Dedicator of cytokinesis 4b

Overview
NameDedicator of cytokinesis 4b
Smed IDSMED30011727
Length (bp)5609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dedicator of cytokinesis 4b (SMED30011727) t-SNE clustered cells

Violin plots show distribution of expression levels for Dedicator of cytokinesis 4b (SMED30011727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dedicator of cytokinesis 4b (SMED30011727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dedicator of cytokinesis 4b (SMED30011727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v4_6156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v4_6156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v4_6156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v4_6156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v4_6156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011727SMESG000063593.1 SMESG000018675.1 Contig49074newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011727SMESG000063593.1 SMESG000018675.1 Contig49074uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30011727SMESG000063593.1 SMESG000063592.1 SMESG000063595.1 dd_Smed_v6_6156_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30011727SMESG000063595.1 SMESG000063593.1 SMED30011727smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30011727SMESG000063595.1 SMESG000063593.1 SMED30011727smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011727SMESG000063595.1 SMESG000063593.1 SMESG000063592.1 dd_Smed_v6_6156_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Match: DOCK1 (dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:2987])

HSP 1 Score: 233.417 bits (594), Expect = 9.283e-61
Identity = 371/1666 (22.27%), Postives = 709/1666 (42.56%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKII-------GKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEF---LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLN--EKILPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDII--QIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +        G++E V+  D          L   + TTL    +IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +          + Q K +    L + +N       +G   E++M   + DP +       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE  I         ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q L+++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        L   +KN    A K  ++ E L  +M ++E +F  + ++  L      ++   + ++  + LF   N      +D    +  +A + L  I N   +    + L+ +F ++  LN    +L  +KL  +++++ S + +  +C +IL  +    + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G  + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + +  T     K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP +    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E      +I+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLP--------LIQEVTTTLREWSTIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMS--LYDPVESKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQ--QNLRQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVN-EQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMF-TEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKY-----HLERQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GNFVACMT-AILRQMEDYH---YAHLIKTFGKMRTDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGDDIKNSPGQY---IQCFTVKP-KLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1609          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Match: DOCK1 (dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:2987])

HSP 1 Score: 214.927 bits (546), Expect = 3.380e-55
Identity = 281/1241 (22.64%), Postives = 543/1241 (43.76%), Query Frame = 2
Query: 1295 LYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLN--EKILPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDII--QIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            +YV L   +FD+ +K +AKNVE  +SV D  G++LE  I         ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q L+++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        L   +KN    A K  ++ E L  +M ++E +F  + ++  L      ++   + ++  + LF   N      +D    +  +A + L  I N   +    + L+ +F ++  LN    +L  +KL  +++++ S + +  +C +IL  +    + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G  + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + +  T     K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP +    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E      +I+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct:  449 IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQ--QNLRQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVN-EQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMF-TEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKY-----HLERQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GNFVACMT-AILRQMEDYH---YAHLIKTFGKMRTDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGDDIKNSPGQY---IQCFTVKP-KLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1630          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Match: DOCK3 (dedicator of cytokinesis 3 [Source:HGNC Symbol;Acc:HGNC:2989])

HSP 1 Score: 194.897 bits (494), Expect = 5.335e-49
Identity = 159/644 (24.69%), Postives = 302/644 (46.89%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            ++P++W+ + L  SNI +  +  +   +    TET    ++  ++   +  F+ Q  L+LE  + +KR KIL+ Y DMR+ +     ++  N    +      F   M+     V+L+P P++R  ++P F  ++     K  +  ++  ++I  ++++  EG GDE Y                 L K   +   E     V  V +LM+  L+ R                 + M FYK E+N   ++I Y  KL  +     +  EAA  L +  + + W +  L      F ++        K  L  KII+   + + +E    +C      Y S ++Y+ LS   K  + +Y+ I+ + RL+  ++R+ F G   P  +R+ ++YV +   + ++   ++ + ++FP A    + + P           + I  + PIP  +D+ +   +  +++ +++ +N+  F  D  FHKG  DK+NE K++ + R  + +T ++P I  W  +    +  ++P+E A  ++  KNQ  R LI +Y ++ +  ++N  SM L G +DA VNGG+ +Y +AFF     +    D  +I   K+ + EQ  +L   LA+H+K V P +  LH++L   F+ M  ++
Sbjct:  992 VFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQN----LGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFSLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKIGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPL----REFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIMEQQRLEPEFFRVGFYGRKFPFFLRN-KEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKENEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRSLISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYINKHPGDAEKITQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASL 1626          

HSP 2 Score: 125.946 bits (315), Expect = 4.722e-28
Identity = 133/567 (23.46%), Postives = 250/567 (44.09%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKF-----VFKEIPL-DIRKEGYLVVYVYRIGQLLTDPNKLLI--CKFRRPVAFGSFSVKE-LQS-----------------NNE----KVKINLFNLSETDFLKPTS---------------ELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            WT  EE   G V   F+ +V  GL+L++G+TV I  +  GWY G S  K    N  GIFP +Y+ +  K  IV    ++   E +  L   ++T ++     W S  K+L  +   +      + +N++++L   ++     ++++ ++  H+ + ++  N  L +D    K+   V+    + V+ L K+++ +   ++   +  D        + +      +   +++ +F +  + ++  + + + D  +  Q    +L  L  + G P+   EK      +F ++   D++++ Y+V +V RIG++L + +K       +RRP      S+ + LQS                 NNE    ++  N+   S   +  P++               E I+ + P  + NR + +T +   P+     D+ ND                    LY+ L   +F+R  K   KN+E  + V  + G+ L +CI       N++ Y S V YHSNSP+W ++IK+ +       S+L  EF HC+TKDK   E+K F   F  L +
Sbjct:    2 WTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKK---PNVKGIFPANYIHL--KKAIV---SNRGQYETVVPLEDSIVTEVTATLQEWASLWKQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKD-FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVP--HHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLN-KNGGPR-NPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPPHLHYRRPYGCAVLSILDVLQSLTEVKEEKDFVLKVYTCNNESEWSQIHENIIRKSSAKYSAPSASHGLIISLQLLRGDMEQIRRENP-MIFNRGLAITRKLGFPDVIMPGDIRND--------------------LYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFSTLMR 532          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Match: DOCK4 (dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc:HGNC:19192])

HSP 1 Score: 194.897 bits (494), Expect = 5.469e-49
Identity = 142/577 (24.61%), Postives = 279/577 (48.35%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++ +   + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  962 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1525          

HSP 2 Score: 130.568 bits (327), Expect = 2.241e-29
Identity = 153/648 (23.61%), Postives = 288/648 (44.44%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNAR------MLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPLDI-----RKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  V +GL L++GDTV I  +  GWY G++L      N  GIFP+SYV +  KN  V     K+  ++  V+         M +TL   G++W  +L   N+  L        + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   D+ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  ++    E F+L +   R G PK  D+      + +D+     RK+ Y+ V++ RIG++     K     ++RRP      S+ +L +   K    +K+ + N +E+++ +    +IK KL ++      N  + V+L+  H +      E   +          +  SN     + ++ LY+ +   EF++  K  A+NVE  + + DSSGQ L+  +S        ++Y S V YH+NSP+W++L+K+ +       +++  EF HC+TK+K   E+K F   F+ L +  E G+               EN+ +  T +   +P   +    +  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I      LKE+
Sbjct:    2 WIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKN---PNIKGIFPSSYVHL--KNACV-----KNKGQFEMVIPTEDSVITEMTSTLRDWGTMW-KQLYVRNEGDLFHRLW---HIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-YAMVDPEDISITELYRLMEHRHRK-----------------KDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRL--NRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLILKVYMCN-TESEWYQIHENIIK-KLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSVARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLP--FSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Match: DOCK4 (dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc:HGNC:19192])

HSP 1 Score: 191.815 bits (486), Expect = 2.796e-48
Identity = 142/586 (24.23%), Postives = 278/586 (47.44%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHK-MIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                 L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++ +   + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  414 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 986          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Celegans
Match: ced-5 (CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3])

HSP 1 Score: 65.0846 bits (157), Expect = 5.449e-10
Identity = 78/365 (21.37%), Postives = 155/365 (42.47%), Query Frame = 2
Query: 3620 MMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLP-FDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIST-FNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKN-----DFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVN----------VTRYEVMTETMPNIFTWAPIIN-ENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS 4660
            +M Y  + +   L++ Y  KL  L    G+K+EAA  L      + ++++ LP +      N         K +L  +  NL  + +++E+A  + +  +  Y +   +Y +L+  L+K+++ Y  I    R    YY + F G   P  + +   +VF+     K+    E ++      D P+  ++       ++SP  +   I +  +DPI        N  +   I+ YF+ +NI  F     + K +  KD +  +++          V R     +++P    +  I+   +   + P++ A + + KKN+   +       N   DL   S  + G + A V GG+  Y + FF+++
Sbjct: 1214 LMRYYNQYSHKELYVKYIYKLYDLHTSYGNKIEAAKTLLRHATMLTFDDDALPQWLIARSLNRHRELHRQLKEDLMEEAGNLFSKGEDWEDALIVYNQLVPVYQNIIMDYDKLAGLLQKIAQLYTSISRTERAYFYYYLVAFYGQGFPAYL-NGHKFVFRSE---KLEMHGEFMQRIMKMYDNPEKIMKTDPCPHLVDSPGRY---IQVFNIDPIGTGCSFENNPEVKPVIKKYFRYYNIQTFE----YSKVEERKDTKWTSIDPSSEFMRNWLVRRRIKTADSLPTDLRFTEIVELSDPIYVTPLQNAVEQMRKKNKELNETAASAESNPNFDLKLLSRDILGVVSAAVMGGVKNY-EVFFTEA 1566          

HSP 2 Score: 61.6178 bits (148), Expect = 7.286e-9
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 2
Query: 1295 LYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECI---LSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL 1618
            +Y+ L  AE   + K S +N+EA+L V +S+G  +E +   +S   S   T Y S V YH++ P W + IKI L S    + YL I F+     DK   E+  FA   +QL
Sbjct:  418 MYITLMQAEL--SGKSSDRNIEARLHVVESNGHVMENVFETISVTGSQLSTVYKSIVVYHTDKPMWTEPIKIALPSCASHDVYLRILFYSKKAYDKPKPEKGPFAIAHVQL 526          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Celegans
Match: ced-5 (CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3])

HSP 1 Score: 65.0846 bits (157), Expect = 5.449e-10
Identity = 78/365 (21.37%), Postives = 155/365 (42.47%), Query Frame = 2
Query: 3620 MMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLP-FDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIST-FNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKN-----DFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVN----------VTRYEVMTETMPNIFTWAPIIN-ENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS 4660
            +M Y  + +   L++ Y  KL  L    G+K+EAA  L      + ++++ LP +      N         K +L  +  NL  + +++E+A  + +  +  Y +   +Y +L+  L+K+++ Y  I    R    YY + F G   P  + +   +VF+     K+    E ++      D P+  ++       ++SP  +   I +  +DPI        N  +   I+ YF+ +NI  F     + K +  KD +  +++          V R     +++P    +  I+   +   + P++ A + + KKN+   +       N   DL   S  + G + A V GG+  Y + FF+++
Sbjct: 1214 LMRYYNQYSHKELYVKYIYKLYDLHTSYGNKIEAAKTLLRHATMLTFDDDALPQWLIARSLNRHRELHRQLKEDLMEEAGNLFSKGEDWEDALIVYNQLVPVYQNIIMDYDKLAGLLQKIAQLYTSISRTERAYFYYYLVAFYGQGFPAYL-NGHKFVFRSE---KLEMHGEFMQRIMKMYDNPEKIMKTDPCPHLVDSPGRY---IQVFNIDPIGTGCSFENNPEVKPVIKKYFRYYNIQTFE----YSKVEERKDTKWTSIDPSSEFMRNWLVRRRIKTADSLPTDLRFTEIVELSDPIYVTPLQNAVEQMRKKNKELNETAASAESNPNFDLKLLSRDILGVVSAAVMGGVKNY-EVFFTEA 1566          

HSP 2 Score: 61.6178 bits (148), Expect = 7.286e-9
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 2
Query: 1295 LYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECI---LSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL 1618
            +Y+ L  AE   + K S +N+EA+L V +S+G  +E +   +S   S   T Y S V YH++ P W + IKI L S    + YL I F+     DK   E+  FA   +QL
Sbjct:  418 MYITLMQAEL--SGKSSDRNIEARLHVVESNGHVMENVFETISVTGSQLSTVYKSIVVYHTDKPMWTEPIKIALPSCASHDVYLRILFYSKKAYDKPKPEKGPFAIAHVQL 526          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0330303)

