NYDP AS+D+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D+VE+ SL L   HI IYSASWGPEDDGKTVDGP  LA+ AF  G+ +GR GLGSIFVWASGNGG+ HD+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+ +E+ I+TTD+  +CTE H+GTSASAP AAGI AL L AN+ LTWRDMQHLVV T++ A+L A DW+TN  G++ SHS+G+GL+DAGAMV LA NWTTV  Q  C     ++   I  +    + ++    AC        R LEHVQA+++L   +RG++ + LISP  + S LL  R +D ++ GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT      T P      T T SQ
Sbjct:   30 FTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRD-LNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRY-----TQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT----ACLGEPNHITR-LEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQ 594          
BLAST of Furin-1 vs. UniProt/SwissProt
Match: sp|P26016|FUR11_DROME (Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 310/575 (53.91%), Postives = 392/575 (68.17%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGT 1830
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y     L  WSLI YGT
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMGHALLREWSLIFYGT 790          
BLAST of Furin-1 vs. UniProt/SwissProt
Match: sp|P30430|FUR1C_DROME (Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 310/577 (53.73%), Postives = 396/577 (68.63%), Query Frame = 1
Query:  178 GHYTDTWAVQI-NGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV--------------------NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS---YDAEVTLINWSLILYGTDT 1836
            GHYT TWAV I NG    A  +A  +GFV L +I    Y F H +VSKRS+ P+ ++Q+ L DD RV W +QQ AK R KR  +                    ND KW +MWYLN+    + MN+I AWK G  G+ VVV+ILDDG+E DHPD+++NYDP ASYD+ S+D++P P Y  +++     N HGTRCAG+VAATANN  C VG+AY A++GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGPGELA  AF +G  KGR G GSIF+WASGNGG+  DNCNCDGYTNSI+TL +++ +E G  PWY+EKCSSTLA TYSSG   E+ ++TTD++H CT  H+GTSASAP AAGI AL L +N+ LTWRD+QH+VV TA+ ANL+   WS N  G+  SHSFG+GLMDA  MV +A NW  VPEQ  C   AP     I   P  +  L +T + C     + V YLEHVQAKI+L S +RG+++L+L SP+ ++  LLT R +D + +GF+ WPFMSVH WGE   G W+L I++   Y A++T   W +I YGT+T
Sbjct:  229 GHYTHTWAVHIPNGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQQRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLD-MNVIPAWKMGITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDS-----NRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRCEINAPHVDKVI--PPRTHITLQLTVNHC-----RSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQIT--QWDMIFYGTET 790          
BLAST of Furin-1 vs. UniProt/SwissProt
Match: sp|Q63415|PCSK6_RAT (Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus OX=10116 GN=Pcsk6 PE=1 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 309/592 (52.20%), Postives = 397/592 (67.06%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVP 1902
            YT+ WAVQ+ G    A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR         NDP W  MWY++  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D+C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T+AC+D+S +RV YLEHV  +IS+   +RG++++ LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A G W L +    ++V        L  WSLILYGT   P +R  S+H    +    +VP
Sbjct:   53 YTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHCADKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHMC--VATADKRPRSIPVVQVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHP-YRTFSSHQSRSRMLELSVP 636          
BLAST of Furin-1 vs. UniProt/SwissProt
Match: sp|P29122|PCSK6_HUMAN (Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 306/589 (51.95%), Postives = 397/589 (67.40%), Query Frame = 1
Query:  175 RGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLPSHRQNSTHTKSQ 1878
            R  YT+ WAVQ+ G   +A  +AA +G++ L +I  +   Y F H +  KRS   S    + L  DP+V WL+QQ  K RVKR +         NDP W  MWYL+  +K     + MN+ +AWK+GY G+NVVV+ILDDGIE++HPDL  NYD  ASYD+  ND +P PRY +SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D C+CDGYTNSI+T+ V++ +E G  PWY E+C+STLA TYSSG+  ER I+TTD+   CT+ H+GTS SAP  AGI ALAL AN  LTWRD+QHL+V T+R A+L+A DW  N AG + SH +GFGL+DA A+V  A  WT VP QH+C  VA     P S+        +  T AC+++S +RV YLEHV  + S+   +RG+++++L+SPS + S+LL KR  D+++ GF +W FM+VH WGE+A G W L I    ++V        L  WSLILYGT   P H  ++  ++S+
Sbjct:   67 RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN-----ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMC--VAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSR 648          
BLAST of Furin-1 vs. UniProt/SwissProt
Match: sp|P09958|FURIN_HUMAN (Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 303/597 (50.75%), Postives = 399/597 (66.83%), Query Frame = 1
Query:  121 VILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAE---VTLINWSLILYGT--DTLPSHRQNS---THTKSQ 1878
            V    +L    A +Q +    +T+TWAV+I G    A  +A  +GF+ L +I    Y F HR V+KRS+ P     S L  +P+V WLEQQ AK R KR +     DPK+ + WYL+ + + + +N+ +AW +GY G  +VVSILDDGIEK+HPDL  NYDP AS+D+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D+VE+ SL L   HI IYSASWGPEDDGKTVDGP  LA+ AF  G+ +GR GLGSIFVWASGNGG+ HD+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+ +E+ I+TTD+  +CTE H+GTSASAP AAGI AL L AN+ LTWRDMQHLVV T++ A+L A DW+TN  G++ SHS+G+GL+DAGAMV LA NWTTV  Q  C  +  +   P  +        ++T  AC        R LEH QA+++L   +RG++ + L+SP  + S LL  R +D ++ GF+ W FM+ H W E+  G W L I +        TL  ++L+LYGT  + LP   ++S   T T SQ
Sbjct:   11 VAATGTLVLLAADAQGQKV--FTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRD-LNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRY-----TQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKC--IIDILTEPKDIGKRLEVRKTVT--ACLGEPNHITR-LEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQ 594          
BLAST of Furin-1 vs. TrEMBL
Match: A0A5K4FDH6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 364/629 (57.87%), Postives = 458/629 (72.81%), Query Frame = 1
Query:   94 YEYIVMKCFVILFSSLFCFGAKSQS------------------ESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDAC------SDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKN 1896
            Y+   + C +++   L C    +Q+                  + +  YT  WAV+I G    AR +A  YGF++L EI+P IY FKH R+SKRS+  +NYY   L++D +V+WLEQQ AKVRVKR +   V+DPKW +MWYLN+       MN+ S W +GY GQ+VVV+ILDDG+E DHPDLK+NYDP ASYD+ SND+NPEPRY++ +  K   N HGTRCAG+VAA ANN +CG+G+AY+A IGG+RMLDG+V+D++ES SL    QHID+YSASWGPEDDGKTVDGPG+LA++AF +GI  GR GLGSIFVWASGNGG +HDNCNCDGYTNSI+TLGV +VSE G  PWYAE CSSTLAVTYSSG   ER +ITTD+NH CT+ HSGTSASAP AAGICAL LSAN  LTWRD+Q+LVV TAR   L A DW  N  G+  SH+FG+GLMDA AMVDLALNWT VP Q +C   APM G PI+++  + E L++TTD C      + +   RV +LEHVQAK++L S +RGE+ELWL SP+ + S+LL+KR  D+  AGFH WPFMSVH+WGE A GTWKLT+ S +A V++ +WSLILYGT+T P    +S+H +  ++ P+N
Sbjct:   19 YKICSLVCIILVTVRLCCCTTNNQTIPKQNASTSPELSDLPHNKRKALYTPYWAVEIKGGEKAARAIAEKYGFLYLGEILPGIYHFKHNRISKRSLRQNNYYHDQLANDEQVVWLEQQVAKVRVKRDVHIPVSDPKWPQMWYLNRGGPGGLDMNVRSVWARGYAGQSVVVTILDDGLETDHPDLKDNYDPFASYDVNSNDDNPEPRYLTRD--KSNTNRHGTRCAGEVAAAANNSVCGLGIAYRARIGGVRMLDGDVTDAMESRSLSHQLQHIDVYSASWGPEDDGKTVDGPGKLAQMAFRNGIQMGRRGLGSIFVWASGNGGTSHDNCNCDGYTNSIYTLGVGSVSEHGSVPWYAELCSSTLAVTYSSGGRGERGVITTDLNHTCTDNHSGTSASAPLAAGICALTLSANPNLTWRDLQYLVVYTARPDGLYADDWHVNGVGRRVSHAFGYGLMDAAAMVDLALNWTNVPPQRVCEAQAPMTGSPITIRQMSKENLALTTDGCESAAALAGDLSHRVVHLEHVQAKVTLSSAQRGEIELWLTSPAGTISQLLSKRPKDIDVAGFHAWPFMSVHYWGELANGTWKLTVKSGNAVVSIHDWSLILYGTNTPPPSVPSSSHRRGVRQLPRN 645          
BLAST of Furin-1 vs. TrEMBL
Match: A0A4E0RKD3 (Furin OS=Fasciola hepatica OX=6192 GN=D915_000368 PE=3 SV=1)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 358/588 (60.88%), Postives = 439/588 (74.66%), Query Frame = 1
Query:  160 SQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSD------NSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPK 1893
            + SE +  +T  WAV++ G  + AR +A  YGF ++ EIMP IY FK  R+SKRSIY S YY   L +DP+V+W EQQ  K RVKR +   VNDP W  MWYLN+       MN+ SAW +GY GQ+VVV+ILDDG+E DHPDLKENYDP ASYD+  ND+NPEPRY   ++     N HGTRCAG+VAA ANN +CG+G+AY+A IGG+RMLDG+VSD++ES SL    QHID+YSASWGPEDDGKTVDGPG LA++AF +GI  GR GLGSIFVWASGNGGK+ DNCNCDGYTNSI+TLGV++ SE G  PWYAE CSSTL VTYSSG   ER +ITTD+NH CT  HSGTSASAP AAGICA+ LSAN  LTWRD+Q+LVV TAR   L A DW  N  G+  SH+FG+GLMDAGAMVDLALNWT VP Q +C   AP+ GGP+S++P + E L++TTD C+       +  +RV YLEHVQAK+++ S +RGE+ELWL SPS + SKLL+KR  D+  AGFH WPFMSVH+WGE A GTWKLT++S  A V++ +W LILYGT+T P    +++H +  ++ PK
Sbjct:   63 TSSEKKPIFTPFWAVELQGGEEAAREIANKYGFTYIGEIMPGIYHFKQSRLSKRSIYHSIYYHDQLVEDPKVLWAEQQVVKTRVKRDVHIPVNDPHWPHMWYLNRGGSGGLDMNVRSAWARGYAGQDVVVTILDDGLETDHPDLKENYDPFASYDVNGNDDNPEPRY---HDKVTASNRHGTRCAGEVAAVANNSLCGLGIAYRARIGGVRMLDGDVSDAMESRSLGHQLQHIDVYSASWGPEDDGKTVDGPGRLAQLAFRNGIQMGRGGLGSIFVWASGNGGKSGDNCNCDGYTNSIYTLGVSSASEHGSVPWYAEMCSSTLTVTYSSGGHGERGVITTDLNHTCTNNHSGTSASAPLAAGICAVTLSANPRLTWRDLQYLVVYTARPDGLYADDWRVNGVGRRVSHAFGYGLMDAGAMVDLALNWTNVPPQRVCEAQAPITGGPVSVRPMSRENLALTTDGCASAAARAGDPSQRVVYLEHVQAKVTVSSAQRGEIELWLTSPSGTVSKLLSKRPKDIEVAGFHAWPFMSVHYWGELANGTWKLTVHSGKAAVSIHDWILILYGTNT-PPPMHDASHRRGVRQLPK 646          
BLAST of Furin-1 vs. TrEMBL
Match: G7YU09 (Furin OS=Clonorchis sinensis OX=79923 GN=CLF_110890 PE=3 SV=1)

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 361/581 (62.13%), Postives = 439/581 (75.56%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSK------KRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKN 1896
            +T  WAV+I    + AR +A  +GF+FL  I+P IY  K  R+S+RS++ S +Y   L++DPRV+WLEQQ AKVRVKR +   VNDP W  MWYLN+       MN+ SAW +GY GQ+VVV+ILDDG+E DHPDLKENYDP ASYD+  ND NPEPRY SS+      N HGTRCAG+VAA ANN ICG+G+AY+A IGG+RMLDG+VSD++ES SL    QHID+YSASWGPEDDGKTVDGPG LA++AF +GI+ GR GLGSIFVWASGNGGKN DNCNCDGYTNSI+TLGV++VSE G  PWYAE CSSTLAVTYSSG  +ER +ITTD+NH CT  HSGTSASAP AAGICAL LSAN+ LTWRD+Q+LVV TAR   L A DW  N  G+  SH+FG+GLMDAGAMVDLA+NWT VP Q +C   AP+ GGP+S++  + EVL++TTD C+  +       + V YLEHVQAK+++ S +RGE+EL L SPS + S LL+KR  D+  AGFH WPFMSVHFWGE A GTWKLT+YS  A V++ +W LILYGT+T P     S+H +  ++ PKN
Sbjct:   70 FTRYWAVEILEGEEVAREVAEKHGFIFLGTILPGIYYMKQPRLSRRSVHHSIHYHDQLANDPRVVWLEQQVAKVRVKRDVHIPVNDPHWADMWYLNRGGPNGLDMNVRSAWARGYAGQDVVVTILDDGLEIDHPDLKENYDPFASYDVNGNDANPEPRYPSSDKNP-ASNRHGTRCAGEVAAVANNSICGLGIAYRARIGGVRMLDGDVSDAMESRSLGYQLQHIDVYSASWGPEDDGKTVDGPGRLAQMAFRNGIVMGRGGLGSIFVWASGNGGKNGDNCNCDGYTNSIYTLGVSSVSERGSVPWYAEMCSSTLAVTYSSGGQEERGVITTDLNHTCTRNHSGTSASAPLAAGICALTLSANKRLTWRDLQYLVVYTARPEGLNASDWRVNGVGRSVSHAFGYGLMDAGAMVDLAINWTNVPPQRVCEAQAPITGGPVSVQRMSKEVLALTTDGCASTAAFAGDPTQCVVYLEHVQAKVTVSSAQRGEIELRLTSPSGTESILLSKRPKDMDVAGFHAWPFMSVHFWGEMANGTWKLTVYSGKASVSIHDWILILYGTNT-PPPLHASSHRRGVRQLPKN 648          
BLAST of Furin-1 vs. TrEMBL
Match: A0A074Z5Y0 (P/Homo B domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_09434 PE=3 SV=1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 366/600 (61.00%), Postives = 444/600 (74.00%), Query Frame = 1
Query:  133 SSLFCFGAKSQSESRGH--YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSK------KRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKN 1896
            S  F  GA       G   +T  WAV+I    + AR +A  +GF+FL  I+P IY  K  R+S+RS++ S +Y   L++DPRV+WLEQQ AKVRVKR +   VNDP W  MWYLN+       MN+ SAW +GY GQ+VVV+ILDDG+E DHPDLKENYDP ASYD+  ND NPEPRY SS+      N HGTRCAG+VAA ANN ICG+G+AY+A IGG+RMLDG+VSD++ES SL    QHID+YSASWGPEDDGKTVDGPG LA++AF +GI+ GR GLGSIFVWASGNGGKN DNCNCDGYTNSI+TLGV++VSE G  PWYAE CSSTLAVTYSSG  +ER +ITTD+NH CT  HSGTSASAP AAGICAL LSAN+ LTWRD+Q+LVV TAR   L A DW  N  G+  SH+FG+GLMDAGAMVDLA+NWT VP Q +C   AP+ GGP+S++  + EVL++TTD C+  +       + V YLEHVQAK+++ S +RGE+EL L SPS + S LL+KR  D+  AGFH WPFMSVHFWGE A GTWKLT+YS  A V++ +W LILYGT+T P     S+H +  ++ PKN
Sbjct:   51 SMTFADGAAQHVSESGSPIFTRYWAVEILEGEEVAREVAEKHGFIFLGTILPGIYYMKQPRLSRRSVHHSIHYHDQLANDPRVVWLEQQVAKVRVKRDVHIPVNDPHWADMWYLNRGGPNGLDMNVRSAWARGYAGQDVVVTILDDGLEIDHPDLKENYDPFASYDVNGNDANPEPRYPSSDKNP-ASNRHGTRCAGEVAAVANNSICGLGIAYRARIGGVRMLDGDVSDAMESRSLGYQLQHIDVYSASWGPEDDGKTVDGPGRLAQMAFRNGIVMGRGGLGSIFVWASGNGGKNGDNCNCDGYTNSIYTLGVSSVSERGSVPWYAEMCSSTLAVTYSSGGQEERGVITTDLNHTCTRNHSGTSASAPLAAGICALTLSANKRLTWRDLQYLVVYTARPEGLNASDWRVNGVGRSVSHAFGYGLMDAGAMVDLAINWTNVPPQRVCEAQAPITGGPVSVQRMSKEVLALTTDGCASTAAFAGDPTQCVVYLEHVQAKVTVSSAQRGEIELRLTSPSGTESILLSKRPKDMDVAGFHAWPFMSVHFWGEMANGTWKLTVYSGKASVSIHDWILILYGTNT-PPPLHASSHRRGVRQLPKN 648          
BLAST of Furin-1 vs. TrEMBL
Match: A0A4S2L075 (P/Homo B domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010212 PE=3 SV=1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 360/581 (61.96%), Postives = 439/581 (75.56%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI---VNDPKWYKMWYLNKMNKEN-SMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSK------KRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKN 1896
            +T  WAV+I    + AR +A  +GF+FL  I+P IY  K  R+S+RS++ S +Y   L++DPRV+WLEQQ AKVRVKR +   VNDP W  MWYLN+       MN+ SAW +GY GQ+VVV+ILDDG+E DHPDLKENYDP ASYD+  ND NPEPRY SS+      N HGTRCAG+VAA ANN ICG+G+AY+A IGG+RMLDG+VSD++ES SL    QHID+YSASWGPEDDGKTVDGPG LA++AF +GI+ GR GLGSIFVWASGNGGKN DNCNCDGYTNSI+TLGV++VSE G  PWYAE CSSTLAVTYSSG  +ER +ITTD+NH CT  HSGTSASAP AAGICAL LSAN+ LTWRD+Q+LVV TAR   L A DW  N  G+  SH+FG+GLMDAGAMVDLA+NW+ VP Q +C   AP+ GGP+S++  + EVL++TTD C+  +       + V YLEHVQAK+++ S +RGE+EL L SPS + S LL+KR  D+  AGFH WPFMSVHFWGE A GTWKLT+YS  A V++ +W LILYGT+T P     S+H +  ++ PKN
Sbjct:   70 FTRYWAVEILEGEEVAREVAEKHGFIFLGTILPGIYYMKQPRLSRRSVHHSIHYHDQLANDPRVVWLEQQVAKVRVKRDVHIPVNDPHWADMWYLNRGGPNGLDMNVRSAWARGYAGQDVVVTILDDGLEIDHPDLKENYDPFASYDVNGNDANPEPRYPSSDKNP-ASNRHGTRCAGEVAAVANNSICGLGIAYRARIGGVRMLDGDVSDAMESRSLGYQLQHIDVYSASWGPEDDGKTVDGPGRLAQMAFRNGIVMGRGGLGSIFVWASGNGGKNGDNCNCDGYTNSIYTLGVSSVSERGSVPWYAEMCSSTLAVTYSSGGQEERGVITTDLNHTCTRNHSGTSASAPLAAGICALTLSANKRLTWRDLQYLVVYTARPEGLNASDWRVNGVGRSVSHAFGYGLMDAGAMVDLAINWSNVPPQRVCEAQAPITGGPVSVQRMSKEVLALTTDGCASTAAFAGDPTQCVVYLEHVQAKVTVSSAQRGEIELRLTSPSGTESILLSKRPKDMDVAGFHAWPFMSVHFWGEMANGTWKLTVYSGKASVSIHDWILILYGTNT-PPPLHASSHRRGVRQLPKN 648          
BLAST of Furin-1 vs. Ensembl Cavefish
Match: pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:NCBI gene;Acc:103021799])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 301/593 (50.76%), Postives = 398/593 (67.12%), Query Frame = 1
Query:  124 ILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK---ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLP 1842
            + F  L  F     S SR  +T+ WAV++ G  ++A  LA+ YGF  L +I  +   Y F H RV +RS + +    S +  DP+V W++QQ  K RVKR+          NDPKW  MWY++  +     + MNI++AW++GY G+N+V++ILDDGIE++HPDL  NYD  ASYD+  ND++P PRY SSN     +N HGTRCAG+VAA ANN  C VG+A+ A IGGIRMLDG+V+D VE+ SL +   +IDIYSASWGP+DDGKTVDGPG LAK AFE GI KGR GLGSIFVWASGNGG+  D+C+CDGYTNSI+T+ V++ +E G+ PWY E CSSTLA TYSSG   +R I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  +TWRD+QHL+V T+R  +L+A DW TNAAG + SH +GFGL+DA AMV  A  W +VP QH C  +A  +   I  +P      SI++  C D  +++V YLEHV  ++ +   +RG++E+ LISPS + S+LL KR  D ++ GF +W FM+VH WGE+A GTW L I    +++        L  W+LIL+GT   P
Sbjct:    4 LAFLVLSTFSVCEASPSRSVFTNHWAVRVTGGPEEADKLASKYGFANLGQIGGLEDHYHFHHSRVVRRSTFATRGAHSFIHMDPKVDWVQQQVVKSRVKRYARSDPNFIYFNDPKWSNMWYIHCSDNSRCRSEMNILAAWQRGYTGRNIVITILDDGIERNHPDLALNYDQLASYDVNGNDHDPTPRYDSSN-----ENKHGTRCAGEVAAVANNSHCIVGIAHNARIGGIRMLDGDVTDVVEAKSLGIRPDYIDIYSASWGPDDDGKTVDGPGPLAKQAFEVGIKKGRKGLGSIFVWASGNGGRQGDHCSCDGYTNSIYTISVSSSTENGNKPWYLEVCSSTLATTYSSGEFYDRKIVTTDLRQRCTDGHTGTSVSAPMVAGVIALALEANPLITWRDVQHLLVKTSRPVHLKASDWKTNAAGHKVSHLYGFGLVDAEAMVLEAKKWRSVPSQHTCIKMADRRTRYI--RPDQKLNASISSTGCRDQPEEQVVYLEHVVVRVLINHPRRGDLEISLISPSGTRSQLLAKRLFDNSNEGFRNWEFMTVHCWGEKAEGTWTLEISESPSQLRNPEILGKLKEWTLILHGTAEHP 589          