HSP 1 Score: 186.422 bits (472), Expect = 1.103e-46
Identity = 163/662 (24.62%), Postives = 309/662 (46.68%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENI--EMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFL-------CKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEET---LPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP----IESPYEHKMIIYIAKMDPIPFDLDLNKNR-NIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSD----SSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSV 4873
            ++P +WL + L  +++    L +  + +    L  +    +L  ++   + AF+TQ  L+LE++   KR+KIL ++ DMR+ +  + L++     S +      F   MV     V+L+P P +R   +  F  ++            +  ++I  ++ +  E  GD+EY            +    +  E     +  V +L++  L+ R +               + + FYK E+N   +++ Y  KL  L     +  EA   LK+    + W+ ET    PFD      +        K  L ++I+    + + +E+   +C      Y    F+Y +LS  L + ++F++ I+T+ R +  Y+R+ F G  LP  +R+ + +V++   + ++    + L+ +FP A+I    + PP    + +P ++   I I+ + P+     L      +  KI  +++ +++  F  D   +KG VDKDNE K++ + R  + +   +P I  W  +  + ++ L P+E A +II    +   +LI +Y  + ++++NPFSM LQGT+DA V GG++KY +AFFS+    S         ++  K  ++EQ  +L  AL LH +L    V  LH RL   F  +  ++  +   K + S S+
Sbjct:  978 VFPNDWLVMKLAANDVLRMSLEEFAKPLVYRFLGPQAFDSQLWWSYFSLAVAFLTQPSLQLEQYREPKRLKILHSHGDMRVLMGFQILSMW----SQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMMQCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRETQSFAPFDNSGQPEWQR------KERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN-KQFVYRGLEYERIGAFTQRLQTEFPSAQI-LGNNSPPDNAILNAPDQY---IQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGILRWYEVKQKTMQELTPVEYACEIISNAGKELSELIVQYKRDPKRNINPFSMRLQGTIDANVMGGISKYQEAFFSEQFLKSPQGAGQQANVQRLKVLILEQIQILEQALELHGQLAPSGVQPLHNRLLERFSQLKQSLSGMGRLKRQHSESI 1624          

HSP 2 Score: 83.5741 bits (205), Expect = 1.757e-15
Identity = 93/394 (23.60%), Postives = 165/394 (41.88%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNKLLICK---------FRRPVAFGSFSVKEL--------QSNNEK-VKINLFNLSETDFLKPTSELIK------TKLPSQLGNRFVQVTLETSH----------PNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLK-----------------KCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKY 1948
            D+ +E +LV  V R+G+++   +   I K         FRRP   G  S+ ++        QS++E+     LF   E DF      +IK      + + +  G + + V+L+  H          P   Q   +        + +  D  N      L++ L   EF+R  K + KN+   + V D +G  L +C+       ++  Y S + YH N+P WN+++++ +       +++  EF HC+T+DK   E K FA  F +L                  KC +  K++ +  +R +     P++      + C       SKE+  L  +LCST+L             ++N  +L+L Q+    +TI   D L   LR    +++K+
Sbjct:  265 DLNEELHLVAVVMRVGKIIQSDSIKKIEKSGTLGHGPTFRRPFGVGVLSLGDIAHFDSSLEQSSDEREYNFKLFQCEEKDFHLLPELIIKKSSGKYSPIQASQGTQGIVVSLKLLHGGLGQARQEQPMLFQGSTITRKMGFPDVIMPGDVRND-----LFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKT--EPKLFAFSFARLMDTGGATLGDGLHELYVYKCEDPAKLQVANYLRLQ---CRPRDAQ--AKMDCGGCFSRSSKEVFVLRSLLCSTKL-------------TQNADLLSLLQWRTYPETI--QDSLTGVLRLNDEELVKF 631          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0336766)

HSP 1 Score: 186.422 bits (472), Expect = 1.103e-46
Identity = 163/662 (24.62%), Postives = 309/662 (46.68%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENI--EMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFL-------CKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEET---LPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP----IESPYEHKMIIYIAKMDPIPFDLDLNKNR-NIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSD----SSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSV 4873
            ++P +WL + L  +++    L +  + +    L  +    +L  ++   + AF+TQ  L+LE++   KR+KIL ++ DMR+ +  + L++     S +      F   MV     V+L+P P +R   +  F  ++            +  ++I  ++ +  E  GD+EY            +    +  E     +  V +L++  L+ R +               + + FYK E+N   +++ Y  KL  L     +  EA   LK+    + W+ ET    PFD      +        K  L ++I+    + + +E+   +C      Y    F+Y +LS  L + ++F++ I+T+ R +  Y+R+ F G  LP  +R+ + +V++   + ++    + L+ +FP A+I    + PP    + +P ++   I I+ + P+     L      +  KI  +++ +++  F  D   +KG VDKDNE K++ + R  + +   +P I  W  +  + ++ L P+E A +II    +   +LI +Y  + ++++NPFSM LQGT+DA V GG++KY +AFFS+    S         ++  K  ++EQ  +L  AL LH +L    V  LH RL   F  +  ++  +   K + S S+
Sbjct:  978 VFPNDWLVMKLAANDVLRMSLEEFAKPLVYRFLGPQAFDSQLWWSYFSLAVAFLTQPSLQLEQYREPKRLKILHSHGDMRVLMGFQILSMW----SQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMMQCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRETQSFAPFDNSGQPEWQR------KERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN-KQFVYRGLEYERIGAFTQRLQTEFPSAQI-LGNNSPPDNAILNAPDQY---IQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGILRWYEVKQKTMQELTPVEYACEIISNAGKELSELIVQYKRDPKRNINPFSMRLQGTIDANVMGGISKYQEAFFSEQFLKSPQGAGQQANVQRLKVLILEQIQILEQALELHGQLAPSGVQPLHNRLLERFSQLKQSLSGMGRLKRQHSESI 1624          

HSP 2 Score: 83.5741 bits (205), Expect = 1.757e-15
Identity = 93/394 (23.60%), Postives = 165/394 (41.88%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNKLLICK---------FRRPVAFGSFSVKEL--------QSNNEK-VKINLFNLSETDFLKPTSELIK------TKLPSQLGNRFVQVTLETSH----------PNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLK-----------------KCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKY 1948
            D+ +E +LV  V R+G+++   +   I K         FRRP   G  S+ ++        QS++E+     LF   E DF      +IK      + + +  G + + V+L+  H          P   Q   +        + +  D  N      L++ L   EF+R  K + KN+   + V D +G  L +C+       ++  Y S + YH N+P WN+++++ +       +++  EF HC+T+DK   E K FA  F +L                  KC +  K++ +  +R +     P++      + C       SKE+  L  +LCST+L             ++N  +L+L Q+    +TI   D L   LR    +++K+
Sbjct:  265 DLNEELHLVAVVMRVGKIIQSDSIKKIEKSGTLGHGPTFRRPFGVGVLSLGDIAHFDSSLEQSSDEREYNFKLFQCEEKDFHLLPELIIKKSSGKYSPIQASQGTQGIVVSLKLLHGGLGQARQEQPMLFQGSTITRKMGFPDVIMPGDVRND-----LFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKT--EPKLFAFSFARLMDTGGATLGDGLHELYVYKCEDPAKLQVANYLRLQ---CRPRDAQ--AKMDCGGCFSRSSKEVFVLRSLLCSTKL-------------TQNADLLSLLQWRTYPETI--QDSLTGVLRLNDEELVKF 631          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0330304)

HSP 1 Score: 186.037 bits (471), Expect = 1.412e-46
Identity = 163/662 (24.62%), Postives = 309/662 (46.68%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENI--EMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFL-------CKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEET---LPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP----IESPYEHKMIIYIAKMDPIPFDLDLNKNR-NIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSD----SSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSV 4873
            ++P +WL + L  +++    L +  + +    L  +    +L  ++   + AF+TQ  L+LE++   KR+KIL ++ DMR+ +  + L++     S +      F   MV     V+L+P P +R   +  F  ++            +  ++I  ++ +  E  GD+EY            +    +  E     +  V +L++  L+ R +               + + FYK E+N   +++ Y  KL  L     +  EA   LK+    + W+ ET    PFD      +        K  L ++I+    + + +E+   +C      Y    F+Y +LS  L + ++F++ I+T+ R +  Y+R+ F G  LP  +R+ + +V++   + ++    + L+ +FP A+I    + PP    + +P ++   I I+ + P+     L      +  KI  +++ +++  F  D   +KG VDKDNE K++ + R  + +   +P I  W  +  + ++ L P+E A +II    +   +LI +Y  + ++++NPFSM LQGT+DA V GG++KY +AFFS+    S         ++  K  ++EQ  +L  AL LH +L    V  LH RL   F  +  ++  +   K + S S+
Sbjct:  978 VFPNDWLVMKLAANDVLRMSLEEFAKPLVYRFLGPQAFDSQLWWSYFSLAVAFLTQPSLQLEQYREPKRLKILHSHGDMRVLMGFQILSMW----SQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMMQCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRETQSFAPFDNSGQPEWQR------KERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN-KQFVYRGLEYERIGAFTQRLQTEFPSAQI-LGNNSPPDNAILNAPDQY---IQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGILRWYEVKQKTMQELTPVEYACEIISNAGKELSELIVQYKRDPKRNINPFSMRLQGTIDANVMGGISKYQEAFFSEQFLKSPQGAGQQANVQRLKVLILEQIQILEQALELHGQLAPSGVQPLHNRLLERFSQLKQSLSGMGRLKRQHSESI 1624          

HSP 2 Score: 83.5741 bits (205), Expect = 2.082e-15
Identity = 93/394 (23.60%), Postives = 165/394 (41.88%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNKLLICK---------FRRPVAFGSFSVKEL--------QSNNEK-VKINLFNLSETDFLKPTSELIK------TKLPSQLGNRFVQVTLETSH----------PNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLK-----------------KCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKY 1948
            D+ +E +LV  V R+G+++   +   I K         FRRP   G  S+ ++        QS++E+     LF   E DF      +IK      + + +  G + + V+L+  H          P   Q   +        + +  D  N      L++ L   EF+R  K + KN+   + V D +G  L +C+       ++  Y S + YH N+P WN+++++ +       +++  EF HC+T+DK   E K FA  F +L                  KC +  K++ +  +R +     P++      + C       SKE+  L  +LCST+L             ++N  +L+L Q+    +TI   D L   LR    +++K+
Sbjct:  265 DLNEELHLVAVVMRVGKIIQSDSIKKIEKSGTLGHGPTFRRPFGVGVLSLGDIAHFDSSLEQSSDEREYNFKLFQCEEKDFHLLPELIIKKSSGKYSPIQASQGTQGIVVSLKLLHGGLGQARQEQPMLFQGSTITRKMGFPDVIMPGDVRND-----LFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKT--EPKLFAFSFARLMDTGGATLGDGLHELYVYKCEDPAKLQVANYLRLQ---CRPRDAQ--AKMDCGGCFSRSSKEVFVLRSLLCSTKL-------------TQNADLLSLLQWRTYPETI--QDSLTGVLRLNDEELVKF 631          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0336765)

HSP 1 Score: 184.882 bits (468), Expect = 3.101e-46
Identity = 165/668 (24.70%), Postives = 312/668 (46.71%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENI--EMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------HMFLC-----KFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEET---LPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP----IESPYEHKMIIYIAKMDPIPFDLDLNKNR-NIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSD----SSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSV 4873
            ++P +WL + L  +++    L +  + +    L  +    +L  ++   + AF+TQ  L+LE++   KR+KIL ++ DMR+ +  + L++     S +      F   MV     V+L+P P +R   +  F  ++            +  ++I  ++ +  E  GD+EY        H+ L      +    +  E     +  V +L++  L+ R +               + + FYK E+N   +++ Y  KL  L     +  EA   LK+    + W+ ET    PFD      +        K  L ++I+    + + +E+   +C      Y    F+Y +LS  L + ++F++ I+T+ R +  Y+R+ F G  LP  +R+ + +V++   + ++    + L+ +FP A+I    + PP    + +P ++   I I+ + P+     L      +  KI  +++ +++  F  D   +KG VDKDNE K++ + R  + +   +P I  W  +  + ++ L P+E A +II    +   +LI +Y  + ++++NPFSM LQGT+DA V GG++KY +AFFS+    S         ++  K  ++EQ  +L  AL LH +L    V  LH RL   F  +  ++  +   K + S S+
Sbjct:  978 VFPNDWLVMKLAANDVLRMSLEEFAKPLVYRFLGPQAFDSQLWWSYFSLAVAFLTQPSLQLEQYREPKRLKILHSHGDMRVLMGFQILSMW----SQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMMQCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTMEHLSLVLLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRETQSFAPFDNSGQPEWQR------KERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN-KQFVYRGLEYERIGAFTQRLQTEFPSAQI-LGNNSPPDNAILNAPDQY---IQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGILRWYEVKQKTMQELTPVEYACEIISNAGKELSELIVQYKRDPKRNINPFSMRLQGTIDANVMGGISKYQEAFFSEQFLKSPQGAGQQANVQRLKVLILEQIQILEQALELHGQLAPSGVQPLHNRLLERFSQLKQSLSGMGRLKRQHSESI 1630          

HSP 2 Score: 83.5741 bits (205), Expect = 1.945e-15
Identity = 93/394 (23.60%), Postives = 165/394 (41.88%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNKLLICK---------FRRPVAFGSFSVKEL--------QSNNEK-VKINLFNLSETDFLKPTSELIK------TKLPSQLGNRFVQVTLETSH----------PNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLK-----------------KCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKY 1948
            D+ +E +LV  V R+G+++   +   I K         FRRP   G  S+ ++        QS++E+     LF   E DF      +IK      + + +  G + + V+L+  H          P   Q   +        + +  D  N      L++ L   EF+R  K + KN+   + V D +G  L +C+       ++  Y S + YH N+P WN+++++ +       +++  EF HC+T+DK   E K FA  F +L                  KC +  K++ +  +R +     P++      + C       SKE+  L  +LCST+L             ++N  +L+L Q+    +TI   D L   LR    +++K+
Sbjct:  265 DLNEELHLVAVVMRVGKIIQSDSIKKIEKSGTLGHGPTFRRPFGVGVLSLGDIAHFDSSLEQSSDEREYNFKLFQCEEKDFHLLPELIIKKSSGKYSPIQASQGTQGIVVSLKLLHGGLGQARQEQPMLFQGSTITRKMGFPDVIMPGDVRND-----LFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKT--EPKLFAFSFARLMDTGGATLGDGLHELYVYKCEDPAKLQVANYLRLQ---CRPRDAQ--AKMDCGGCFSRSSKEVFVLRSLLCSTKL-------------TQNADLLSLLQWRTYPETI--QDSLTGVLRLNDEELVKF 631          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0330305)