BLAST of Furin-1 vs. Ensembl Cavefish
Match: furina (furin-1-like [Source:NCBI gene;Acc:103024357])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 297/555 (53.51%), Postives = 379/555 (68.29%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGT 1830
            YT+TWAV I G  ++A  LA  + F+    I    Y F+HRRV KRS+         L  +P+V W EQQ  K R KR I +   DPK+ + WYL   N  + +N+  AWK+G  G+ VVVSILDDGIE +HPDL+ NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA ANN ICGVGVAY A IGG+RMLDGEV+D+VE+ SL L  QHIDIYSASWGPEDDGKTVDGP +LAK AF  G+ +GR GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG ++E+ IITTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L   DW TN  G++ SHS+G+GL+DA A+V LA NWT V  Q  C  V  +   P ++  +   V+S   D+C+      V  LEH QA+++L   +RG + ++LISP  + S LL  R +D +S GF+ W FM+ H W E+  G W L I +        TL  ++LILYGT
Sbjct:   30 YTNTWAVHITGGEEEANRLARKHDFINHGNIFGDYYHFRHRRVVKRSLSEHRGTHIRLHREPQVSWAEQQVVKRRKKRDIYSEPADPKFAQQWYLYNSNHRD-LNVKEAWKQGVTGKGVVVSILDDGIEMNHPDLERNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAVANNDICGVGVAYNAKIGGVRMLDGEVTDAVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKDAFLRGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSSTQYGNVPWYSEACSSTLATTYSSGGLNEKQIITTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSNPAHLTTDDWRTNGVGRKVSHSYGYGLLDAAAIVALAKNWTNVGPQQKC--VLSLVSEPKNIGSHL--VISKNVDSCA-GKPNFVSSLEHAQAQLTLSYNRRGNLAIYLISPQGTRSTLLAGRPHDYSSEGFNDWAFMTTHSWDEDPRGEWTLEIENKAGLSDFGTLTQFTLILYGT 573          
BLAST of Furin-1 vs. Ensembl Cavefish
Match: furina (furin-1-like [Source:NCBI gene;Acc:103024357])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 297/555 (53.51%), Postives = 379/555 (68.29%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGT 1830
            YT+TWAV I G  ++A  LA  + F+    I    Y F+HRRV KRS+         L  +P+V W EQQ  K R KR I +   DPK+ + WYL   N  + +N+  AWK+G  G+ VVVSILDDGIE +HPDL+ NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA ANN ICGVGVAY A IGG+RMLDGEV+D+VE+ SL L  QHIDIYSASWGPEDDGKTVDGP +LAK AF  G+ +GR GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG ++E+ IITTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L   DW TN  G++ SHS+G+GL+DA A+V LA NWT V  Q  C  V  +   P ++  +   V+S   D+C+      V  LEH QA+++L   +RG + ++LISP  + S LL  R +D +S GF+ W FM+ H W E+  G W L I +        TL  ++LILYGT
Sbjct:   30 YTNTWAVHITGGEEEANRLARKHDFINHGNIFGDYYHFRHRRVVKRSLSEHRGTHIRLHREPQVSWAEQQVVKRRKKRDIYSEPADPKFAQQWYLYNSNHRD-LNVKEAWKQGVTGKGVVVSILDDGIEMNHPDLERNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAVANNDICGVGVAYNAKIGGVRMLDGEVTDAVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKDAFLRGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSSTQYGNVPWYSEACSSTLATTYSSGGLNEKQIITTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSNPAHLTTDDWRTNGVGRKVSHSYGYGLLDAAAIVALAKNWTNVGPQQKC--VLSLVSEPKNIGSHL--VISKNVDSCA-GKPNFVSSLEHAQAQLTLSYNRRGNLAIYLISPQGTRSTLLAGRPHDYSSEGFNDWAFMTTHSWDEDPRGEWTLEIENKAGLSDFGTLTQFTLILYGT 573          
BLAST of Furin-1 vs. Ensembl Cavefish
Match: furinb (furin [Source:NCBI gene;Acc:103043208])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 292/560 (52.14%), Postives = 383/560 (68.39%), Query Frame = 1
Query:  169 ESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILYGT 1830
            E +G YTD+WAV I G  ++A+ +A  + F++   +    Y F+HR V KRS+         L  +P+V+W EQQ AK R KR I +   DPK+ + WYL   N+ + +++  AW +G+ G+ VV++ILDDGIEKDHPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHI IYSASWGPEDDGKTVDGP +LAK AF  G+ +GR GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN  LTWRDMQHLVV T+  A+L   DW TN  G+  SHS+G+GL+DA AMV LA NW++V  QH C  V  M   P  ++ +   + S + +ACS      V  LEHVQA+++L  + RG + + LISP  + S LL  R  D ++ GF+ W FM+ H W E+  G W L I +         L  ++L LYGT
Sbjct:   25 EIQGLYTDSWAVHIRGGEEEAQRIAHKHNFIYHGNVFGDYYHFQHRSVVKRSLSGHRGVHVRLQSEPQVVWAEQQVAKRRRKRDIYSEPTDPKFPQQWYLYNPNRRD-LHVKEAWAQGFTGRGVVITILDDGIEKDHPDLAQNYDPDASYDVNDRDPDPQPRY-----TQLNDNRHGTRCAGEVAAAANNGVCGVGVAYNARIGGVRMLDGEVTDVVEAQSLSLNLQHIHIYSASWGPEDDGKTVDGPAKLAKEAFLQGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSTTQYGNVPWYSEACSSTLATTYSSGNLNEKQIVTTDLRKKCTDSHTGTSASAPLAAGIIALALEANMNLTWRDMQHLVVRTSHPAHLITSDWRTNGVGRLVSHSYGYGLLDASAMVALARNWSSVGPQHKC--VIDMLTEPRDVRNHL--MFSKSVEACS-GQPDFVSSLEHVQARLTLSYSHRGNLAIHLISPLGTRSTLLHPRPQDNSAEGFNDWAFMTTHAWDEDPRGEWTLEIENVAGLSDYGVLSQFTLFLYGT 573          
BLAST of Furin-1 vs. Ensembl Cavefish
Match: pcsk5b (proprotein convertase subtilisin/kexin type 5 [Source:NCBI gene;Acc:103025246])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 303/607 (49.92%), Postives = 384/607 (63.26%), Query Frame = 1
Query:  118 FVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRH-------------------IVNDPKWYKMWYL----NKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLP 1842
              +L    F F A  ++     YT+ WAV+I G  + A  +A+ YG+  L +I  +   Y F H R  KRS   S    S +S +P+V W+EQQ  K RVKR                      ND KW  MWY+    N  N ++ MNI+ AWK+GY G++VVV+ILDDGIE++HPDL +NYD  ASYD+  ND +P PRY  SN     +N HGTRCAG+VAA+ANN  C VG+AY A IGG+RMLDG+V+D VE+ SL L  QHIDIYSASWGP+DDGKTVDGP  LA+ AFE+GI  GR G GSIFVWASGNGG++ D+C+CDGYTNSI+T+ +++ +E G  PWY E+C+STL  TYSSG   +R IITTD+   CT+ H+GTSASAP AAGI ALAL AN  LTWRD+QH++V T+R  +L A DW TNAAG   SH +GFGLMDA AMV  A  W  VP QHIC   A  Q   I  +     V   T   C+DN+   V YLEHV  +I++   +RG++ + L SPS + S+LL  R  D +  GF +W FM+ H WGE+A G W L I    +++        L  WSL+LYGT   P
Sbjct:   12 LCVLALGFFSFFAPCKARI---YTNHWAVRITGGAELAERIASRYGYRNLGQIGDLKDYYHFFHSRTIKRSTLSSRGTHSFISMEPKVQWMEQQVVKRRVKRDYKSSYTSAVQSSPAQSDSIFFNDAKWSSMWYIHCNDNIHNCQSDMNIVGAWKRGYTGKDVVVTILDDGIERNHPDLVQNYDNQASYDVNGNDLDPMPRYDVSN-----ENKHGTRCAGEVAASANNSHCTVGIAYNAKIGGVRMLDGDVTDMVEAKSLSLHPQHIDIYSASWGPDDDGKTVDGPAALARQAFENGIRLGRKGRGSIFVWASGNGGRSRDHCSCDGYTNSIYTISISSTAESGRKPWYLEECASTLTTTYSSGENYDRKIITTDLRQRCTDSHTGTSASAPMAAGIIALALEANTLLTWRDVQHIIVKTSRAGHLSAPDWKTNAAGYNVSHLYGFGLMDAEAMVKEAERWKPVPPQHICVENADKQIRTIRPEHVVRSVYKAT--GCTDNANNHVIYLEHVVVRITITHPRRGDLSINLTSPSGTKSQLLANRLFDHSMEGFKNWEFMTTHCWGEKAAGDWILEINDTPSQLRSQKTPGKLKEWSLVLYGTSVHP 608          
BLAST of Furin-1 vs. Ensembl Sea Lamprey
Match: pcsk7 (proprotein convertase subtilisin/kexin type 7 [Source:ZFIN;Acc:ZDB-GENE-030131-7293])

HSP 1 Score: 185.267 bits (469), Expect = 1.844e-53
Identity = 109/231 (47.19%), Postives = 150/231 (64.94%), Query Frame = 1
Query:  373 VIWLEQQFAKVRVKRHI-VNDPKWYKMWYLNKMNKENSM--NIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGV 1056
            V+W  +Q    RVKR +  NDPK+ K W+L +      M  N+   W++G  G+ VVV+++DDG+E   PDL+ NY    SYD+   D +P P       T  +++ HGTRCAG++AA ANN +CGVG AY + + GIR+LDG ++D +E+ +    YQ   IYS SWGP+DDGKTVDGP  L + A + G++ GR G G+IFV ASGNGG+  DNCN DGY NSI+T+ +
Sbjct:   59 VLWSVEQKGLRRVKRSLPFNDPKFPKQWHLQRNTHTPGMDLNVTGVWERGVTGKGVVVAVVDDGVEHTLPDLQSNYCAEGSYDLTDGDQDPRP------GTGDQESRHGTRCAGEIAAVANNSLCGVGAAYDSRVAGIRLLDGPLTDHMEATAFNTHYQLNHIYSCSWGPDDDGKTVDGPHVLGQSALQRGVVGGRRGFGTIFVVASGNGGRYQDNCNYDGYANSIYTITI 283          
BLAST of Furin-1 vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 181.415 bits (459), Expect = 3.848e-51
Identity = 118/339 (34.81%), Postives = 175/339 (51.62%), Query Frame = 1
Query:  943 KGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMD--ERAIITTDVNHECTEQHSGTSASAPFAAGICALALSAN---------RFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGP----------ISLKPYA------NEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVAS-AGFHHWPFMSVHFWGEEAPGTWKLTI-----------YSYDAEVTLINWSLILYGTDTLP 1842
            +GR G GS++VWASG+GG ++D+CNCDGY +S++T+ +N+    G    Y E CSSTLA T+S+G     E  + TTD+   CT +HSGTSA+AP AAG+ ALA+ AN         R  T  D      +T  +  L  +    +   +  +H   F   D    +    + +T  +QH+  + +P +  P          +   P +        VL++ TDAC +     VRYLEHVQ  +++ +T+RG++ L L SP  + S LL +R  D  S  GFH WPFM+ H WGE+  G W L +            +      L  W+L+L+GT + P