HSP 1 Score: 184.882 bits (468), Expect = 3.101e-46
Identity = 165/668 (24.70%), Postives = 312/668 (46.71%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENI--EMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------HMFLC-----KFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEET---LPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP----IESPYEHKMIIYIAKMDPIPFDLDLNKNR-NIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSD----SSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSV 4873
            ++P +WL + L  +++    L +  + +    L  +    +L  ++   + AF+TQ  L+LE++   KR+KIL ++ DMR+ +  + L++     S +      F   MV     V+L+P P +R   +  F  ++            +  ++I  ++ +  E  GD+EY        H+ L      +    +  E     +  V +L++  L+ R +               + + FYK E+N   +++ Y  KL  L     +  EA   LK+    + W+ ET    PFD      +        K  L ++I+    + + +E+   +C      Y    F+Y +LS  L + ++F++ I+T+ R +  Y+R+ F G  LP  +R+ + +V++   + ++    + L+ +FP A+I    + PP    + +P ++   I I+ + P+     L      +  KI  +++ +++  F  D   +KG VDKDNE K++ + R  + +   +P I  W  +  + ++ L P+E A +II    +   +LI +Y  + ++++NPFSM LQGT+DA V GG++KY +AFFS+    S         ++  K  ++EQ  +L  AL LH +L    V  LH RL   F  +  ++  +   K + S S+
Sbjct:  978 VFPNDWLVMKLAANDVLRMSLEEFAKPLVYRFLGPQAFDSQLWWSYFSLAVAFLTQPSLQLEQYREPKRLKILHSHGDMRVLMGFQILSMW----SQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMMQCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTMEHLSLVLLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRETQSFAPFDNSGQPEWQR------KERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN-KQFVYRGLEYERIGAFTQRLQTEFPSAQI-LGNNSPPDNAILNAPDQY---IQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGILRWYEVKQKTMQELTPVEYACEIISNAGKELSELIVQYKRDPKRNINPFSMRLQGTIDANVMGGISKYQEAFFSEQFLKSPQGAGQQANVQRLKVLILEQIQILEQALELHGQLAPSGVQPLHNRLLERFSQLKQSLSGMGRLKRQHSESI 1630          

HSP 2 Score: 83.5741 bits (205), Expect = 1.945e-15
Identity = 93/394 (23.60%), Postives = 165/394 (41.88%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNKLLICK---------FRRPVAFGSFSVKEL--------QSNNEK-VKINLFNLSETDFLKPTSELIK------TKLPSQLGNRFVQVTLETSH----------PNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLK-----------------KCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKY 1948
            D+ +E +LV  V R+G+++   +   I K         FRRP   G  S+ ++        QS++E+     LF   E DF      +IK      + + +  G + + V+L+  H          P   Q   +        + +  D  N      L++ L   EF+R  K + KN+   + V D +G  L +C+       ++  Y S + YH N+P WN+++++ +       +++  EF HC+T+DK   E K FA  F +L                  KC +  K++ +  +R +     P++      + C       SKE+  L  +LCST+L             ++N  +L+L Q+    +TI   D L   LR    +++K+
Sbjct:  265 DLNEELHLVAVVMRVGKIIQSDSIKKIEKSGTLGHGPTFRRPFGVGVLSLGDIAHFDSSLEQSSDEREYNFKLFQCEEKDFHLLPELIIKKSSGKYSPIQASQGTQGIVVSLKLLHGGLGQARQEQPMLFQGSTITRKMGFPDVIMPGDVRND-----LFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPIDKFSTAHVRFEFRHCSTRDKT--EPKLFAFSFARLMDTGGATLGDGLHELYVYKCEDPAKLQVANYLRLQ---CRPRDAQ--AKMDCGGCFSRSSKEVFVLRSLLCSTKL-------------TQNADLLSLLQWRTYPETI--QDSLTGVLRLNDEELVKF 631          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 203.371 bits (516), Expect = 9.446e-52
Identity = 152/577 (26.34%), Postives = 280/577 (48.53%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +NI +  +  + + +    L+ +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F ++   +    K  L   II      + +E    +C      Y S ++Y+ LS      + FY+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct:  987 EMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFLSEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL----REFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1550          

HSP 2 Score: 122.094 bits (305), Expect = 4.883e-27
Identity = 150/633 (23.70%), Postives = 288/633 (45.50%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTD-YFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+  VQHGL L++GDTV I  +  GWY G+ L      N+ GIFP       N+++K  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   D+ V  L +L +++  + K   A     H                L + + +     + +EL + + I D  ++    E F++ +   + G PK+  K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      E   L        + +  S+     + ++ LY+ L   EF++  K  A+NVE  +   D+ GQ L+  ++  +     D Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +    +++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+
Sbjct:   43 FRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKN---PNAKGIFPCCYIHLKNAHIKNKGQFETVVPSE--------DSVITEMTSTLRDWGAMW----KQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRREFSMVDPDDISVTELYRL-MEHRHRKKETPAPVSTHH----------------LFVHLKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKL--NKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACN-TESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDVIMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENANLQDCSRYLKLPFS---KSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEI 632          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 203.371 bits (516), Expect = 9.519e-52
Identity = 152/577 (26.34%), Postives = 280/577 (48.53%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHK-MIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +NI +  +  + + +    L+ +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F ++   +    K  L   II      + +E    +C      Y S ++Y+ LS      + FY+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct:  963 EMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFLSEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL----REFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1526          

HSP 2 Score: 125.946 bits (315), Expect = 3.785e-28
Identity = 154/648 (23.77%), Postives = 292/648 (45.06%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTD-YFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  VQHGL L++GDTV I  +  GWY G+ L      N+ GIFP       N+++K  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   D+ V  L +L +++  + K   A     H                L + + +     + +EL + + I D  ++    E F++ +   + G PK+  K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      E   L        + +  S+     + ++ LY+ L   EF++  K  A+NVE  +   D+ GQ L+  ++  +     D Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +    +++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+
Sbjct:    4 WIPTEHEKYGVVLAGFRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKN---PNAKGIFPCCYIHLKNAHIKNKGQFETVVPSE--------DSVITEMTSTLRDWGAMW----KQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRREFSMVDPDDISVTELYRL-MEHRHRKKETPAPVSTHH----------------LFVHLKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKL--NKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACN-TESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDVIMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENANLQDCSRYLKLPFS---KSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEI 608          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 203.371 bits (516), Expect = 9.583e-52
Identity = 152/577 (26.34%), Postives = 280/577 (48.53%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHK-MIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +NI +  +  + + +    L+ +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F ++   +    K  L   II      + +E    +C      Y S ++Y+ LS      + FY+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct:  963 EMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFLSEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL----REFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1526          

HSP 2 Score: 125.561 bits (314), Expect = 3.908e-28
Identity = 154/648 (23.77%), Postives = 292/648 (45.06%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTD-YFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  VQHGL L++GDTV I  +  GWY G+ L      N+ GIFP       N+++K  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   D+ V  L +L +++  + K   A     H                L + + +     + +EL + + I D  ++    E F++ +   + G PK+  K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      E   L        + +  S+     + ++ LY+ L   EF++  K  A+NVE  +   D+ GQ L+  ++  +     D Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +    +++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+
Sbjct:    4 WIPTEHEKYGVVLAGFRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKN---PNAKGIFPCCYIHLKNAHIKNKGQFETVVPSE--------DSVITEMTSTLRDWGAMW----KQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRREFSMVDPDDISVTELYRL-MEHRHRKKETPAPVSTHH----------------LFVHLKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKL--NKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACN-TESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDVIMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENANLQDCSRYLKLPFS---KSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEI 608          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 202.986 bits (515), Expect = 1.136e-51
Identity = 152/577 (26.34%), Postives = 280/577 (48.53%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +NI +  +  + + +    L+ +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F ++   +    K  L   II      + +E    +C      Y S ++Y+ LS      + FY+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct: 1003 EMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFLSEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL----REFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1566          

HSP 2 Score: 122.094 bits (305), Expect = 5.605e-27
Identity = 150/633 (23.70%), Postives = 288/633 (45.50%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTD-YFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+  VQHGL L++GDTV I  +  GWY G+ L      N+ GIFP       N+++K  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   D+ V  L +L +++  + K   A     H                L + + +     + +EL + + I D  ++    E F++ +   + G PK+  K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      E   L        + +  S+     + ++ LY+ L   EF++  K  A+NVE  +   D+ GQ L+  ++  +     D Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +    +++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+
Sbjct:   59 FRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKN---PNAKGIFPCCYIHLKNAHIKNKGQFETVVPSE--------DSVITEMTSTLRDWGAMW----KQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRREFSMVDPDDISVTELYRL-MEHRHRKKETPAPVSTHH----------------LFVHLKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKL--NKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACN-TESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDVIMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENANLQDCSRYLKLPFS---KSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEI 648          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 199.134 bits (505), Expect = 1.538e-50
Identity = 152/586 (25.94%), Postives = 279/586 (47.61%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +NI +  +  + + +    L+ +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                 L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F ++   +    K  L   II      + +E    +C      Y S ++Y+ LS      + FY+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct:  960 EMFPKDWTVMRLVTNNIIITTVLYLSDALRKNFLSEKFDYKVWDSYFCLSVIFINQTCLQLETFSASKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL----REFLSYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVERRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1532          

HSP 2 Score: 127.102 bits (318), Expect = 1.436e-28
Identity = 155/658 (23.56%), Postives = 294/658 (44.68%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTD-YFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQT--ITKDDI 1903
            W   E    G V   F+  VQHGL L++GDTV I  +  GWY G+ L      N+ GIFP       N+++K  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   D+ V  L +L    + + +                  P     + L + + +     + +EL + + I D  ++    E F++ +   + G PK+  K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      E   L        + +  S+     + ++ LY+ L   EF++  K  A+NVE  +   D+ GQ L+  ++  +     D Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +    +++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+    I KD +
Sbjct:    4 WIPTEHEKYGVVLAGFRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKN---PNAKGIFPCCYIHLKNAHIKNKGQFETVVPSE--------DSVITEMTSTLRDWGAMW----KQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRREFSMVDPDDISVTELYRLMEHRHRKKET-----------------PAPVSTHHLFVHLKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKL--NKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACN-TESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITKKLGFSDVIMPGEMRNDLYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENANLQDCSRYLKLPFS---KSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEIDGSEIVKDTL 618          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Match: DOCK4 (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:100490130])

HSP 1 Score: 191.43 bits (485), Expect = 5.188e-48
Identity = 141/577 (24.44%), Postives = 274/577 (47.49%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYE-HKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  +    +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK  K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  E A  L +  + + W++  L      F ++        K  L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I    +  P E+ ++     + I  + PIP   ++ +   I   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  R LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  981 EMFPKDWTVMRFVANNVIITTVLYLSDALRKNFLNDSFDYKIWDSYFYLAVIFINQSCLQLEMFTPSKMKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEGAYTLLLYDELLEWSDRPL----REFISYPMQTEWQRKEYLHMTIIQNFDRGKCWENGIILCRKLAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLTEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPETQEVLQRDGIPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTALTLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLRTLISQCQARQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1544          

HSP 2 Score: 118.242 bits (295), Expect = 1.082e-25
Identity = 143/612 (23.37%), Postives = 281/612 (45.92%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNK-----------QDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS----NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL----KKCFESGKIENSFMIRTKKNFVI--PKNLNHSTSIICNDPDKN-----LSKELCNLTLVLCSTELSSKNNINELI 1822
            F+   QHGL L++GDTV I  +  GWY G+++      N  GIFP+SYV +  KN  +  K   +     E  +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   ++ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  +     E F++ + +    K   K E++    I L   D+RK+ ++ V++ RIG++     K     ++RRP    + S+ +L +   K    +K+ + N +E+D+ +    +IK KL ++      N  + V+L+  H +  Q   +  D++  S++    S  +           + ++ LY+ +   E+++  K  A+NV+  + + +S GQ L+  +S     P +N   +Y S V YH+NSP+W +LIK+ +       +++  EF HC+TK+K   E+K F  CF+ L     + F  G  E   + + ++N V   P      + +  N P  N      +KE   +T  LCS++L+   ++ +L+
Sbjct:   36 FRATSQHGLTLEIGDTVQILEKCEGWYRGFAVKN---PNVKGIFPSSYVHL--KNACIKNKGQFEMVVPTEDAVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLGHIMNEILDLRRQVLLGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-FAMVDPEEISITELYRLMEHRHRK-----------------KDTPVPASNHHLFVQMKSLMCSNLGEELEVIFSLYDSKESRPISERFFVRLNKNGLPKSPEKSERYSSLFIDLSSSDLRKDIFITVHIIRIGRMGAGEKKNSSNMQYRRPFGCAALSIADLLTGESKDDLVLKVYMCN-TESDWYQIHENIIK-KLNARYNLTGSNTGLAVSLQLLHGDIEQ---IRRDYS--SVFTRGVSITRKLGFSDVIMPGEMRNDLYITIEKGEYEKGGKSVARNVQVSMVILNSEGQILKDYISFGSGEPPAN---EYHSFVLYHNNSPRWAELIKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFCFVPLMQEDGRTFPDGTHE-LIVHKCEENTVFQDPCRYLKLSFLKGNQPGNNNQAVKYTKESFWITSFLCSSKLTQNGDMLDLL 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Match: DOCK4 (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:100490130])

HSP 1 Score: 191.045 bits (484), Expect = 6.957e-48
Identity = 139/574 (24.22%), Postives = 271/574 (47.21%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  +    +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK  K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R                 S + FYK E+N   ++I Y  KL  L     +  E A  L +  + + W++  L      F ++        K  L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I    +  P E+ ++ +   + I  + PIP   ++ +   I   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  R LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  949 EMFPKDWTVMRFVANNVIITTVLYLSDALRKNFLNDSFDYKIWDSYFYLAVIFINQSCLQLEMFTPSKMKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEGAYTLLLYDELLEWSDRPL----REFISYPMQTEWQRKEYLHMTIIQNFDRGKCWENGIILCRKLAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLTEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPETQEVLQRDGIPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTALTLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLRTLISQCQARQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1512          

HSP 2 Score: 110.153 bits (274), Expect = 3.297e-23
Identity = 146/636 (22.96%), Postives = 287/636 (45.13%), Query Frame = 2
Query:   92 KVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNK-----------QDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS----NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL----KKCFESGKIENSFMIRTKKNFVI--PKNLNHSTSIICNDPDKN-----LSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            K+   F+   QHGL L++GDTV I  +  G Y+    + F      GIFP+SYV +  KN  +  K   +     E  +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   ++ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  +     E F++ + +    K   K E++    I L   D+RK+ ++ V++ RIG++     K     ++RRP    + S+ +L +   K    +K+ + N +E+D+ +    +IK KL ++      N  + V+L+  H +  Q   +  D++  S++    S  +           + ++ LY+ +   E+++  K  A+NV+  + + +S GQ L+  +S     P +N   +Y S V YH+NSP+W +LIK+ +       +++  EF HC+TK+K   E+K F  CF+ L     + F  G  E   + + ++N V   P      + +  N P  N      +KE   +T  LCS++L+   ++ +L+  +     I +    LKE+
Sbjct:    7 KMVASFRATSQHGLTLEIGDTVQILEKCEGIYFFLCTLYF-----YGIFPSSYVHL--KNACIKNKGQFEMVVPTEDAVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLGHIMNEILDLRRQVLLGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-FAMVDPEEISITELYRLMEHRHRK-----------------KDTPVPASNHHLFVQMKSLMCSNLGEELEVIFSLYDSKESRPISERFFVRLNKNGLPKSPEKSERYSSLFIDLSSSDLRKDIFITVHIIRIGRMGAGEKKNSSNMQYRRPFGCAALSIADLLTGESKDDLVLKVYMCN-TESDWYQIHENIIK-KLNARYNLTGSNTGLAVSLQLLHGDIEQ---IRRDYS--SVFTRGVSITRKLGFSDVIMPGEMRNDLYITIEKGEYEKGGKSVARNVQVSMVILNSEGQILKDYISFGSGEPPAN---EYHSFVLYHNNSPRWAELIKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFCFVPLMQEDGRTFPDGTHE-LIVHKCEENTVFQDPCRYLKLSFLKGNQPGNNNQAVKYTKESFWITSFLCSSKLTQNGDMLDLLKWRMHPENIPHCLSKLKEI 600          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Match: DOCK4 (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:100490130])

HSP 1 Score: 186.037 bits (471), Expect = 2.631e-46
Identity = 139/585 (23.76%), Postives = 270/585 (46.15%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH----------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  +    +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK  K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                   L K   +   E    ++  V +LM+  L+ R                 S + FYK E+N   ++I Y  KL  L     +  E A  L +  + + W++  L      F ++        K  L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I    +  P E+ ++ +   + I  + PIP   ++ +   I   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  R LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  981 EMFPKDWTVMRFVANNVIITTVLYLSDALRKNFLNDSFDYKIWDSYFYLAVIFINQSCLQLEMFTPSKMKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSNTIITFFYFFFSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEGAYTLLLYDELLEWSDRPL----REFISYPMQTEWQRKEYLHMTIIQNFDRGKCWENGIILCRKLAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLTEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPETQEVLQRDGIPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTALTLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLRTLISQCQARQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1555          

HSP 2 Score: 118.242 bits (295), Expect = 1.174e-25
Identity = 147/631 (23.30%), Postives = 288/631 (45.64%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNK-----------QDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS----NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL----KKCFESGKIENSFMIRTKKNFVI--PKNLNHSTSIICNDPDKN-----LSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+   QHGL L++GDTV I  +  GWY G+++      N  GIFP+SYV +  KN  +  K   +     E  +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   ++ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  +     E F++ + +    K   K E++    I L   D+RK+ ++ V++ RIG++     K     ++RRP    + S+ +L +   K    +K+ + N +E+D+ +    +IK KL ++      N  + V+L+  H +  Q   +  D++  S++    S  +           + ++ LY+ +   E+++  K  A+NV+  + + +S GQ L+  +S     P +N   +Y S V YH+NSP+W +LIK+ +       +++  EF HC+TK+K   E+K F  CF+ L     + F  G  E   + + ++N V   P      + +  N P  N      +KE   +T  LCS++L+   ++ +L+  +     I +    LKE+
Sbjct:   36 FRATSQHGLTLEIGDTVQILEKCEGWYRGFAVKN---PNVKGIFPSSYVHL--KNACIKNKGQFEMVVPTEDAVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLGHIMNEILDLRRQVLLGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-FAMVDPEEISITELYRLMEHRHRK-----------------KDTPVPASNHHLFVQMKSLMCSNLGEELEVIFSLYDSKESRPISERFFVRLNKNGLPKSPEKSERYSSLFIDLSSSDLRKDIFITVHIIRIGRMGAGEKKNSSNMQYRRPFGCAALSIADLLTGESKDDLVLKVYMCN-TESDWYQIHENIIK-KLNARYNLTGSNTGLAVSLQLLHGDIEQ---IRRDYS--SVFTRGVSITRKLGFSDVIMPGEMRNDLYITIEKGEYEKGGKSVARNVQVSMVILNSEGQILKDYISFGSGEPPAN---EYHSFVLYHNNSPRWAELIKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFCFVPLMQEDGRTFPDGTHE-LIVHKCEENTVFQDPCRYLKLSFLKGNQPGNNNQAVKYTKESFWITSFLCSSKLTQNGDMLDLLKWRMHPENIPHCLSKLKEI 626          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Match: DOCK4 (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:100490130])

HSP 1 Score: 185.652 bits (470), Expect = 2.798e-46
Identity = 141/588 (23.98%), Postives = 274/588 (46.60%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH----------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHK-MIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  +    +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK  K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                   L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  E A  L +  + + W++  L      F ++        K  L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I    +  P E+ ++ +   + I  + PIP   ++ +   I   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  R LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  973 EMFPKDWTVMRFVANNVIITTVLYLSDALRKNFLNDSFDYKIWDSYFYLAVIFINQSCLQLEMFTPSKMKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSNTIITFFYFFFSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEGAYTLLLYDELLEWSDRPL----REFISYPMQTEWQRKEYLHMTIIQNFDRGKCWENGIILCRKLAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLTEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPETQEVLQRDGIPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTALTLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLRTLISQCQARQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1547          

HSP 2 Score: 108.997 bits (271), Expect = 6.678e-23
Identity = 145/631 (22.98%), Postives = 285/631 (45.17%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNK-----------QDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS----NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL----KKCFESGKIENSFMIRTKKNFVI--PKNLNHSTSIICNDPDKN-----LSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+   QHGL L++GDTV I  +  G Y+    + F      GIFP+SYV +  KN  +  K   +     E  +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   ++ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  +     E F++ + +    K   K E++    I L   D+RK+ ++ V++ RIG++     K     ++RRP    + S+ +L +   K    +K+ + N +E+D+ +    +IK KL ++      N  + V+L+  H +  Q   +  D++  S++    S  +           + ++ LY+ +   E+++  K  A+NV+  + + +S GQ L+  +S     P +N   +Y S V YH+NSP+W +LIK+ +       +++  EF HC+TK+K   E+K F  CF+ L     + F  G  E   + + ++N V   P      + +  N P  N      +KE   +T  LCS++L+   ++ +L+  +     I +    LKE+
Sbjct:   36 FRATSQHGLTLEIGDTVQILEKCEGIYFFLCTLYF-----YGIFPSSYVHL--KNACIKNKGQFEMVVPTEDAVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLGHIMNEILDLRRQVLLGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-FAMVDPEEISITELYRLMEHRHRK-----------------KDTPVPASNHHLFVQMKSLMCSNLGEELEVIFSLYDSKESRPISERFFVRLNKNGLPKSPEKSERYSSLFIDLSSSDLRKDIFITVHIIRIGRMGAGEKKNSSNMQYRRPFGCAALSIADLLTGESKDDLVLKVYMCN-TESDWYQIHENIIK-KLNARYNLTGSNTGLAVSLQLLHGDIEQ---IRRDYS--SVFTRGVSITRKLGFSDVIMPGEMRNDLYITIEKGEYEKGGKSVARNVQVSMVILNSEGQILKDYISFGSGEPPAN---EYHSFVLYHNNSPRWAELIKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFCFVPLMQEDGRTFPDGTHE-LIVHKCEENTVFQDPCRYLKLSFLKGNQPGNNNQAVKYTKESFWITSFLCSSKLTQNGDMLDLLKWRMHPENIPHCLSKLKEI 624          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Match: DOCK4 (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:100490130])

HSP 1 Score: 185.652 bits (470), Expect = 3.244e-46
Identity = 139/585 (23.76%), Postives = 270/585 (46.15%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH----------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHK-MIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  +    +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK  K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                   L K   +   E    ++  V +LM+  L+ R                 S + FYK E+N   ++I Y  KL  L     +  E A  L +  + + W++  L      F ++        K  L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I    +  P E+ ++ +   + I  + PIP   ++ +   I   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  R LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  981 EMFPKDWTVMRFVANNVIITTVLYLSDALRKNFLNDSFDYKIWDSYFYLAVIFINQSCLQLEMFTPSKMKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSNTIITFFYFFFSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEGAYTLLLYDELLEWSDRPL----REFISYPMQTEWQRKEYLHMTIIQNFDRGKCWENGIILCRKLAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLTEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPETQEVLQRDGIPDNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTALTLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLRTLISQCQARQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1555          

HSP 2 Score: 117.857 bits (294), Expect = 1.436e-25
Identity = 147/631 (23.30%), Postives = 288/631 (45.64%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNK-----------QDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS----NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL----KKCFESGKIENSFMIRTKKNFVI--PKNLNHSTSIICNDPDKN-----LSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+   QHGL L++GDTV I  +  GWY G+++      N  GIFP+SYV +  KN  +  K   +     E  +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   ++ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  +     E F++ + +    K   K E++    I L   D+RK+ ++ V++ RIG++     K     ++RRP    + S+ +L +   K    +K+ + N +E+D+ +    +IK KL ++      N  + V+L+  H +  Q   +  D++  S++    S  +           + ++ LY+ +   E+++  K  A+NV+  + + +S GQ L+  +S     P +N   +Y S V YH+NSP+W +LIK+ +       +++  EF HC+TK+K   E+K F  CF+ L     + F  G  E   + + ++N V   P      + +  N P  N      +KE   +T  LCS++L+   ++ +L+  +     I +    LKE+
Sbjct:   36 FRATSQHGLTLEIGDTVQILEKCEGWYRGFAVKN---PNVKGIFPSSYVHL--KNACIKNKGQFEMVVPTEDAVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLGHIMNEILDLRRQVLLGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-FAMVDPEEISITELYRLMEHRHRK-----------------KDTPVPASNHHLFVQMKSLMCSNLGEELEVIFSLYDSKESRPISERFFVRLNKNGLPKSPEKSERYSSLFIDLSSSDLRKDIFITVHIIRIGRMGAGEKKNSSNMQYRRPFGCAALSIADLLTGESKDDLVLKVYMCN-TESDWYQIHENIIK-KLNARYNLTGSNTGLAVSLQLLHGDIEQ---IRRDYS--SVFTRGVSITRKLGFSDVIMPGEMRNDLYITIEKGEYEKGGKSVARNVQVSMVILNSEGQILKDYISFGSGEPPAN---EYHSFVLYHNNSPRWAELIKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFCFVPLMQEDGRTFPDGTHE-LIVHKCEENTVFQDPCRYLKLSFLKGNQPGNNNQAVKYTKESFWITSFLCSSKLTQNGDMLDLLKWRMHPENIPHCLSKLKEI 626          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Match: Dock3 (dedicator of cyto-kinesis 3 [Source:MGI Symbol;Acc:MGI:2429763])

HSP 1 Score: 199.134 bits (505), Expect = 1.701e-50
Identity = 161/644 (25.00%), Postives = 303/644 (47.05%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            ++P++W+ + L  SNI +  +  +   +    TET    ++  ++   +  F+ Q  L+LE  + +KR KIL+ Y DMR+ +     ++  N    + +    F   M+     V+L+P P++R  ++P F  ++     K  +  ++  ++I  ++++  EG GDE Y                 L K   +   E     V  V +LM+  L+ R                 + M FYK E+N   ++I Y  KL  +     +  EAA  L +  + + W +  L      F ++        K  L  KII+   + + +E    +C      Y S ++Y+ LS   K  + +Y+ II + RL+  ++R+ F G   P  +R+ ++YV +   + ++   ++ + ++FP A    + + P           + I  + PIP  +D+ +   +  +++ +++ +N+  F  D  FHKG  DKDNE K++ + R  + +T ++P I  W  +    +  ++P+E A  ++  KNQ  R LI +Y ++ +  ++N  SM L G +DA VNGG+ +Y +AFF     +    D  +I   K+ + EQ  +L   LA+H+K V P +  LH++L   F+ M  ++
Sbjct:  992 VFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQN----LGDHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFGLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKVGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPL----REFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIIEQQRLEPEFFRVGFYGRKFPFFLRN-KEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKDNEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKISQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASL 1626          