Sbjct:    1 QGRGGKGSVYVWASGDGG-SYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKKDPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALAIEANHPETAPCIARRTTTSDANRAFFVTKSRGFL-GICHDFHLQKQPTTHLTAFRGEDVCCDIAGHFSRSTEQQQHLATFRSPFRTFPPLRSRSPCRCVPCVPCSAVPGQGRLVLTVDTDAC-EGRADHVRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDSDSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGTHSPP 336          
BLAST of Furin-1 vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 172.17 bits (435), Expect = 4.802e-48
Identity = 116/323 (35.91%), Postives = 170/323 (52.63%), Query Frame = 1
Query:  943 KGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMD--ERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVIT--------ARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANE-VLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTI-----------YSYDAEVTLINWSLILYGTDTLP 1842
            +GR G GS++VWASG+GG ++D+CNCDGY +S++T+ +N+    G    Y E CSSTLA T+S+G     E  + TTD+   CT +HSGTSA+AP AAG+ ALA+ A       +    V +            A   A   +T+ A + +  +   G +  G   D  L      +Q   H  A  +G  +   P     VL++ TDAC +     VRYLEHVQ  +++ +T+RG++ L L SP  + S LL +R R+  +  GFH WPFM+ H WGE+  G W L +            +      L  W+L+L+GT + P
Sbjct:    1 QGRGGKGSVYVWASGDGG-SYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKKDPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALAIEAKGVEWLHNTSASVSLLPHSRSQSHPETAPCIARRTTTSDANRAFFVTKSRGFL--GICHDFHLQ-----KQPTTHLTA-FRGEDVCAVPGQGRLVLTVDTDAC-EGRADHVRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDSDSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGTHSPP 313          
BLAST of Furin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001746.1 (pep scaffold:Pmarinus_7.0:GL481393:30496:45513:1 gene:ENSPMAG00000001582.1 transcript:ENSPMAT00000001746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.895 bits (359), Expect = 2.404e-39
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 1
Query:  127 LFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTK 669
            L  +++     ++ + R  YT TWAV + G    A  +A  +GF  L +I    Y F+HR V+KRS+   +     L  +P+V W EQQ  K R KR +     DPK+   WYL+  +  + +N+++AW +G  G+ VVVSILDDGIEK+HPDL  NYDP ASYD+ SND +P+PRY   N+ +
Sbjct:   13 LACAVWLVAGGARGQQRDVYTHTWAVLVPGGAAAADDVAGRHGFTNLGQIFGDYYHFRHRAVAKRSLSRHHNRNLKLQKEPKVQWAEQQVVKARRKRELFQEPTDPKYLLQWYLHN-SVHHDLNVLAAWSQGVSGRGVVVSILDDGIEKNHPDLVSNYDPMASYDVNSNDPDPQPRYTEMNDNR 195          
BLAST of Furin-1 vs. Ensembl Yeast
Match: KEX2 (Kexin, a subtilisin-like protease (proprotein convertase); a calcium-dependent serine protease involved in the activation of proproteins of the secretory pathway [Source:SGD;Acc:S000005182])

HSP 1 Score: 343.584 bits (880), Expect = 5.226e-107
Identity = 189/476 (39.71%), Postives = 277/476 (58.19%), Query Frame = 1
Query:  424 VNDPKWYKMWYL-NKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRA-VDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICH----YVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDA--EVTLINWSLILYG 1827
            +NDP + + W+L N     + +N++  W     G  VV +I+DDG++ ++ DLK+N+    S+D   N N P+PR        + D++HGTRCAG++AA   N  CGVGV Y A I GIR+L G+++   E+ SL       DIYS SWGP DDG+ + GP +L K A   G+ +GR+  G+I+V+ASGNGG   DNCN DGYTNSI+++ + A+      P Y+E CS+ +AVTYSSGS +   I ++D+N  C+  H GTSA+AP AAG+  L L AN  LTWRD+Q+L +++A      A  DW  +A GK+YSH +GFG +DA  +++++  W  V  Q   +    YV+       S +     V++I+  +  D + KR+   EHV   + + +  RG   + LISP+   S L   R  DV+S GF  W FMSV  WGE   G WK+ + + +    +   +W L L+G
Sbjct:  133 INDPLFERQWHLVNPSFPGSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPR--------LSDDYHGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDVNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMAVTYSSGSGE--YIHSSDINGRCSNSHGGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWRDSAMGKKYSHRYGFGKIDAHKLIEMSKTWENVNAQTWFYLPTLYVSQSTN---STEETLESVITISEKSLQDANFKRI---EHVTVTVDIDTEIRGTTTVDLISPAGIISNLGVVRPRDVSSEGFKDWTFMSVAHWGENGVGDWKIKVKTTENGHRIDFHSWRLKLFG 592          
BLAST of Furin-1 vs. Ensembl Nematostella
Match: EDO47748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT1])

HSP 1 Score: 520.776 bits (1340), Expect = 2.517e-177
Identity = 281/592 (47.47%), Postives = 368/592 (62.16%), Query Frame = 1
Query:  151 GAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI-------------VNDPKWYKMWYLNKMNKENSMNI--ISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLR-AVDWSTNAAGKEYSHSFGFGLMDAGAMVDLA--LNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV----TLINWSLILYGTDTLPSHRQ 1854
            GA   +E R  YT+ WA+ +NG +++A+ +A  +GF  +  I  +   Y  +H     RS   +      L     V W+EQQ  KVR KR                 DP W   WYL+   K+  ++I  I  WKKG  G+ VVV+ILDDGIE +H DL +NYDPNAS+D+   DN+P PRY  +N     +N HGTRCAG+VAA ANN  CGVGVA+ A IGG+RMLDG V+D VE+ SL L  Q+IDIYSASWGP DDG TV+GPG LA  AF +GI KGR GLGSIFVWASGNGG++ D+CNCDGYT+SI+TL +++ S+ G++PWY+E CSSTLA T+SSG+  E+ I+TTD+++ CTE+H+GTSASAP AAGI ALAL  N  LTWRDMQH+VV T+    L+   DWS N      +  FGFGL+ A  +VD+A    + TVPE+  C     +       K      + +    CS  +   +RYLEHVQ  +SL   +RG++ ++L SP  + S LL+ R+ D ++ GF  WPFM+ H WGE+  GTW L I           TL  W LIL+GT   P+H+Q
Sbjct:   31 GADLSAEERV-YTNGWAIHVNGGIEEAKEVAKAHGFEKVEPIGTLEGYYHLEHPSHPSRSRRSAEDRTDQLRQHRHVTWVEQQHEKVREKRGFYHDRMVARGIVPRFKDPLWDAQWYLDDKRKDTDLDIHVIPVWKKGISGKGVVVTILDDGIEHNHTDLIKNYDPNASWDVNDGDNDPFPRYDPTN-----ENKHGTRCAGEVAAEANNTKCGVGVAFNARIGGVRMLDGRVTDKVEAESLSLNPQYIDIYSASWGPSDDGATVEGPGTLATAAFLNGIQKGRGGLGSIFVWASGNGGRHGDSCNCDGYTDSIYTLSISSASDHGESPWYSESCSSTLATTFSSGAHGEKRIVTTDLHNTCTERHTGTSASAPLAAGIFALALEVNPKLTWRDMQHIVVHTSNHLPLKHDQDWSKNGIDLMVNRKFGFGLLVAEKIVDMANPATYVTVPEKRFCR--GQINQDAKVFKWDKPLTIQLPATGCS-GTGDEIRYLEHVQLMVSLDYVRRGDLVIYLTSPMGTKSCLLSPRKEDSSNEGFSKWPFMTTHSWGEDPRGTWTLEIKDLGDNKANHGTLREWQLILHGTKDKPAHQQ 613          
BLAST of Furin-1 vs. Ensembl Nematostella
Match: EDO47326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RME4])

HSP 1 Score: 493.812 bits (1270), Expect = 5.308e-167
Identity = 273/578 (47.23%), Postives = 364/578 (62.98%), Query Frame = 1
Query:  172 SRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMD--ERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALN--WTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDA--CSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-TLINWSLILYGTDTLPSHRQNST 1863
            S+  YT+TW +  +   +    LAA +GF    +   +   Y  +H+R SKR      ++ +N   DP V + +QQ    R KR  V DP +   WYLN        K   +N++  W+K   G+NVVV+ILDDGIE  HPDL++NYD  ASYD    D++P PRY   N      N HGTRCAG+VAA  N   CGVGVAY A IGGIRMLDG+V+D VE  SL L   +IDIYS+SWGP+DDG+TVDGPG +AK AF DGI KGR GLGSIFVWA+GNGG+ +D CNCDGY  SI+T+ + A+++ G +PWYAE C STL VTYSSG  +  +  I+TTD++H+CT++H+GTSA+AP AAGI AL L AN  LTWRD+QHLVV T++K +    +W TN AG   ++ +GFG++D+ A+V+LA +  W T  EQH+C       G   S +   N  L++T DA  CS  S    R LEHV+  ++LR  +RG + + LISPS + S LL +R  D ++ GF +WPFM+V  W E   G WKL + ++ +   T   W +  +GT   P  R+N T
Sbjct:   24 SKPLYTNTWVIYTDKGQEYVDNLAAKHGFKSHRDGGGLEGFYILEHQRTSKRMRRSLVHHSTNFLRDPHVSYAKQQKILRRQKRGFV-DPLFNDQWYLNNYGQTPGPKGLDINVLPVWRKNITGKNVVVTILDDGIEYTHPDLQQNYDKEASYDYNHYDSDPFPRYSPDN-----INKHGTRCAGEVAAIKNTH-CGVGVAYNARIGGIRMLDGDVTDIVEGKSLSLKTGYIDIYSSSWGPDDDGRTVDGPGPMAKRAFRDGIKKGRRGLGSIFVWATGNGGRYNDYCNCDGYITSIYTISIGAINDKGKSPWYAENCPSTLGVTYSSGQTNGPDLQIVTTDLHHKCTKEHTGTSAAAPLAAGIFALVLEANPKLTWRDLQHLVVNTSKKTDAGDSEWITNGAGHHVNNKYGFGVLDSAALVELAQSPKWRTAEEQHVCR----EPGSSSSQEIPKNGELTLTLDATGCSGKSNCVTR-LEHVRVYVTLRHDRRGAISIVLISPSGTRSDLLKQRSKDFSNNGFKNWPFMTVFSWNENPVGKWKLVVRNHASTAGTFDRWFIKFFGTCQRP--RKNIT 587          