HSP 2 Score: 125.946 bits (315), Expect = 3.773e-28
Identity = 135/568 (23.77%), Postives = 250/568 (44.01%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKF-----VFKEIPL-DIRKEGYLVVYVYRIGQLLTDPNKLLICK--FRRPVAFGSFSVKE-LQS-----------------NNE----KVKINLFNLSETDFLKPTS---------------ELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            WT  EE   G V   F+ +V  GL+L++G+TV I  +  GWY G S  K    N  G+FP +Y+ +  K  IV  +   +    LE  +   + TTL    S+W    K+L  +   +      + +N++++L   ++     ++++ ++  H+ + ++  N  L +D    K+   V+    + V+ L K+++ +   ++   +  D        + +      +    ++ +F +  + ++  + + + D  +  Q    +L  L  + G P+   EK      +F ++   D++++ Y+V +V RIG++L + +K       +RRP      S+ + LQS                 NNE    ++  N+   S T +  P++               E I+ + P  + NR + +T +   P+     D+ ND                    LY+ L   +F+R  K   KN+E  + V  + G+ L +CI       N++ Y S V YHSNSP+W ++IK+ +       S+L  EF HC+TKDK   E+K F   F  L +
Sbjct:    2 WTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKK---PNVKGLFPANYIHL--KKAIVSNRGQYETVVPLEDSIVTEVTTTLQEWASLW----KQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKD-FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVP--HHFFFSLKSFTYNTIGEDSDVFFSLYDMREGKQISERFLVRLN-KNGGPR-NPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDFVLKVYTCNNESEWTQIHENIIRKSSTKYSAPSASHGLIISLQLFRGDMEQIRRENP-MIFNRGLAITRKLGFPDVIMPGDIRND--------------------LYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFSPLMR 532          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Match: Dock4 (dedicator of cytokinesis 4 [Source:MGI Symbol;Acc:MGI:1918006])

HSP 1 Score: 191.43 bits (485), Expect = 4.173e-48
Identity = 143/586 (24.40%), Postives = 277/586 (47.27%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYE-HKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                 L K   +   E    ++  V +LM+  L+ R   KI     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++     + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  962 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKIGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGAKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1534          

HSP 2 Score: 127.102 bits (318), Expect = 1.429e-28
Identity = 154/653 (23.58%), Postives = 288/653 (44.10%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNAR------MLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPLDI-----RKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQY-----------LDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  V +GL L++GDTV I  +  GWY G++L      N  GIFP+SYV +  KN  V     K+  ++  V+         M +TL   G++W  +L   N+  L        + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   D+ +  L +L               +  H  +    Q  +   + L + M +     + +EL + + + D  ++    E F+L +   R G PK  D+      + +D+     RK+ Y+ V++ RIG++     K     ++RRP      S+ +L +   K    +K+ + N +E+++ +    +IK KL ++      N  + V+L+  H +  Q            + +        I +  +  N      LY+ +   EF++  K  A+NVE  + + DS+GQ L+  +S        ++Y S V YH+NSP+W++L+K+ +       S++  EF HC+TK+K   E+K F   F+ L +  E G+               EN+ +  T +   +P   +    +  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I      LKE+
Sbjct:    2 WIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKN---PNIKGIFPSSYVHL--KNACV-----KNKGQFEMVIPTEDSVITEMTSTLRDWGTMW-KQLYVRNEGDLFHRLW---HIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-YAMVDPEDISITELYRL--------------MEHRHRKKDTPVQASS---HHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRL--NRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLVLKVYMCN-TESEWYQIHENIIK-KLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSDIIMPGEMRND-----LYITVERGEFEKGGKSVARNVEVTMFIVDSNGQPLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGSHIRFEFRHCSTKEK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLP--FSKVIFLGNNNQTMKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Match: Dock4 (dedicator of cytokinesis 4 [Source:MGI Symbol;Acc:MGI:1918006])

HSP 1 Score: 191.43 bits (485), Expect = 4.459e-48
Identity = 143/586 (24.40%), Postives = 278/586 (47.44%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                 L K   +   E    ++  V +LM+  L+ R   KI     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++ +   + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  962 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKIGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGAKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1534          

HSP 2 Score: 127.102 bits (318), Expect = 1.824e-28
Identity = 154/653 (23.58%), Postives = 288/653 (44.10%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNAR------MLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPLDI-----RKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQY-----------LDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  V +GL L++GDTV I  +  GWY G++L      N  GIFP+SYV +  KN  V     K+  ++  V+         M +TL   G++W  +L   N+  L        + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   D+ +  L +L               +  H  +    Q  +   + L + M +     + +EL + + + D  ++    E F+L +   R G PK  D+      + +D+     RK+ Y+ V++ RIG++     K     ++RRP      S+ +L +   K    +K+ + N +E+++ +    +IK KL ++      N  + V+L+  H +  Q            + +        I +  +  N      LY+ +   EF++  K  A+NVE  + + DS+GQ L+  +S        ++Y S V YH+NSP+W++L+K+ +       S++  EF HC+TK+K   E+K F   F+ L +  E G+               EN+ +  T +   +P   +    +  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I      LKE+
Sbjct:    2 WIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKN---PNIKGIFPSSYVHL--KNACV-----KNKGQFEMVIPTEDSVITEMTSTLRDWGTMW-KQLYVRNEGDLFHRLW---HIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-YAMVDPEDISITELYRL--------------MEHRHRKKDTPVQASS---HHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRL--NRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLVLKVYMCN-TESEWYQIHENIIK-KLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSDIIMPGEMRND-----LYITVERGEFEKGGKSVARNVEVTMFIVDSNGQPLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGSHIRFEFRHCSTKEK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLP--FSKVIFLGNNNQTMKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Match: Dock2 (dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc:MGI:2149010])

HSP 1 Score: 189.504 bits (480), Expect = 1.685e-47
Identity = 165/683 (24.16%), Postives = 314/683 (45.97%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIE---MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFL------CKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQL-LEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE------DLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFD 4936
            +YP +W+++ +  + + ++ + K  E +    +  T    +L   +   + AF+TQD L+LE+F+H+K  KIL  Y DMR      + + +  +  NK   I          MV  I  ++L+P  ++R   +P F  ++     +     +   ++I  +++    G GDE+Y   L      C      I + V   V++V  L++  L+ R +    SK  +      + + FYK+  N   ++I Y  KL  L L+ E +  EAA  L +    + W++E      +             K  L   II    + + +EEA  +C    + Y +  F+Y+ LS  L + ++FYE I+   R K  Y+ + + G   P  +R+ + ++++   + +  + +  L + FP+AE     S P  +        I    + P+  +    KN+ +  +I +++K + +  F       +GKVD +NE  ++ + R   +T   +P I  W  +++ +  T++P+E A + +   N+    +I++Y  +    +NP SMLL G +D  V GG  KY KAFF++  + E   D  ++   KD +  Q   L   + +H+K V+  +   H+R+E CF+++   +E      ++  F+ R      ++   Y ++  IS  +M  D
Sbjct:  983 VYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTSFEFQLWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPG--------MVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVEGGRGDEQYMQLLESILMECTAEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKD-NRMSCTVNLLNFYKDN-NREEMYIRYLYKLRDLHLDCENYT-EAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLTQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLRN-KVFIYRGKEYERREDFQMQLLSQFPNAEKMNTTSAPGDDVRNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQKFHYSRPVRRGKVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTVNEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYSREHPEDQDKLSHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREMPDFEDRRVGRPRSMLRSYRQMSVISLASMHSD 1653          

HSP 2 Score: 80.1073 bits (196), Expect = 3.500e-14
Identity = 130/554 (23.47%), Postives = 243/554 (43.86%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEV-LNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQI-KALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPK----WKDEKFVFKEIP-LDI-RKEGYLVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL-----QSNNEKVKINLFN--LSETDFLKP-TSELIKTKLPSQLGNRFVQVTLETSHPNETQ----YLDLDNDHTLES-------IYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE---CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            W + ++   G   + F+ +    L L +GD V I+     WY GY L+K     S GIFP S++ +  K   V ++ + +N    E+ L   + TTL   GSIW    K+L   S  E  +  ++ +  ++     ++  +  K++L ++   +   I+  N +L +D  +     ++L      V SL   + +  ++I + +  +  +        ++  +S  + L + + NF   +G   EL M   + DP +       +L +    KG PK      + K VF ++   D+ R + +L+  + RIG++ L D N K      RRP       + ++     +S+ EK     F+   +E DFL     ++I +K  S  G + + VT++    +  Q    Y  L +  T+ +       I +  D  N      +Y+ L   +FD+  K + +NVE  + V    G+ L    C+ +   + N  +Y S V Y    P+W + +K+ +   D++  +L   F H ++ + K    K FA  +++L K
Sbjct:    4 WRKTDKERHGVAIYNFQGSEAQHLTLQIGDVVRIQETCGDWYRGY-LIKHKL--SQGIFPTSFIHL--KEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIW----KQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDKTSVISLFHAHEEATYKITERIKEEMSKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAELFMS--LYDPHKQTVISENYL-VRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFLHSLLGKVIASKGDS--GGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRND-----IYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLPNAICVGAGDKAMN--EYHSVVYYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMK 536          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Match: Dock1 (dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:2429765])

HSP 1 Score: 172.94 bits (437), Expect = 1.624e-42
Identity = 157/615 (25.53%), Postives = 277/615 (45.04%), Query Frame = 2
Query: 3068 MRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDII--QIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + F  T     K  L  +II+   + + +EEA  +     + Y    F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP +    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E      QI+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct: 1019 LQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATLPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKD-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCAAHLTQRDGFQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYETEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPSFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGDDIKTSPGQY---IQCFTVKP-KLDLPPRFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKISSMVQQHLDDPGLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHGQIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1609          

HSP 2 Score: 90.8929 bits (224), Expect = 1.735e-17
Identity = 147/641 (22.93%), Postives = 271/641 (42.28%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKII-------GKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEF---LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFNL--SETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQIL--NLWQFLK 1873
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +        G++E V+  D          L   + TTL    +IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +          + Q K +    L + +N       +G   E++M   + DP +       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE  I         ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L  NL Q +K
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLP--------LIQEVTTTLREWSTIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEVASKQVEERLQEEKSQKQNMDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMS--LYDPMESKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQAVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETLKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKGELEEKGHSATGKGMQSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTNLLQQNLRQLMK 641          
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Match: sp|Q14185|DOCK1_HUMAN (Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 4.458e-60
Identity = 371/1666 (22.27%), Postives = 709/1666 (42.56%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKII-------GKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEF---LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLN--EKILPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDII--QIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +        G++E V+  D          L   + TTL    +IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +          + Q K +    L + +N       +G   E++M   + DP +       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE  I         ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q L+++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        L   +KN    A K  ++ E L  +M ++E +F  + ++  L      ++   + ++  + LF   N      +D    +  +A + L  I N   +    + L+ +F ++  LN    +L  +KL  +++++ S + +  +C +IL  +    + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G  + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + +  T     K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP +    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E      +I+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLP--------LIQEVTTTLREWSTIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMS--LYDPVESKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQ--QNLRQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVN-EQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMF-TEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKY-----HLERQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GNFVACMT-AILRQMEDYH---YAHLIKTFGKMRTDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGDDIKNSPGQY---IQCFTVKP-KLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1609          
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Match: sp|Q8CIQ7|DOCK3_MOUSE (Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.337e-49
Identity = 161/644 (25.00%), Postives = 302/644 (46.89%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            ++P++W+ + L  SNI +  +  +   +    TET    ++  ++   +  F+ Q  L+LE  + +KR KIL+ Y DMR+ +     ++  N    +      F   M+     V+L+P P++R  ++P F  ++     K  +  ++  ++I  ++++  EG GDE Y                 L K   +   E     V  V +LM+  L+ R                 + M FYK E+N   ++I Y  KL  +     +  EAA  L +  + + W +  L      F ++        K  L  KII+   + + +E    +C      Y S ++Y+ LS   K  + +Y+ II + RL+  ++R+ F G   P  +R+ ++YV +   + ++   ++ + ++FP A    + + P           + I  + PIP  +D+ +   +  +++ +++ +N+  F  D  FHKG  DKDNE K++ + R  + +T ++P I  W  +    +  ++P+E A  ++  KNQ  R LI +Y ++ +  ++N  SM L G +DA VNGG+ +Y +AFF     +    D  +I   K+ + EQ  +L   LA+H+K V P +  LH++L   F+ M  ++
Sbjct:  989 VFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQN----LGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFGLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKVGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPL----REFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIIEQQRLEPEFFRVGFYGRKFPFFLRN-KEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKDNEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKISQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASL 1623          

HSP 2 Score: 125.561 bits (314), Expect = 3.229e-27
Identity = 136/574 (23.69%), Postives = 254/574 (44.25%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVI------TMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKF-----VFKEIPL-DIRKEGYLVVYVYRIGQLLTDPNKLLICK--FRRPVAFGSFSVKE-LQS-----------------NNE----KVKINLFNLSETDFLKPTS---------------ELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            WT  EE   G V   F+ +V  GL+L++G+TV I  +  GWY G S  K    N  G+FP +Y+ +  K  IV  +   +    LE  +   + TTL    S+W    K+L  +   +      + +N++++L   ++     ++++ ++  H+ + ++  N  L +D    K+   V+    + V+ L K+++ +   ++   +  D        + +P+  +   + +      ++ +F +  + ++  + + + D  +  Q    +L  L  + G P+   EK      +F ++   D++++ Y+V +V RIG++L + +K       +RRP      S+ + LQS                 NNE    ++  N+   S T +  P++               E I+ + P  + NR + +T +   P+     D+ ND                    LY+ L   +F+R  K   KN+E  + V  + G+ L +CI       N++ Y S V YHSNSP+W ++IK+ +       S+L  EF HC+TKDK   E+K F   F  L +
Sbjct:    2 WTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKK---PNVKGLFPANYIHL--KKAIVSNRGQYETVVPLEDSIVTEVTTTLQEWASLW----KQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKD-FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVD--------TMRPRHGETCRMPVPYHFFFSLKSFTYNTIGEDSDVFFSLYDMREGKQISERFLVRLN-KNGGPR-NPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDFVLKVYTCNNESEWTQIHENIIRKSSTKYSAPSASHGLIISLQLFRGDMEQIRRENP-MIFNRGLAITRKLGFPDVIMPGDIRND--------------------LYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFSPLMR 532          
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Match: sp|Q8IZD9|DOCK3_HUMAN (Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.562e-48
Identity = 159/644 (24.69%), Postives = 302/644 (46.89%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            ++P++W+ + L  SNI +  +  +   +    TET    ++  ++   +  F+ Q  L+LE  + +KR KIL+ Y DMR+ +     ++  N    +      F   M+     V+L+P P++R  ++P F  ++     K  +  ++  ++I  ++++  EG GDE Y                 L K   +   E     V  V +LM+  L+ R                 + M FYK E+N   ++I Y  KL  +     +  EAA  L +  + + W +  L      F ++        K  L  KII+   + + +E    +C      Y S ++Y+ LS   K  + +Y+ I+ + RL+  ++R+ F G   P  +R+ ++YV +   + ++   ++ + ++FP A    + + P           + I  + PIP  +D+ +   +  +++ +++ +N+  F  D  FHKG  DK+NE K++ + R  + +T ++P I  W  +    +  ++P+E A  ++  KNQ  R LI +Y ++ +  ++N  SM L G +DA VNGG+ +Y +AFF     +    D  +I   K+ + EQ  +L   LA+H+K V P +  LH++L   F+ M  ++
Sbjct:  992 VFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQN----LGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFSLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKIGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPL----REFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIMEQQRLEPEFFRVGFYGRKFPFFLRN-KEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKENEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRSLISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYINKHPGDAEKITQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASL 1626          

HSP 2 Score: 125.946 bits (315), Expect = 2.268e-27
Identity = 133/567 (23.46%), Postives = 250/567 (44.09%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKF-----VFKEIPL-DIRKEGYLVVYVYRIGQLLTDPNKLLI--CKFRRPVAFGSFSVKE-LQS-----------------NNE----KVKINLFNLSETDFLKPTS---------------ELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            WT  EE   G V   F+ +V  GL+L++G+TV I  +  GWY G S  K    N  GIFP +Y+ +  K  IV    ++   E +  L   ++T ++     W S  K+L  +   +      + +N++++L   ++     ++++ ++  H+ + ++  N  L +D    K+   V+    + V+ L K+++ +   ++   +  D        + +      +   +++ +F +  + ++  + + + D  +  Q    +L  L  + G P+   EK      +F ++   D++++ Y+V +V RIG++L + +K       +RRP      S+ + LQS                 NNE    ++  N+   S   +  P++               E I+ + P  + NR + +T +   P+     D+ ND                    LY+ L   +F+R  K   KN+E  + V  + G+ L +CI       N++ Y S V YHSNSP+W ++IK+ +       S+L  EF HC+TKDK   E+K F   F  L +
Sbjct:    2 WTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKK---PNVKGIFPANYIHL--KKAIV---SNRGQYETVVPLEDSIVTEVTATLQEWASLWKQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKD-FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVP--HHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLN-KNGGPR-NPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPPHLHYRRPYGCAVLSILDVLQSLTEVKEEKDFVLKVYTCNNESEWSQIHENIIRKSSAKYSAPSASHGLIISLQLLRGDMEQIRRENP-MIFNRGLAITRKLGFPDVIMPGDIRND--------------------LYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFSTLMR 532          
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Match: sp|Q8N1I0|DOCK4_HUMAN (Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3)

HSP 1 Score: 194.897 bits (494), Expect = 2.627e-48
Identity = 142/577 (24.61%), Postives = 279/577 (48.35%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++ +   + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  962 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1525          

HSP 2 Score: 130.568 bits (327), Expect = 1.076e-28
Identity = 153/648 (23.61%), Postives = 288/648 (44.44%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNAR------MLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPLDI-----RKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  V +GL L++GDTV I  +  GWY G++L      N  GIFP+SYV +  KN  V     K+  ++  V+         M +TL   G++W  +L   N+  L        + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   D+ +  L +L    + +                    P  +  + L + M +     + +EL + + + D  ++    E F+L +   R G PK  D+      + +D+     RK+ Y+ V++ RIG++     K     ++RRP      S+ +L +   K    +K+ + N +E+++ +    +IK KL ++      N  + V+L+  H +      E   +          +  SN     + ++ LY+ +   EF++  K  A+NVE  + + DSSGQ L+  +S        ++Y S V YH+NSP+W++L+K+ +       +++  EF HC+TK+K   E+K F   F+ L +  E G+               EN+ +  T +   +P   +    +  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I      LKE+
Sbjct:    2 WIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKN---PNIKGIFPSSYVHL--KNACV-----KNKGQFEMVIPTEDSVITEMTSTLRDWGTMW-KQLYVRNEGDLFHRLW---HIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-YAMVDPEDISITELYRLMEHRHRK-----------------KDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRL--NRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLILKVYMCN-TESEWYQIHENIIK-KLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSVARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGAHIRFEFRHCSTKEK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLP--FSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Match: sp|P59764|DOCK4_MOUSE (Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.119e-47
Identity = 143/586 (24.40%), Postives = 278/586 (47.44%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L      ++  ++   +  F+ Q CL+LE F+ SK+ K+LE Y DMR+ +     ++  N      +F  A    ++     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y                 L K   +   E    ++  V +LM+  L+ R   KI     K +       S + FYK E+N   ++I Y  KL  L     +  EAA  L +  + + W++  L      F  +        K +L   II      + +E    +C    + Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I    +  P E+ ++ +   + I  + PIP   ++ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A +++  KNQ  + LI +      +++NP +M L G +DA VNGG+++Y +AFF
Sbjct:  962 EMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPA----LIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKIGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPL----REFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGAKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFF 1534          