BLAST of Furin-1 vs. Ensembl Nematostella
Match: EDO32292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH1])

HSP 1 Score: 480.715 bits (1236), Expect = 2.857e-164
Identity = 245/451 (54.32%), Postives = 310/451 (68.74%), Query Frame = 1
Query:  430 DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDA--CSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIY 1776
            DP + + W+L      +  +++  W+ G  G++VVVSILDDGIE  H DLKENYD  ASYD  SND +P PRY  ++     +N HGTRCAG+VAA  NN +CGVGVA KA +GG+RMLDG+V+D+VE+ SL L  QHIDIYSASWGP+DDGKTVDGP  LA+ AF DGI KGR G GSI+VWASGNGG+  DNCNCDGYTNSI+TL +++V+EIG++PWY+E CSSTLA  +SSGS + R I+T DV + CT+ H+GTSASAP AAGI A+AL  NR LTWRDMQH+VV T     L   D  TN  G+  SH+FG+GL+DA  +V LA  W TVP Q +           I  K   +  L++ T+A  C+  + + +RYLEHV+  ISL S KRG++ ++L SP  + S LL KR  D +  GFH W FM+ H W E   GTW L I+
Sbjct:    1 DPLFEEQWHLAGYEAFDH-HVLPVWQMGVYGKDVVVSILDDGIEYTHDDLKENYDKLASYDFNSNDADPAPRYTWND-----ENRHGTRCAGEVAAQMNNSVCGVGVAPKAKVGGVRMLDGDVTDAVEAGSLSLNPQHIDIYSASWGPDDDGKTVDGPARLARKAFTDGIEKGRGGKGSIYVWASGNGGRTSDNCNCDGYTNSIYTLSISSVTEIGNSPWYSEACSSTLASAFSSGSWNNRKIVTVDVRNRCTKTHTGTSASAPLAAGILAMALEVNRNLTWRDMQHIVVRTCTMDKLNMHDVVTNGVGRLVSHTFGYGLLDATRLVKLARVWRTVPPQRVSFLF-------IYRKIPDDGALTVRTEATGCTGTANE-IRYLEHVECIISLDSVKRGDISIYLTSPRGTRSTLLGKRIRDNSQNGFHDWAFMTTHSWEENPTGTWTLEIF 437          
BLAST of Furin-1 vs. Ensembl Nematostella
Match: EDO38851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU0])

HSP 1 Score: 451.44 bits (1160), Expect = 3.924e-150
Identity = 239/546 (43.77%), Postives = 340/546 (62.27%), Query Frame = 1
Query:  184 YTDTWAVQIN-GTVDDARILAATYGFVFLNEI--MPSIYSFKHRRV----SKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV-NDPKWYKMWYLNKMNKENS-----MNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDER---AIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTI 1773
            +T++WAVQ++   V+ A  +AA +GF  L ++  +   Y FKH       ++R ++     +  + +D  V+W ++Q    R +++IV +DPK++  WYL    +        ++++ AW +   G+ VVVSILDDG++  HPDL++N+D  ASYD   ND +P+PR   S+     DN HGTRCAG+VAA ANN +CGVGVAY ANIGG+RMLDG+ +D +E  SL     +IDIYS  WGP+DDGKT   PG+LA+ A   G LKGR G G+I+VWA+GNGG   D+CNCDGYT SI+T+ +  + + G + +Y E CSSTL VT++ GS  ER    ++TTD++H+CTE+  GTS++AP AAG+ AL L AN  L+WRD+QHLVV TA+  +     W  N AG  ++H FGFG +DA AMV  A  W +V  Q ICH   P       +       ++I T ACS  + K +  LEHV   +S +  +RG+V + L SPS + +++L+ RR D +  G H W FM+VH WGE   G W + +
Sbjct:    2 FTNSWAVQLDSAEVEAADRIAAKHGFTNLGQVGSLKGYYHFKHVHKPGNRARRELHVHEKTRLLMQED-EVLWAQRQHVLARTRKYIVPHDPKFHDQWYLFNDGQSTGPAGVDIDVVPAWNRNITGRGVVVSILDDGVDHTHPDLRDNFDQKASYDF--NDMDPDPRPRDSD----PDNCHGTRCAGEVAA-ANNDVCGVGVAYNANIGGVRMLDGQATDVLEGSSLSFQSAYIDIYSNCWGPKDDGKTFGKPGKLAQEALMQGALKGRGGRGNIYVWATGNGGLTDDDCNCDGYTTSIYTISIGCIGDHGLSAYYTELCSSTLGVTFNGGSHREREENKMVTTDLHHKCTEEFKGTSSAAPLAAGMIALVLEANPNLSWRDVQHLVVETAQVTSPVDEGWMKNGAGYHFNHKFGFGRLDADAMVKRAKTWKSVAPQRICH--GPSSSTQQEIPTGGTLSITIDTIACS-GTDKMLTKLEHVTLTVSFQHRRRGDVSIDLFSPSGTRNEMLSTRRYDDSKNGLHDWTFMTVHNWGENPKGEWVMNV 536          
BLAST of Furin-1 vs. Ensembl Nematostella
Match: EDO38852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU1])

HSP 1 Score: 442.965 bits (1138), Expect = 3.779e-147
Identity = 232/545 (42.57%), Postives = 327/545 (60.00%), Query Frame = 1
Query:  178 GHYTDTWAVQINGTVDD--ARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRH-IVNDPKWYKMWYLNKMNKENS-----MNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGS---MDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTI 1773
            G++T+TWAV+I    ++   R ++  +GF  + +I  +   Y  +H  V + +   +      L  +  V W EQQ    RV++  I  DP + +MWYL    +        +N+I  WK+G  G+ VVV++LDDG++ +HPDLK NY+P AS+D   ND +P PR I        DN HGTRCAG++AA AN+ ICG GVAY A IGG+RMLDG+ +D++E+ SL    Q  D+YS  WGP+DDGKT   PG LA  A + G  KGR G G+IFVWA+GNGG   D+CNCDGYT SI+T+ +  + + G + +Y E CSSTLAVT++ G+    +E  +ITTD+  +CTEQ  GTS++AP AAG+ AL L  N  LTWRD+QH++V TA+  +     W TN AG  ++H FGFG +DA AMV+ +  W  VP Q  C   + + G    +    +  + I T  C   +   + +LEHV   +S    +RG+V L L SPS + +++L+ RR D +  G   W FM+VH WGE   G WKL +
Sbjct:    3 GYFTNTWAVEIEHPFEEKYVREISKRHGFTIIGKIGNLKGHYHLRHDDVDELNKEHNRDKTDRLLLEDNVRWAEQQKILHRVRKDGIPTDPMFTEMWYLMNTGQTGGPVGVDINVIPVWKRGITGRGVVVTVLDDGMDHNHPDLKPNYEPCASHDFNDNDQDPAPRDIDP------DNCHGTRCAGEIAAVANDSICGAGVAYNAKIGGVRMLDGKATDALEACSLGFANQVTDVYSNCWGPKDDGKTFGKPGPLAAKALKSGAEKGRGGKGNIFVWATGNGGLTDDDCNCDGYTTSIYTVSIGCIGDHGLSAYYTELCSSTLAVTFNGGAHREKEENKMITTDLKGKCTEQFKGTSSAAPLAAGMVALMLEQNPSLTWRDVQHIIVHTAKMTSPVDDGWRTNGAGLHFNHKFGFGRLDADAMVEKSRVWKNVPVQRTCTGASSVTGDEKDIPVGGSLDIQIPTGGCM-GTIAEINHLEHVVLTVSFIHRRRGDVSLLLTSPSGTKNEMLSTRRYDDSKEGLDKWSFMTVHCWGENPRGFWKLNV 540          
BLAST of Furin-1 vs. Ensembl Medaka
Match: furina (furin-1 [Source:NCBI gene;Acc:100049240])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 301/585 (51.45%), Postives = 391/585 (66.84%), Query Frame = 1
Query:   97 EYIVMKCFVILFSSL---FCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVN---DPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV---TLINWSLILY 1824
            E++     ++L S +   FC         +  YT+TWAV I G  ++A  +A  +GF+    +    Y F+HR V+KRS+      +  L  DP V W EQQ  K R+KR + N   DPK+   WYL+  N  + +N  +AW++GY G+ VVVSILDDGIEK+HPDL +NYDP+ASYD+   D +P+PRY     T++ DN HGTRCAG+VAA A+N ICGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHI IYSASWGPEDDGKTVDGP +LAK AF  G+ +GR GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G+ PWY+E CSSTLA TYSSG+++E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN+ LTWRDMQHLVV T+  A+L A DW TN  G++ SHS+G+GL+DAGA+V LA NWT V  Q  C      +   I    Y N+    + DAC   S   V  LEHVQA+++L   +RG + + LISP+ + S LL  R +D +S GF+ W FM+ H W E   GTW+L I +        TL  + L+LY
Sbjct:   18 EFVTGAVLLMLVSGIGPTFC---------QNIYTNTWAVHIPGGQEEADRVAEKHGFINYGHVFSDYYHFRHRTVAKRSLSDHRGTKVRLLRDPMVSWAEQQVVKRRIKRDLFNEPLDPKFKDQWYLSNSNHRD-LNAKAAWQQGYTGKGVVVSILDDGIEKNHPDLMQNYDPDASYDVNDGDPDPQPRY-----TQLNDNRHGTRCAGEVAAAASNGICGVGVAYNAKIGGVRMLDGEVTDMVEAQSLSLNPQHIHIYSASWGPEDDGKTVDGPAKLAKEAFLRGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLATTYSSGNINEKQIVTTDLKSKCTDSHTGTSASAPLAAGIIALALEANQNLTWRDMQHLVVQTSHPAHLLANDWRTNGVGRKVSHSYGYGLLDAGAIVSLAKNWTNVKPQRKCVITMLSEPRNIGNHLYINK----SVDACI-GSDSYVTSLEHVQARLTLSYNRRGNLAIHLISPAGTRSTLLHPRPHDYSSEGFNDWAFMTTHSWDENPTGTWRLEIENVVGASDYGTLTQFVLVLY 582          
BLAST of Furin-1 vs. Ensembl Medaka
Match: pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:NCBI gene;Acc:101166930])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 296/576 (51.39%), Postives = 382/576 (66.32%), Query Frame = 1
Query:  166 SESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHI--------VNDPKWYKMWYLNKMNK----ENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGT 1830
            S  R  YT+ WAVQI G  D A  +AA YG+  L +I  +  +Y F H RV +R+  P     S +  D +V W +QQ  K RVKR           NDPKW  MWY+N  +      + MN+++AW++GY G+NVVVSILDDGIE++HPDL +NYD  ASYDI  ND++P PRY S N     +N HGTRCAG+VAA ANN  C VG+AY A+IGGIRMLDG+V+D VE+ SL +   +I IYSASWGP+DDG+TVDGPG L + AFE GI KGR GLGSIFVWA+GNGG+  D+C+CDGYT+SI+T+ V++ +E G+ PWY E CSS +  TYSSG   ER I+TTD+   CT+ H+GTS SAP  AG+ ALAL AN  L+WRD+QHL+V T+R A+L+A DW TNAAG   SH +GFGL+DA AMV  A  W  VP QH C  V+  +   I      N   SITT  CS + ++ V++LEHV  K+ L   +RG++E+ LISP+ + S+LL +R  D +S GF +W FM+VHFW E   GTW L +    +++        L  W+LILYGT
Sbjct:   43 SGRRDRYTNHWAVQILGGPDQADAVAAKYGYRNLGQIGGLQDLYHFHHSRVVRRATLPHRGPHSLIHLDAQVAWAQQQLVKPRVKRIAQTDPAFLGFNDPKWSSMWYINCQDDGGRCRSDMNVLAAWQRGYTGRNVVVSILDDGIERNHPDLSQNYDHLASYDINGNDHDPTPRYDSRN-----ENVHGTRCAGEVAAAANNSQCIVGIAYNAHIGGIRMLDGDVTDIVEAKSLGIRPDYIHIYSASWGPKDDGRTVDGPGPLTRQAFERGIQKGRRGLGSIFVWAAGNGGRQADHCSCDGYTSSIYTISVSSTTENGNRPWYLEVCSSIMVTTYSSGEFHERKIVTTDLWQRCTDAHTGTSISAPIVAGVIALALEANFLLSWRDVQHLLVKTSRPAHLKAEDWKTNAAGLTVSHLYGFGLVDADAMVMEARRWRPVPPQHTCSQVSGRRSRHIHAGLRLNS--SITTSGCSGDPQQHVQHLEHVVVKVLLLHPRRGDLEMELISPAGTRSQLLARRLLDSSSEGFRNWEFMTVHFWAETPNGTWTLEVKDTPSKLRNLEVLGNLKEWTLILYGT 611          
BLAST of Furin-1 vs. Ensembl Medaka
Match: furinb (furin, paired basic amino acid cleaving enzyme [Source:NCBI gene;Acc:101158353])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 295/582 (50.69%), Postives = 385/582 (66.15%), Query Frame = 1
Query:  109 MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS-----YDAEVTLINWSLILYGT 1830
            M  +V L  +   F     +++   YT++WAVQI+G  ++A  +A  +GF+    +    Y F+H  V +RS+         L ++P+++W EQQ  K R KR I     DP + K WYL+    ++ ++  +AW +GY G+ VVV+ILDDGIEKDHPDL  NYDP ASYD+   D +P+PRY   N     +N HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHI IYSASWGPEDDGK++DGP +LAK AF  GI KGR+GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G  PWY+E CSSTLA T+SSG+  E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN  LTWRDMQHLVV T++  +L A DW TN  G+  SHS+G+GL+DA AMV LA NWTTV  QH C +    +   I  K     V S + DAC       V  LEHVQA+++L   +RG++ + LISP  + S LL  R ND +S GF+ W FM+ H W E+  G W L I +     +D  V L  ++L+L+GT
Sbjct:    1 MDAWVALLLTWTGFVLLKWTDAAEVYTNSWAVQISGGPEEADRIAREHGFINHGNVFGDYYHFRHHAVKRRSLSIHKGMHIKLQEEPKILWAEQQVVKKRKKRDIYEDPTDPDFPKQWYLSNPTHQD-LDTKAAWAQGYTGRGVVVTILDDGIEKDHPDLISNYDPEASYDVNDGDADPQPRYTQRN-----ENRHGTRCAGEVAAAANNGVCGVGVAYHAKIGGVRMLDGEVTDVVEARSLSLNPQHIHIYSASWGPEDDGKSLDGPAKLAKEAFIQGITKGRSGLGSIFVWASGNGGREQDSCNCDGYTNSIYTLSISSTTQSGSVPWYSEPCSSTLATTFSSGNPGEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANMNLTWRDMQHLVVRTSQPGHLSAADWKTNGVGRTVSHSYGYGLLDAAAMVGLAQNWTTVGPQHQCVHTMLAEPRDIGNK----LVFSKSLDACW-GRPDYVSSLEHVQARLTLSHNQRGKLAVHLISPLGTRSTLLFPRPNDYSSEGFNDWAFMTTHSWDEDPQGEWTLEIENVAPNGHDYGV-LTQFTLLLWGT 570          
BLAST of Furin-1 vs. Ensembl Medaka
Match: furinb (furin, paired basic amino acid cleaving enzyme [Source:NCBI gene;Acc:101158353])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 282/546 (51.65%), Postives = 364/546 (66.67%), Query Frame = 1
Query:  235 ILAATYGFVFL------NEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIV---NDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYS-----YDAEVTLINWSLILYGT 1830
            +L +T   +F+       ++    Y F+H  V +RS+         L ++P+++W EQQ  K R KR I     DP + K WYL+    ++ ++  +AW +GY G+ VVV+ILDDGIEKDHPDL  NYDP ASYD+   D +P+PRY   N     +N HGTRCAG+VAA ANN +CGVGVAY A IGG+RMLDGEV+D VE+ SL L  QHI IYSASWGPEDDGK++DGP +LAK AF  GI KGR+GLGSIFVWASGNGG+  D+CNCDGYTNSI+TL +++ ++ G  PWY+E CSSTLA T+SSG+  E+ I+TTD+  +CT+ H+GTSASAP AAGI ALAL AN  LTWRDMQHLVV T++  +L A DW TN  G+  SHS+G+GL+DA AMV LA NWTTV  QH C +    +   I  K     V S + DAC       V  LEHVQA+++L   +RG++ + LISP  + S LL  R ND +S GF+ W FM+ H W E+  G W L I +     +D  V L  ++L+L+GT
Sbjct:   33 VLPSTTSLLFILRSSGPVKVFGDYYHFRHHAVKRRSLSIHKGMHIKLQEEPKILWAEQQVVKKRKKRDIYEDPTDPDFPKQWYLSNPTHQD-LDTKAAWAQGYTGRGVVVTILDDGIEKDHPDLISNYDPEASYDVNDGDADPQPRYTQRN-----ENRHGTRCAGEVAAAANNGVCGVGVAYHAKIGGVRMLDGEVTDVVEARSLSLNPQHIHIYSASWGPEDDGKSLDGPAKLAKEAFIQGITKGRSGLGSIFVWASGNGGREQDSCNCDGYTNSIYTLSISSTTQSGSVPWYSEPCSSTLATTFSSGNPGEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANMNLTWRDMQHLVVRTSQPGHLSAADWKTNGVGRTVSHSYGYGLLDAAAMVGLAQNWTTVGPQHQCVHTMLAEPRDIGNK----LVFSKSLDACW-GRPDYVSSLEHVQARLTLSHNQRGKLAVHLISPLGTRSTLLFPRPNDYSSEGFNDWAFMTTHSWDEDPQGEWTLEIENVAPNGHDYGV-LTQFTLLLWGT 566          
BLAST of Furin-1 vs. Ensembl Medaka
Match: pcsk5b (proprotein convertase subtilisin/kexin type 5 [Source:NCBI gene;Acc:101170192])

HSP 1 Score: 530.02 bits (1364), Expect = 1.728e-176
Identity = 300/588 (51.02%), Postives = 378/588 (64.29%), Query Frame = 1
Query:  184 YTDTWAVQINGTVDDARILAATYGFVFLNEI--MPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRH----------------------IVNDPKWYKMWYL----NKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEV-------TLINWSLILYGTDTLP 1842
            YT+ WAV+I G  D A  +AA YG+  + +I  +   Y F H R  KRS   S    S +S +P+V W+EQQ  K R+KR                         ND KW  MWY+    +  N ++ MNI+ AWK+G+ G+ VVV+ILDDGIE++HPDL  NYDP ASYD+ SND +P PRY ++N     +N HGTRCAG+VAA ANN  C VG+AY A IGG+RMLDG+V+D VE+ SL L  QHIDIYSASWGP+DDGKTVDGP  LA+ AFE+GI  GR G GSIFVWASGNGG++ D+C+CDGYTNSI+T+ +++ +E G  PWY E+CSSTL  TYSSG   +R IITTD+ H CT+ H+GTSASAP AA I ALAL AN  LTWRD+QH++V T+R  +L A DW TNAAG   SH +GFGLMDA AMV  A  W  VP QHIC   A  Q   I  +     V   T   C+DN  + V YLEHV  +I++   +RG++ + L SPS + S+LL  R  D +  GF +W FM+ H WGE+A G W L IY   +++        L  WSL+LYGT   P
Sbjct:   31 YTNHWAVRIAGGPDVADRIAAKYGYRNMGQIGDLKDHYHFFHSRTIKRSTLSSRGRHSFISMEPKVEWIEQQVVKRRIKRDYKPVPPHSLTSPAYSNQAQNNIFYNDAKWSSMWYIHCNGDVHNCQSDMNIMGAWKRGFTGKGVVVTILDDGIERNHPDLSYNYDPQASYDVNSNDPDPMPRYDATN-----ENKHGTRCAGEVAAAANNSHCIVGIAYNAKIGGVRMLDGDVTDMVEARSLSLHPQHIDIYSASWGPDDDGKTVDGPASLARQAFENGIRSGRKGRGSIFVWASGNGGRSRDHCSCDGYTNSIYTISISSTAESGRKPWYLEECSSTLTTTYSSGENYDRKIITTDLRHRCTDSHTGTSASAPMAAAIIALALEANSDLTWRDVQHIIVKTSRAGHLSAPDWKTNAAGYNVSHLYGFGLMDAEAMVKEAERWKHVPAQHICVESADRQIRTIRPEHVVRSVYKAT--GCADNPNQHVIYLEHVVVRITITHPRRGDLSINLTSPSGTKSQLLANRLFDHSMEGFKNWEFMTTHCWGEKAAGDWVLEIYDSPSQLRSQKVPGKLKEWSLVLYGTSVNP 611          
BLAST of Furin-1 vs. Planmine SMEST
Match: SMESG000049794.1 (SMESG000049794.1)

HSP 1 Score: 1349.73 bits (3492), Expect = 0.000e+0
Identity = 645/645 (100.00%), Postives = 645/645 (100.00%), Query Frame = 1
Query:  109 MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVNDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVPYINNNNERNLETSFEVKENQIIFPQSSHSLRFSFKLIFISVLLIGYR 2043
            MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVNDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVPYINNNNERNLETSFEVKENQIIFPQSSHSLRFSFKLIFISVLLIGYR
Sbjct:    1 MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGFVFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVRVKRHIVNDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVPYINNNNERNLETSFEVKENQIIFPQSSHSLRFSFKLIFISVLLIGYR 645          
BLAST of Furin-1 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 440.654 bits (1132), Expect = 1.786e-146
Identity = 238/490 (48.57%), Postives = 319/490 (65.10%), Query Frame = 1
Query:  403 VRVKRHIVNDPKWYKMWYLNKMN---KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVAS--AGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN--WS---LILYGTDTLP 1842
            +++K+   +DP + K WYL +     K   MN+  AW+ GY G+ V +SILDDGI+  H DLKENYDP AS+DI  +DN+P P      N K  +N HGTRCAG+V+A ANN  CGVG+AY + IG +RMLDG+V+D VE+ +L    QHIDIYS SWGP+D+G+ V+GP  LAK AF+ GI  GRNGLG+I+VWASGNGGK  D+C CDGY +SI+T+ +++VSE    PWY E C+STLA TYSSG   E+ II+TD+N++C   H+GTSASAP AAGI AL + AN  LTWRD+Q+++V+T+        ++  N A K+ S+ +GFGLMD+G +V +   W  +P  H C       G  ISLK      LS+ TD C    K +V Y+EHV   + L   KRG++ + LISPS + S++L  R +D A   + F  WP MSV FWGE+A G W + I +Y  + +  N  WS   L +YGT+  P
Sbjct:    1 MKIKQIKFSDPLFKKQWYLIRSQFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLP------NLKSTENRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGDVTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGYEQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCK--ISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPHDFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWP 480          
BLAST of Furin-1 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 430.639 bits (1106), Expect = 5.619e-143
Identity = 230/460 (50.00%), Postives = 304/460 (66.09%), Query Frame = 1
Query:  484 MNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVAS--AGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN--WS---LILYGTDTLP 1842