HSP 2 Score: 127.102 bits (318), Expect = 1.276e-27
Identity = 154/653 (23.58%), Postives = 288/653 (44.10%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNAR------MLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPLDI-----RKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIKTKLPSQL----GNRFVQVTLETSHPNETQY-----------LDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W   E    G V   F+  V +GL L++GDTV I  +  GWY G++L      N  GIFP+SYV +  KN  V     K+  ++  V+         M +TL   G++W  +L   N+  L        + +N+I++L   ++      +++  +  H+   ++  N  L +D    K   +++   D+ +  L +L               +  H  +    Q  +   + L + M +     + +EL + + + D  ++    E F+L +   R G PK  D+      + +D+     RK+ Y+ V++ RIG++     K     ++RRP      S+ +L +   K    +K+ + N +E+++ +    +IK KL ++      N  + V+L+  H +  Q            + +        I +  +  N      LY+ +   EF++  K  A+NVE  + + DS+GQ L+  +S        ++Y S V YH+NSP+W++L+K+ +       S++  EF HC+TK+K   E+K F   F+ L +  E G+               EN+ +  T +   +P   +    +  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I      LKE+
Sbjct:    2 WIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKN---PNIKGIFPSSYVHL--KNACV-----KNKGQFEMVIPTEDSVITEMTSTLRDWGTMW-KQLYVRNEGDLFHRLW---HIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKE-YAMVDPEDISITELYRL--------------MEHRHRKKDTPVQASS---HHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRL--NRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLVLKVYMCN-TESEWYQIHENIIK-KLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSDIIMPGEMRND-----LYITVERGEFEKGGKSVARNVEVTMFIVDSNGQPLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGSHIRFEFRHCSTKEK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLP--FSKVIFLGNNNQTMKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Match: W5MM11 (Dedicator of cytokinesis 1 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.999e-61
Identity = 377/1707 (22.09%), Postives = 723/1707 (42.36%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDN---NEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNN-------KEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLAD-FDEAHNLE-----AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDI------RKEGYLVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKELQS----NNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENSFM---IRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAI-KLNISCEILAMSMNSMEPVFMILSKN----NELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILP----KEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSE---DLLTNGTSLVCKTDEF-----IPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVL--YKIGENIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            W   ++   G   + +       L L +GDTV I     GWY GY L +    ++ GIFP  Y+ +  K+  V     K+    NE    L   + TTL    SIW  EL   +K  +           N + ++ +D++++ +        +++L ++   +   I+  N  L++D  +     ++L        SL + +     QI+  + +   +  N++      F++ P  +    L +T+ N    +G   E++M   + DP +       +L +  +  G  K  D+    + +  D+      R+    V  + R+G++ L D N K L    RRP       V ++ +    + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  D  H ++             I +  D  N      +YV L   +FD+ +K + KNVE  +SV D  G++LE  I      +  ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E+S +   +   K  +  K  + +   +       +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q L+++  +   +++K  L+  +  +      +S +   D L  +  +  + L         N  L  Y+R  +    L    +  V ++ + K   S E L  +M ++E +F  + ++    N+L Y  +      E L+     F    +S+  N +   +  +A + +  I N   +    + L+ LF   +F+  K+ P    K+KL  ++ ++ S + +  +C +IL  +    + F      +  Q  L A   LL   +E    KN+   +  V    + +LR   +T ++ G               RDSE     + + T+ + + +E+     I  F K+ T +  +L E +      I   DL          +   +YP +W+ + +  + + ++ +  Y    N + L      ++L   +   + AF+TQ+ L+LE FS  KR KI   Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G   +   V  +  ++     +H EN++     +          + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+EE         + +        K  L  +IIN   + + +EEA  +     + Y +  F+Y++LS+ L+K ++FYE I+   R K  Y+ + + G   P  +R+ + ++++   + +  + +  L   FP+A+ +   + PP E    SP ++     +  +  +P      +N+ +  +I  ++  + +  F       KG+ D DNE   + + R   +T   +P I  W  + + ++  ++P+E A + +   N+   +++  +  +    +NP SMLL G +D  V GG   Y KAFF++  T+E   D  +I+  KD +  Q   L   + +H + VT A+   HERLE CF+ + + +E
Sbjct:    4 WVPTKKEKYGVAIYNYDARGGEELSLQIGDTVHILETYEGWYRGYRLRR---KSTKGIFPACYIHL--KDATVEGNGQKETVIPNEL--PLVQEVTTTLREWASIW-RELYVGDKREM----------FNTVRDMIYDLIEWRSQILSGTLPQDELTELKQKVTSKIDYGNKYLDLDLVVRDKDGNILDPDQTSTISLFRAHEAASKQIEQRIQEEKSQKQNIDLNRQAKFASTPSFA----LFVTLKNVVCKIGEDAEVLMS--LYDPVEFRFISENYL-VRWSSSGLVKDIDQLHNLRSVFTDLGSKDLKRERISFVCQIVRVGRMELRDNNTKKLTSGLRRPFGVAVMDVTDIITGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKDFPHLVDRSTAVARKMGFPEIIMPGDVRND-----IYVTLAQGDFDKGSKTTPKNVEVTMSVYDEDGKRLENVIFPGAGDDGISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALSFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDSSVYLNLPATKLELEEKGYSATGKSLQGLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQ--QNLRQLMKVDGGEVVK-FLQDTLDALFNIMMENSDIDTYDTLVFDALVFIIGLIADRKFQHFNPVLETYIRKHFS-ATLAYTKLTTVLKDYVDKAEKSTEQLFKAMKALEYIFKFIVRSRVLFNQL-YENKGETDFMESLRSLFTSFNDMMSSNSENTV--MVKGAALKYVPTIVNDVKLVFDPKELSKLFT--EFI-LKVPPGRLVKQKLYCMIDIVHSDLFTQHDCREILLPLMTDQLKF-----HLEKQEELEACCQLLSYILEVLYRKNVGPTQWHVQIIMEKLLRTVNRTVISMG---------------RDSELIGSFVASMTATLRQMEEYHYAHLISTFGKMRTDVVDFLMETF------IMFKDL----------IGKNVYPADWVIMNMMQNKVFLRAINQYAAVLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFHKYQDMRRQIGFEIRDMWYNLGPHKIK--------FIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFTRSFQRFENEIITKLDHEVEGGRGDEQYKVLFQKILLEHCRKHKYLAKSGENFVTLVVRLLERLLDYRTIMHDENKENRMSCT---------VNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQAATQGQLKDQLYQEIINYFDKGKMWEEAIILGKELAEQYENEMFDYEQLSALLRKQAQFYESIVKVIRPKPDYFAVGYYGQGFPSFLRN-KMFIYRGKEYERREDFEARLLTQFPNAD-KMKTTTPPNEDIKNSPGQYIQCFTVKPILELPPKF---QNKPVSEQILSFYTVNEVHKFQYSRPVRKGEKDPDNEFANMWIERTTYVTAYKLPGILRWFEVRSVSMVEISPLENAIETMQLTNEKINNMVQRHLNDPNLPINPLSMLLNGIVDPAVMGGFANYEKAFFTEKYTQEHPEDQDKIEKLKDLIAWQIPNLADGVRIHGEKVTEALRPFHERLEACFKQLKEKVE 1607          
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Match: U3IT54 (Dedicator of cytokinesis 1 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=DOCK1 PE=3 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 3.572e-60
Identity = 381/1687 (22.58%), Postives = 711/1687 (42.15%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDN---NEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKA-LLADFDEAHNLE-----AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDI------RKEGYLVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNK--TDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFI---FESANENLKHIQNLTSI--DVLCEYLNCL-------FKSKDF--------LNEKI--LPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEV------KTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +  K  IV  K   +    NE    L   + TTL     IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  LL +  +  N++      F+  P  +    L + + N    +G   E++M   + DP +       +L +  +  G PK  D     + +  D+      R +   V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE ++  P + ++  ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + N     +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q LK++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        L   +K    NA K  I+ ++   +M ++E +F  +           +  RI         LF   Y +    D R+ +   F+S NE +  I + T I      +YL  +       F  K+         LN  +  L  +KL  +++++ S + +  +C +IL       + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G+ + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+EE         + +        K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  L+K ++FYE I+   R K  Y+ + + G   P  +R+ + ++++   + +  + +  L   FP+AE     S P  +        I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE       +T+ VT Y+     +P I  W  + +  +  ++P+E A + +   N    +++ ++  +    +NP SMLL G +D  V GG   Y KAFF++    E   D  +I+  KD +  Q   L   + +H + VT A+   HER+E CFR + + +E
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHL--KEAIVEGKGQHETVIPNEL--PLIQEVTTTLREWSIIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPEQTSTISLFRAHEIASKQVEERLLEEKSQKQNIDINRQAKFAATPSFA----LFVNLKNVVCKIGEDAEVLMS--LYDPLESKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKRDKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRSTAVARKMGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLESVIF-PGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDASTYLSLPSTKIELEEKGHSATGKSMQNLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTNLLQ--QNLKQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKTYVDNAEKCGITDQLFK-AMKALEYIFKFI-----------VRSRI---------LFNQLYENKGEADFRESLLQLFKSINEMMSSISDQTVIVKGAALKYLPAIVNDVKLVFDPKELSKLFTEFILNVPVSRLTIQKLYCLIEIVHSDLFTQHDCREILLPTMTDQLKY-----HLERQEDLEACCQLLSNILEVLYKKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GSFVACMT-AILRQMEDYH---YAHLIKTFGKMRSDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMMQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHFTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKSG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQAATQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLRKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFIRN-KVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSSGQYIQCFTVKP-KLDLPSKFHRPVSEQIVSFYRVNEVQRFEYSRPVRKGEKNPDNEFANMWIERTIYVTAYK-----LPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINNMVQQHLNDPNLPINPLSMLLNGIVDPAVMGGFTNYEKAFFNEKYMHEHPEDHDKIEKLKDLIAWQIPFLAEGIRIHGEKVTEALRPFHERMEACFRQLKEKVE 1609          
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Match: H0VTH6 (Dedicator of cytokinesis 1 OS=Cavia porcellus OX=10141 GN=DOCK1 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 6.059e-60
Identity = 379/1670 (22.69%), Postives = 721/1670 (43.17%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKII-------GKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLAD-FDEAHNLEAFSTQPKTSQLNDLVITMNNFEF---LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNK--TDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQIL--NLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKI--LPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDII--QIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +        G++E V+  D          L   + TTL    +IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +   +  NL+  + Q K +    L + +N       +G   E++M   + DP++       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE +L  P + ++  ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L  NL Q +K    +   +++K  L+  +  +      +S     D L  +  +  + L         N  L  Y++  +        L   ++N   NA KL I+ E L  +M ++E +F  + ++  L      ++   + ++  + LF   N      +D+   +  +A + L  I N   +    + L+ +F ++  LN  +  L  +KL  +++++ S + +  +C +IL  +    + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G  + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + +  T     K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP +    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E      QI+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHLKEAIVEGKGQHETVIPSDLP--------LIQEVTTTLREWSTIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNLD-INRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMS--LYDPTEFKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVLF-PGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDATTYLSLPSTKAELEEKGHSATGKSMHSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQPNLRQLMK----VDGGEVVK-FLQDTLDALFNIMMENSESDTFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLRNYVDNAEKLGIN-EQLYKAMKALEYIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDMTVRVKGAALKYLPTIVNDVKLVFDPKELSKMF-TEFILNVPVGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTEQLKY-----HLERQEDLEACCQLLSNILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GNFVACMT-AILRQMEDYH---YAHLIKTFGKMRTDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMMQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCAAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGDDIKNSPGQY---IQCFTVKP-KLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPVRKGEKNPDNEFANMWIERTVYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPGLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHGQIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1609          
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Match: U3JEP1 (Dedicator of cytokinesis 1 OS=Ficedula albicollis OX=59894 GN=DOCK1 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.338e-60
Identity = 385/1694 (22.73%), Postives = 728/1694 (42.98%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDN---NEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLAD-FDEAHNLE-----AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNK--TDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKD--KKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEY--------QFIELLLNGI-KNVFQNAIKLNISCEILAMSMNSMEPVFMILSKN----NELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKI--LPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGENIE---MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEV------KTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE---DLNVFKGRSSS 4867
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +  K  IV  K   +    NE    L   + TTL     IW     + N++          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +   +  N++      F+  P  +    L + + N    +G   E++M   + DP +       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE ++  P + ++  ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D   K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + N     +SK+   ++ ++CST+L+   N++ L +LK   N  +L+  Q LK++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        + +EL L  + K    NA K  I+ ++   +M ++E +F  + ++    N+L Y  +     +E L   + LF+  N     N+D    +  +A + L  I N   +    + L+ LF ++  LN  +  L  +KL  +++++ S + +  +C +IL       + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G+ + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  + +    +  T   ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+EE         + +        K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  L+K ++FYE I+   R K  Y+ + + G   P  +R+ + ++++   + +  + +  L   FP+AE     S P  +        I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE       +T+ VT Y+     +P I  W  + +  +  ++P+E A + +   N    +++ ++  +    +NP SMLL G +D  V GG   Y KAFF++    E   D  +I+  KD +  Q   L   + +H + VT A+   HER+E CFR + D +E    +    G SS 
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHL--KEAIVEGKGQHETVIPNEL--PLIQEVTTTLREWSIIWRQLYVQDNRDMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPEQTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSFA----LFVNLKNVVCKIGEDAEVLMS--LYDPLESKFISENYL-VRWSSCGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRSTAVARKMGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLESVIF-PGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDLIAKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDASTYLSLPSTKIELEEKGHSATGKSMQNLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLH--QNLKQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTNKLLELELTKVLKTYVDNAEKCGITDQLFK-AMKALEYIFKFIVRSRILFNQL-YENKGEADFRESL---LQLFKSINEMMSSNSDQTVIVKGAALKYLPAIVNDVKLVFDPKELSRLF-TEFILNVPVSRLTIQKLYCLIEIVHSDLFTQHDCREILLPTMTDQLKY-----HLERQEDLEACCQLLSNILEVLYKKDVGPTQRHVQIIMENLLRTVNRTVISMG---------------RDSELI---GSFVACMT-AILRQMEDYH---YAHLIKTFGKMRSDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMMQNKVFLRAINQYADMLNKKFLDQTNFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQRFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKSG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQAATQGQLKDQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLRKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFIRN-KVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKTSSGQYIQCFTVKP-KLDLPSKFHRPVSEQIVSFYRVNEVQRFEYSRPVRKGEKNPDNEFANMWIERTIYVTAYK-----LPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINNMVQQHLNDPNLPINPLSMLLNGIVDPAVMGGFANYEKAFFTEKYMHEHPEDHDKIEKLKDLIAWQIPFLAEGIRIHGEKVTEALRPFHERMEACFRQLKDKVEKQYGVRAIDGNSSG 1631          
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Match: U3CX33 (Dedicator of cytokinesis protein 1 OS=Callithrix jacchus OX=9483 GN=DOCK1 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.525e-59
Identity = 373/1666 (22.39%), Postives = 710/1666 (42.62%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKII-------GKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEF---LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEI-PLDIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEG-NYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKI--LPKEKLIFIVQLLQSGIIS--NCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMET---KNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGE--NIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQ--IKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            L L +GDTV I     GWY GY+L K    +  GIFP SY+ +        G++E V+  D          L   + TTL    +IW     + N+E          + I  ++     I+  +  +++L ++   +   I+  N +L++D  +     ++L        SL + +     Q++  L +          + Q K +    L + +N       +G   E++M   + DP +       +L +  +  G PK  D     + VF ++   D+++E    V  + R+G++ L D N + L    RRP       V ++      + +K     F     E DFL+   +++I  K  +  G + + VTL+   P +   +  +  H ++             I +  D  N      +YV L   +FD+ +K +AKNVE  +SV D  G++LE  I         ++Y S + Y    P+W + +K+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E++     + + K  +  K  + +   + +     +SK+   ++ ++CST+L+   N++ L +LK   N  +L   Q L+++  +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y++  +        L   +KN   NA K  ++ E L  +M ++E +F  + ++  L      ++   + ++  + LF   N      +D    +  +A + L  I N   +    + L+ +F ++  LN  +  L  +KL  +++++ S + +  +C +IL  +    + +      +  Q  L A   LL   +E    K++   +R V    + +LR   +T ++ G               RDSE +   G  + C T   + + E  +   + +L + +     D+ V  L       K L+   +YP +W+ + +  + + ++ + +  +  N + L      ++L   +   + AF+TQ+ L+LE FS +KR KIL  Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G           V +V +LM+  L+ R I    +K  +      + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+E+         + +  T     K  L  +II+   + + +EEA  +     + Y +  F+Y++LS  LKK ++FYE I+   R K  Y+ + + G   P  +R  + ++++   + +  + +  L   FP+AE +   + PP E    SP ++   I    + P   DL    +R +  +I  +++ + +  F       KG+ + DNE   + + R    T   +P I  W  + +  +  ++P+E A + +   N     ++ ++ ++    +NP SMLL G +D  V GG   Y KAFF+D   +E    +  I+  KD +  Q   L   + +H   VT A+   HER+E CF+ + + +E
Sbjct:   28 LSLQIGDTVHILETYEGWYRGYTLRK---KSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLP--------LIQEVTTTLREWSTIWRQLYVQDNREMFRS----VRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMS--LYDPVESKFISENYL-VRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKG-QGLWVTLKLL-PGDIHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQ--QNLRQLMKVDGGEVVK-FLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDNAEKPGVN-EQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMVSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMF-TEFILNVPVGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKY-----HLERQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMG---------------RDSELI---GNFVACMT-AILRQMEDYH---YAHLIKTFGKMRTDV-VDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIK--------FIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTG--------ETFVKLVVRLMERLLDYRTIMHDENKE-NRMSCTVNVLNFYKE-IEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCAAHLTQRDGYQATTQGQLKEQLYQEIIHFFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLR-GKVFIYRGKEYERREDFEARLLTQFPNAE-KMKTTSPPGEDIKNSPGQY---IQCFTVKP-KLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFTNYEKAFFTDRYLQEHPEAREKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVE 1609          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 200.675 bits (509), Expect = 4.211e-51
Identity = 152/577 (26.34%), Postives = 278/577 (48.18%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKM-IIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFF 4651
            E++PK+W  + L  +N+ +  +  + + +    L  +   ++  ++   S  F+ Q CL+LE FS SKR KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W+E  L      F N+   +    K  L   II      + +E    +C      Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + ++FP A I    +  P ++ Y+ +   + I  + PIP   D+ +   +   I+ ++K +NI  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF
Sbjct:  941 EMFPKDWTVMRLVTNNVIITTVLYLSDALRKNFLNDKFDYKVWDSYFYLSVIFINQSCLQLETFSPSKRKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHMKAQNFTEASYTLLLYDELLEWSERPL----REFLNYPMQSEWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLSEFPHA-IAMQHANQPDQTIYQAEAQYLQIYAVTPIPDSQDVLQRDGVPDNIKSFYKVNNIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVEKRELVEVSPLENAIEVIENKNLQLRTLITQCQTRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFF 1504          