            MN+  AW+ GY G+ V +SILDDGI+  H DLKENYDP AS+DI  +DN+P P      N K  +N HGTRCAG+V+A ANN  CGVG+AY + IG +RMLDG+V+D VE+ +L    QHIDIYS SWGP+D+G+ V+GP  LAK AF+ GI  GRNGLG+I+VWASGNGGK  D+C CDGY +SI+T+ +++VSE    PWY E C+STLA TYSSG   E+ II+TD+N++C   H+GTSASAP AAGI AL + AN  LTWRD+Q+++V+T+        ++  N A K+ S+ +GFGLMD+G +V +   W  +P  H C       G  ISLK      LS+ TD C    K +V Y+EHV   + L   KRG++ + LISPS + S++L  R +D A   + F  WP MSV FWGE+A G W + I +Y  + +  N  WS   L +YGT+  P
Sbjct:    1 MNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLP------NLKSTENRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGDVTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGYEQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCK--ISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPHDFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWP 450          
BLAST of Furin-1 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 429.869 bits (1104), Expect = 1.017e-142
Identity = 230/460 (50.00%), Postives = 304/460 (66.09%), Query Frame = 1
Query:  484 MNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVAS--AGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN--WS---LILYGTDTLP 1842
            MN+  AW+ GY G+ V +SILDDGI+  H DLKENYDP AS+DI  +DN+P P      N K  +N HGTRCAG+V+A ANN  CGVG+AY + IG +RMLDG+V+D VE+ +L    QHIDIYS SWGP+D+G+ V+GP  LAK AF+ GI  GRNGLG+I+VWASGNGGK  D+C CDGY +SI+T+ +++VSE    PWY E C+STLA TYSSG   E+ II+TD+N++C   H+GTSASAP AAGI AL + AN  LTWRD+Q+++V+T+        ++  N A K+ S+ +GFGLMD+G +V +   W  +P  H C       G  ISLK      LS+ TD C    K +V Y+EHV   + L   KRG++ + LISPS + S++L  R +D A   + F  WP MSV FWGE+A G W + I +Y  + +  N  WS   L +YGT+  P
Sbjct:    1 MNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLP------NLKSTENRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGDVTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGYEQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCK--ISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPHDFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWP 450          
BLAST of Furin-1 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 439.499 bits (1129), Expect = 3.863e-139
Identity = 238/490 (48.57%), Postives = 319/490 (65.10%), Query Frame = 1
Query:  403 VRVKRHIVNDPKWYKMWYLNKMN---KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVAS--AGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN--WS---LILYGTDTLP 1842
            +++K+   +DP + K WYL +     K   MN+  AW+ GY G+ V +SILDDGI+  H DLKENYDP AS+DI  +DN+P P      N K  +N HGTRCAG+V+A ANN  CGVG+AY + IG +RMLDG+V+D VE+ +L    QHIDIYS SWGP+D+G+ V+GP  LAK AF+ GI  GRNGLG+I+VWASGNGGK  D+C CDGY +SI+T+ +++VSE    PWY E C+STLA TYSSG   E+ II+TD+N++C   H+GTSASAP AAGI AL + AN  LTWRD+Q+++V+T+        ++  N A K+ S+ +GFGLMD+G +V +   W  +P  H C       G  ISLK      LS+ TD C    K +V Y+EHV   + L   KRG++ + LISPS + S++L  R +D A   + F  WP MSV FWGE+A G W + I +Y  + +  N  WS   L +YGT+  P
Sbjct:    1 MKIKQIKFSDPLFKKQWYLIRSQFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLP------NLKSTENRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGDVTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGYEQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSNPHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCK--ISYNGKKISLKDKFTVKLSVKTDGCP--GKNKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPHDFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWP 480          
The following BLAST results are available for this feature:
BLAST of Furin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCSK60.000e+051.68proprotein convertase subtilisin/kexin type 6 [Sou... [more]
PCSK60.000e+051.95proprotein convertase subtilisin/kexin type 6 [Sou... [more]
PCSK60.000e+051.68proprotein convertase subtilisin/kexin type 6 [Sou... [more]
PCSK60.000e+051.68proprotein convertase subtilisin/kexin type 6 [Sou... [more]
FURIN0.000e+050.75furin, paired basic amino acid cleaving enzyme [So... [more]
back to top
BLAST of Furin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kpc-10.000e+050.08Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
kpc-10.000e+050.08Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
bli-41.947e-15946.06Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
bli-41.947e-15946.06Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
bli-42.734e-15946.06Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Furin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fur10.000e+053.91gene:FBgn0004509 transcript:FBtr0336806[more]
Fur10.000e+053.91gene:FBgn0004509 transcript:FBtr0089983[more]
Fur10.000e+053.73gene:FBgn0004509 transcript:FBtr0089982[more]
Fur10.000e+053.73gene:FBgn0004509 transcript:FBtr0336805[more]
Fur10.000e+053.73gene:FBgn0004509 transcript:FBtr0336804[more]
back to top
BLAST of Furin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
furina0.000e+052.54furin (paired basic amino acid cleaving enzyme) a ... [more]
furina0.000e+052.54furin (paired basic amino acid cleaving enzyme) a ... [more]
furina0.000e+052.54furin (paired basic amino acid cleaving enzyme) a ... [more]
furinb0.000e+052.10furin (paired basic amino acid cleaving enzyme) b ... [more]
CR383678.10.000e+049.24proprotein convertase subtilisin/kexin type 5a [So... [more]
back to top
BLAST of Furin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdap1l10.000e+050.94ganglioside induced differentiation associated pro... [more]
gdap1l10.000e+050.94ganglioside induced differentiation associated pro... [more]
gdap1l10.000e+050.94ganglioside induced differentiation associated pro... [more]
gdap1l10.000e+050.94ganglioside induced differentiation associated pro... [more]
gdap1l10.000e+050.94ganglioside induced differentiation associated pro... [more]
back to top
BLAST of Furin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcsk60.000e+052.20proprotein convertase subtilisin/kexin type 6 [Sou... [more]
Pcsk60.000e+052.20proprotein convertase subtilisin/kexin type 6 [Sou... [more]
Furin0.000e+051.74furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin0.000e+051.74furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin0.000e+051.74furin (paired basic amino acid cleaving enzyme) [S... [more]
back to top
BLAST of Furin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26016|FUR11_DROME0.000e+053.91Furin-like protease 1, isoforms 1/1-X/2 OS=Drosoph... [more]
sp|P30430|FUR1C_DROME0.000e+053.73Furin-like protease 1, isoform 1-CRR OS=Drosophila... [more]
sp|Q63415|PCSK6_RAT0.000e+052.20Proprotein convertase subtilisin/kexin type 6 OS=R... [more]
sp|P29122|PCSK6_HUMAN0.000e+051.95Proprotein convertase subtilisin/kexin type 6 OS=H... [more]
sp|P09958|FURIN_HUMAN0.000e+050.75Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2[more]
back to top
BLAST of Furin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FDH60.000e+057.87Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0RKD30.000e+060.88Furin OS=Fasciola hepatica OX=6192 GN=D915_000368 ... [more]
G7YU090.000e+062.13Furin OS=Clonorchis sinensis OX=79923 GN=CLF_11089... [more]
A0A074Z5Y00.000e+061.00P/Homo B domain-containing protein OS=Opisthorchis... [more]
A0A4S2L0750.000e+061.96P/Homo B domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of Furin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk60.000e+050.76proprotein convertase subtilisin/kexin type 6 [Sou... [more]
furina0.000e+053.51furin-1-like [Source:NCBI gene;Acc:103024357][more]
furina0.000e+053.51furin-1-like [Source:NCBI gene;Acc:103024357][more]
furinb0.000e+052.14furin [Source:NCBI gene;Acc:103043208][more]
pcsk5b0.000e+049.92proprotein convertase subtilisin/kexin type 5 [Sou... [more]
back to top
BLAST of Furin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pcsk71.844e-5347.19proprotein convertase subtilisin/kexin type 7 [Sou... [more]
pcsk23.848e-5134.81proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk24.802e-4835.91proprotein convertase subtilisin/kexin type 2 [Sou... [more]
ENSPMAT00000001746.12.404e-3941.85pep scaffold:Pmarinus_7.0:GL481393:30496:45513:1 g... [more]
back to top
BLAST of Furin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KEX25.226e-10739.71Kexin, a subtilisin-like protease (proprotein conv... [more]
back to top
BLAST of Furin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477482.517e-17747.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473265.308e-16747.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322922.857e-16454.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388513.924e-15043.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388523.779e-14742.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Furin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
furina0.000e+051.45furin-1 [Source:NCBI gene;Acc:100049240][more]
pcsk60.000e+051.39proprotein convertase subtilisin/kexin type 6 [Sou... [more]
furinb0.000e+050.69furin, paired basic amino acid cleaving enzyme [So... [more]
furinb0.000e+051.65furin, paired basic amino acid cleaving enzyme [So... [more]
pcsk5b1.728e-17651.02proprotein convertase subtilisin/kexin type 5 [Sou... [more]
back to top
BLAST of Furin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049794.10.000e+0100.00SMESG000049794.1[more]
SMESG000018546.11.786e-14648.57SMESG000018546.1[more]
SMESG000018546.15.619e-14350.00SMESG000018546.1[more]
SMESG000018546.11.017e-14250.00SMESG000018546.1[more]
SMESG000018546.13.863e-13948.57SMESG000018546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011738 ID=SMED30011738|Name=Furin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2237bp
TGTTGAAGTCGTTATAATTAAATGAAATTACGTCAGGTTTTATTACAAAT
TAGGCGTTGTCAGTTGGAAAATTTTAGTGCAATAAATTTATAATATGAAT
ATATTGTAATGAAGTGTTTTGTAATTCTCTTCTCATCTCTCTTTTGTTTC
GGCGCCAAATCTCAATCAGAATCACGTGGCCATTATACAGACACTTGGGC
AGTCCAAATCAACGGAACAGTTGACGACGCAAGGATATTAGCCGCCACAT
ATGGATTCGTTTTTCTCAATGAGATAATGCCGTCCATTTATTCATTCAAG
CACCGACGAGTATCAAAGCGCTCAATTTATCCGAGCAATTACTATCAGAG
CAATTTATCCGATGATCCAAGAGTCATCTGGTTGGAGCAACAATTTGCCA
AAGTCAGGGTGAAACGGCACATTGTCAATGATCCAAAATGGTACAAAATG
TGGTATCTGAATAAAATGAATAAAGAAAACTCAATGAATATTATATCAGC
TTGGAAAAAGGGATACAGGGGTCAGAATGTCGTCGTGTCTATCCTCGATG
ATGGAATAGAAAAAGATCATCCGGACCTCAAAGAAAACTATGATCCAAAC
GCGTCGTATGACATCATCAGTAACGACAACAATCCGGAGCCCCGATATAT
TTCCAGCAACAATACCAAGATCAAAGATAATCACCATGGTACCAGATGCG
CCGGTCAAGTGGCAGCTACGGCAAATAATCGGATATGCGGAGTTGGGGTG
GCGTACAAGGCTAATATCGGAGGAATACGAATGCTCGATGGAGAGGTTTC
AGATAGCGTTGAGAGTCATTCGTTGAGATTGTTTTATCAACATATCGATA
TTTACTCGGCCAGTTGGGGACCGGAGGATGATGGGAAAACTGTTGATGGG
CCAGGAGAACTTGCCAAAATTGCATTTGAAGATGGCATACTAAAGGGTAG
GAATGGTCTGGGATCTATTTTTGTTTGGGCAAGTGGTAATGGGGGAAAGA
ATCATGATAACTGCAATTGTGATGGATACACCAATAGTATTTTTACTCTG
GGAGTCAATGCTGTCTCTGAAATTGGGGATGCTCCGTGGTATGCAGAAAA
ATGTTCCTCCACTTTGGCGGTAACCTATAGTAGCGGCAGTATGGATGAGC
GGGCTATTATCACAACTGATGTGAACCATGAGTGCACGGAACAACATTCT
GGGACTTCAGCGAGTGCTCCTTTTGCCGCGGGGATTTGTGCATTGGCCTT
ATCTGCTAATAGGTTTCTTACTTGGCGAGACATGCAGCATTTAGTTGTCA
TTACAGCTCGAAAGGCTAATTTGAGAGCTGTCGATTGGAGCACGAACGCT
GCAGGGAAAGAGTACTCTCATTCTTTTGGATTTGGGCTAATGGATGCCGG
TGCAATGGTTGATTTAGCTCTCAACTGGACAACAGTACCCGAGCAACATA
TTTGCCATTATGTGGCCCCAATGCAAGGTGGGCCTATTTCATTGAAACCG
TATGCAAATGAAGTATTATCTATCACAACTGATGCTTGCTCAGATAATTC
TAAAAAACGTGTCAGATACCTTGAACATGTCCAGGCAAAAATTTCTCTGC
GTAGTACTAAAAGAGGGGAAGTCGAATTGTGGCTCATTTCACCGAGTAGA
TCAACCAGCAAGCTGCTTACCAAACGTCGAAATGATGTAGCAAGCGCTGG
CTTTCATCACTGGCCTTTCATGTCAGTCCATTTTTGGGGCGAAGAAGCTC
CAGGAACTTGGAAGTTGACAATATATTCATATGATGCAGAAGTAACCCTC
ATCAATTGGTCGTTAATCCTCTATGGGACAGACACCTTGCCGTCACATCG
TCAGAACAGTACCCACACCAAATCACAGAAACGACCGCCGAAAAATGTTC
CTTACATAAACAATAATAACGAAAGAAATTTAGAAACAAGTTTCGAAGTC
AAAGAAAATCAAATAATATTTCCACAAAGTTCTCACAGTCTTCGGTTTTC
ATTCAAGCTCATTTTCATCAGTGTTTTATTAATTGGCTATAGATAGTTGT
CAATCTTATCACTTTTGTGCAATGACTTCCAACCAGACTTTTCAGAAGGT
CTAGTCAAGTTGTTCATTGAATGTCTTCAATACATATGATGCAATCATGT
TCAGTCTCCAAGGATTTCCTGATCATATCACTTGTAACTGTCACTTTTTG
GCTCATCAATTGTATATTGAACTCATTTAACTTAACT
back to top

protein sequence of SMED30011738-orf-1

>SMED30011738-orf-1 ID=SMED30011738-orf-1|Name=SMED30011738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=646bp
MKCFVILFSSLFCFGAKSQSESRGHYTDTWAVQINGTVDDARILAATYGF
VFLNEIMPSIYSFKHRRVSKRSIYPSNYYQSNLSDDPRVIWLEQQFAKVR
VKRHIVNDPKWYKMWYLNKMNKENSMNIISAWKKGYRGQNVVVSILDDGI
EKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQ
VAATANNRICGVGVAYKANIGGIRMLDGEVSDSVESHSLRLFYQHIDIYS
ASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHD
NCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSGSMDERAI
ITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITA
RKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICH
YVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRST
KRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGT
WKLTIYSYDAEVTLINWSLILYGTDTLPSHRQNSTHTKSQKRPPKNVPYI
NNNNERNLETSFEVKENQIIFPQSSHSLRFSFKLIFISVLLIGYR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0010008endosome membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004252serine-type endopeptidase activity
GO:0016787hydrolase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:1901394positive regulation of transforming growth factor beta1 activation
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036852Peptidase_S8/S53_dom_sf
IPR038466S8_pro-domain_sf
IPR034182Kexin/furin
IPR015500Peptidase_S8_subtilisin-rel
IPR032815S8_pro-domain
IPR000209Peptidase_S8/S53_dom
IPR002884P_dom
IPR008979Galactose-bd-like_sf
IPR022398Peptidase_S8_His-AS
IPR023827Peptidase_S8_Asp-AS
IPR023828Peptidase_S8_Ser-AS
IPR009020Propept_inh
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015500Peptidase S8, subtilisin-relatedPRINTSPR00723SUBTILISINcoord: 189..202
score: 52.37
coord: 364..380
score: 57.65
coord: 138..157
score: 46.62
IPR032815Peptidase S8, pro-domainPFAMPF16470S8_pro-domaincoord: 29..103
e-value: 8.8E-17
score: 61.7
IPR000209Peptidase S8/S53 domainPFAMPF00082Peptidase_S8coord: 138..426
e-value: 1.3E-47
score: 162.5
IPR036852Peptidase S8/S53 domain superfamilyGENE3DG3DSA:3.40.50.200coord: 108..437
e-value: 3.3E-92
score: 311.3
IPR036852Peptidase S8/S53 domain superfamilySUPERFAMILYSSF52743Subtilisin-likecoord: 105..440
IPR002884P domainPFAMPF01483P_proproteincoord: 488..571
e-value: 9.1E-22
score: 76.9
IPR002884P domainPROSITEPS51829P_HOMO_Bcoord: 442..577
score: 43.074
IPR038466Peptidase S8, pro-domain superfamilyGENE3DG3DSA:3.30.70.850coord: 17..103
e-value: 3.1E-23
score: 84.0
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 441..574
e-value: 4.6E-39
score: 135.0
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 434..578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 581..602
NoneNo IPR availablePANTHERPTHR42884:SF3FURIN-LIKE PROTEASE 1, ISOFORMS 1/1-X/2coord: 21..603
NoneNo IPR availablePANTHERPTHR42884FAMILY NOT NAMEDcoord: 21..603
NoneNo IPR availablePROSITEPS51892SUBTILASEcoord: 114..434
score: 42.292
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.72
NoneNo IPR availableSUPERFAMILYSSF54897Protease propeptides/inhibitorscoord: 26..95
IPR023828Peptidase S8, subtilisin, Ser-active sitePROSITEPS00138SUBTILASE_SERcoord: 365..375
IPR023827Peptidase S8, subtilisin, Asp-active sitePROSITEPS00136SUBTILASE_ASPcoord: 143..154
IPR022398Peptidase S8, subtilisin, His-active sitePROSITEPS00137SUBTILASE_HIScoord: 193..203
IPR034182Kexin/furin catalytic domainCDDcd04059Peptidases_S8_Protein_convertases_Kexins_Furin-likecoord: 107..401
e-value: 1.85069E-161
score: 462.8