HSP 2 Score: 99.3673 bits (246), Expect = 3.175e-20
Identity = 139/626 (22.20%), Postives = 272/626 (43.45%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLG-WYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN----ETQYLDLDNDHTLESIYLSNDS---PNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLEC-ILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+  VQ+GL L++GDTV I  +  G   + Y  +K            +  K+  + E V+ K+        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D    K+  S++   D+ V  L +L    + + +                  P  +  + L + M +     + +EL + + I D  ++    E F++ + +    K   K E+     + L   D+RK+ Y+VV++ RIG++     K     ++RRP      S+ +L + + K    +K+   N +E+D+ +    +IK   ++      N  + V L+  H +      +Y+ +       +  L       P ++D+  LY+ L   EFD+  K  A+NVE  +   D  GQ L   + +        +Y + V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +     ++  N+     +KE   +T  LCST+L+   ++ +L+  ++   +I +    LKE+
Sbjct:   21 FRGTVQNGLPLEIGDTVQILEKCEGKLCFSYCHIK-----------EAMTKV--QFETVVPKE--------DTVITEMTSTLRDWGTMW----KQLYVKNEGDLFHRLWHVMNEILDLRRQVLLGHLTHDRMKDVKQHITARLDWGNEQLCLDLVPRKD-FSMVDPDDISVTELYRLMEHRHRKKET-----------------PVPASTHHLFVHMKSLMSSNLGEELEVFFFIYDSRENRPLSERFFVKLNKNGVPKSPEKTERQCTLFVDLGSGDLRKDVYIVVHIIRIGRMGAGEKKNTCSVQYRRPYGCAVVSIADLLTADSKDDHLLKVYACN-TESDWNQIHENIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMAIFTRGVSITRKLGFSDVIMPGERDEEHLYITLEKGEFDKGGKTVARNVEVTVYALDMDGQILRGHVTAGSGEPGADEYHTFVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGFSFVPLMQ--EDGRTLPDGTHELIVHKCEENASLQDCARYLKLPFS---KANLPGNNQAVKATKESFWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSKLKEI 595          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Match: si:dkey-81e3.1 (dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc:HGNC:19192])

HSP 1 Score: 192.586 bits (488), Expect = 1.268e-48
Identity = 161/642 (25.08%), Postives = 307/642 (47.82%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRI----EVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY-----HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            +++PK+W  + L  +N+ +  +  + + +    L  +   ++ +++   S  F+ Q CL+LE F  SKR K+LE Y DMR+    E+   + N+   K ++I +   +F          V+L+P P +R  ++P F  ++     +  +  ++  ++I  +E++  EG GDE Y     ++ L K   +   E     +  V +LM+  L+ R   KI     K +       + + FYK E+N   ++I Y  KL +L     +  EAA  L +  + + W E  L      F  +   +    K  L   II+     + +E    +C      Y + ++Y+ LS      +  Y+ I+ + RL+  ++RI F G   P   R+ +++V + + + ++   ++ + ++FP A    + ++P           + I  + P+P + D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A+++I  K    R LI +      +++NP +M L G +DA VNGGL +Y +AFF+    S    D  +I   ++ + EQ  +L   LA+H+K V   +  LH++L   F  M  ++
Sbjct:  942 DMFPKDWTVMRLVTNNVIITTVLYLSDTLRSNFLNEKFDFKVWESYFYLSIIFIIQPCLQLEMFPPSKRKKVLEKYGDMRVMIGCEIFSMWQNLGDYKVNLIPSLIGSF--------LEVTLVPQPDLRNVLIPVFHDMMDSEERRSGNFKQVEAKLIDKLESLMSEGKGDETYKELFNNILLKKIERETWRESGVSHIATVTRLMERLLDYRDCMKIGEVDGKKIG---CTVNLLNFYKTELNKEEMYIRYIHKLYELHLKAQNFTEAAYTLLLYDELLEWTERPL----REFLTYPMQSEWQRKECLHLTIIHNFDRGKCWENCIILCRELANQYEAYYDYRNLSKMRLMEASLYDKIMNQQRLEPEFFRIGFYGKKFPFFFRN-KEFVCRGNDYERLEAFQQRMLSEFPHAIAMQHANQPDQTILQAEAQYLQIYAVSPVPDNQDVLQRDGVPNNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLSLAQSLPGISRWFEVEKRELVEMSPLENASEVIENKTLQLRTLIAQCQMRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFFAKDYISNHPEDGDKITRLRELMFEQAHILEYGLAVHEKFVPQDMRPLHKKLVDQFHVMRSSL 1567          

HSP 2 Score: 104.76 bits (260), Expect = 8.585e-22
Identity = 146/635 (22.99%), Postives = 278/635 (43.78%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEV---LNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKW--KDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNKLLI-CKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK--TKLPSQLGNRF-VQVTLETSHPNETQ----YLDL--DNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSS-VTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL-----------------KKCFESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            F+  VQHGL L++G+T                         GIFP S++         L+  H  N    E    +   ++T ++V    W +  K+L  ++  E      + + +I+ L   ++      +++  I  H+   ++  N  L +D    ++  S++   ++ V  L +L               +  H    F   P  + ++ L + +N+     V +EL + + I D  +     E F++ +   ++G PK   K E+     + L   D+RK+ Y+V +++RIG+++    K +   ++RRP      SV +L + + K    +K+   N +E+++ +    +I+  +   SQ+G+   + V+L+  H N  Q    Y+ L   N      +  S+     + ++ LY+ L   EF++  K  A+NVE  + +    GQ L+ ++   +     D F S V YHSNSP+W++ IK+ +       ++L  EF HC+TK+K   E+K F   F+ L                  KC E+  +++S     +   K  + P N         N   KN SKE   +  +LCST+L+   ++ +L+  ++   +I++    LK++
Sbjct:   18 FRGTVQHGLPLEIGET-------------------------GIFPCSFIH--------LKHAHIKNKGQFETVIPMEESVITEMTVTLRDWGTMWKQLYVKNEGELFHRLWHVMTEILELRRQVLVGHLTNDRMTDIKQHIIARLDWGNEQLGLDLVPRRD-FSMVDPDEISVTELYRL--------------MERRHRKRDF---PLQTNMHHLFLQVNSLLNCSVAEELHVFFFIYDSREMRPISERFFVRL--NKQGVPKSPEKTERQCTLFVDLGSSDLRKDVYVVAHIFRIGRMVAGEKKSVSNTQYRRPFGCTVISVSDLLTTDFKDDHLLKVYSCN-TESEWYQIHDNIIRKVSSRYSQIGSSTGLAVSLQLLHGNLEQIQKDYMRLFTRNVSITHRLGFSDIIMPGEVRNDLYITLERGEFEKGGKSVARNVEVTVYLLGGDGQVLKGLVCPGSGEPGADEFHSFVLYHSNSPRWSEQIKLVVPPELFRATHLRFEFRHCSTKEK--GEKKLFGYSFVPLMQEDGRTLPDGTHEIIVHKCEETANLQDSSRYLKLPFSKASLQPGN---------NQTMKN-SKESFWIISLLCSTKLTQNGDMLDLLKWRTHPERIMDSLTKLKDI 586          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Match: dock3 (dedicator of cytokinesis 3 [Source:ZFIN;Acc:ZDB-GENE-100624-1])

HSP 1 Score: 189.119 bits (479), Expect = 1.723e-47
Identity = 161/649 (24.81%), Postives = 304/649 (46.84%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRI----EVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYE-HKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTI 4831
            I+P++W  + L  SNI +  +  +   +    T+     ++  ++   +  ++ Q  L+LE  + +KR KIL+ Y DMR+    E+   + N+  NK   I          M+     V+L+P  ++R  ++P F  ++     K  +  ++  ++I  ++++  EG GDE Y                 L K   +   E     V  V +LM+  L+ R                 + + FYK E+N   ++I Y  KL  +     +  EAA  L + ++ + W E  L      F ++   +    K  L  K+I+   + + +E    +C      Y S ++Y+ LS   K  + +Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ +  +FP A I       P E+  +     + I  +  +P ++D+ +   +  +I+ +++ +N+  F  D  FHKG  DK+NE K++ + R  + +T  +P I  W  +    +  ++P+E A  ++  KNQ  R LI +Y ++ L  ++N  SM L G +DA VNGG+ +Y +AFF      T   D  +I   KD + +Q  +L   LA+H+KLV P +  LH++L   F+ M  ++
Sbjct:  949 IFPRDWNVMRLLTSNIIVTTVQYLSPALHKNFTDADFDFKVWNSYFSLAVLYINQPSLQLESITPAKRKKILDKYGDMRVMMAYELFSMWQNLGENKIHFIPG--------MIGPFLGVTLVPQGEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSLVSEGKGDENYRELFGLLTQLFGPYPSLLEKIEQETWRETGISFVTSVTRLMERLLDYRDCMKGDETENKKIGCTVNLLNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYWELLQWEERPL----REFLHYPAQSEWHRKEGLCRKVIHYFNKGKCWEYGIPLCRELAFQYESLYDYQSLSWIRKMEAAYYDNIMEQQRLEPEFFRVGFYGRKFPFFLRN-KEFVCRGHDYERLEAFQQRMLGEFPQA-IAMQHPNQPDEAILQCDAQYLQIYAVAAVPENVDVLQMDRVPDRIKSFYRVNNVRRFRYDRPFHKGSKDKENEFKSLWIERTTLTLTHPLPGISRWFEVEKRELVEVSPLENAISVVENKNQELRTLISQYQHKQLHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKEYIGTHPEDTEKITQLKDLMQDQVHILGVGLAVHEKLVHPEMRPLHKKLIDQFQMMRSSL 1583          

HSP 2 Score: 92.8189 bits (229), Expect = 3.264e-18
Identity = 121/555 (21.80%), Postives = 241/555 (43.42%), Query Frame = 2
Query:  107 FKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSL--GIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQD-HQFEHFWLPILEARKGKPKWKDEKF-----VFKEIP-LDIRKEGYLVVYVYRIGQLLTDPNK--LLICKFRRPVAFG------------------SFSVKELQSNNE----KVKINLFNLSETDFLKPTS--------ELIKTKLPS------QLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            F+ +V HGL L++G+TV    Q L  + G S  +    + L  GIFP SYV +  +  +V  +   +    LE  +   + +TL     +W    K+L  +   +      + +N++++L   ++     ++++ ++  H+ + ++  N  L +D    K+   ++    + V+ L K+++ +   ++      D        + +      + L + + +F +  + ++  + + + D  +  H  E F + +   + G PK   EK      +F ++   D++++ Y+V  V R G++L + +K       +RRP                       F +K    NNE    ++  N+   S T +  P++        +L++ ++         + NR V +T +   P+     D+ ND                    LY+ L   +F+R  K   KN+E  + V  + G+ L +CI       + T++ S V YH+NSP+W+++IK+ +       S+L +EF HC+TKDK   E+K F   F  L +
Sbjct:   19 FRGSVSHGLTLEIGETV----QILEKFEGKSHSQKHCHHLLFSGIFPASYVYL--RKAVVTNRGQYETVVPLEDSVVTEVTSTLQEWAVLW----KQLYVKHKVDLFYKLRHVMNELIDLRRQMLSGHLTQDQIREVKRHVTVRLDWGNEHLGLDLVPRKD-FEMVDADQISVSDLYKMHLSSRHSVQQSTTQGDSMRQRHGEACRIPVP--HHLFVNLKSFTYNTIGEDTDIFFSLYDLREGKHISEKFMVRL--NKNGGPK-NPEKVDRLCALFTDLSNKDMKRDLYIVAQVIRTGRMLLNDSKKGPPHVHYRRPYGCAVLAMSDVLQTISELKEEKDFVLKVYTCNNENEWYQIHENIIRKSSTKYTAPSTNYGLIISLQLLRGEMDQVRRENPMIFNRSVAITRKLGFPDVIMPGDIRND--------------------LYLTLERGDFERGGKSVQKNIEITVYVLYADGEILKDCISLGSGEPHITEHRSYVLYHNNSPRWSEVIKLPIPIDRFRGSHLRLEFRHCSTKDK--GEKKLFGFAFTPLMR 535          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Match: dock1 (dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GENE-080108-5])

HSP 1 Score: 172.555 bits (436), Expect = 1.558e-42
Identity = 198/844 (23.46%), Postives = 354/844 (41.94%), Query Frame = 2
Query: 2960 IYPKNWL-------SIYLKISNISMKVLYKIGENIEML-TTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLN---KNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSVPTLDCVYDR-----------LDSISFKTMSFDTQFSEKNGSFYQEDIRT-SETLSWQFSENNNRFSDDC-----RSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSXXXXXXXXXXXXXXXKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPL------KTPPLPPV 5323
            +YP +W+        ++L+  N    VL     N + L  T   ++L   +   + AF+TQ+ L+LE FS  KR KI   Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G GDE+Y              H +L K G   +   V  +  ++     +H EN++     +          + + FYKE +    ++I Y  KL  L +   +  EAA  L +    + W+EE         + +        K  L  +IIN   + + +EEA  +     + Y +  F++++LS+ L+K ++FYE I+   R K  Y+ + + G   P  +R+ + ++++   + +  +    L   FP+AE     + P  +        I    + P+   L+L    +N+ +  +I  Y+  + +  F       KG+ D DNE   + + R   +T   +P I  W   ++ +   ++P+E A + +   N+   +++  +  +    +NP SMLL G +D  V GG   Y KAFF++   ++   D  +I   KD +  Q   L   + +H + VT A+   HERLE CF+ + + +E            V TL  + D            L   S  ++S DT  S      YQ   +T +  LS Q   N+ + SD+      R +N ++  K+  GS K     T+ P R +R  S        +              S  P   +P + +     S+ ++EL+ +      +TPP  P+
Sbjct:  960 VYPGDWVIMNTMQNKVFLRAINQYAAVL-----NKKFLDQTNFELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFHRYQDMRRQIGFEIRDMWYNLGPHKIK--------FIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFTRSFQRFENEIITKLDHEVEGGRGDEQYKILFQKILSEHCRKHKYLAKSGETFVSLVVRLLERLLDYRTIMHDENKENRMSCT---------VNVLNFYKE-IEREEMYIRYLYKLRDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQAVTQGQLKDQLYQEIINYFDKGKMWEEAIILGKELSEQYENEMFDFEQLSALLRKQAQFYENIVKVIRPKPDYFAVGYYGLGFPSFLRN-KMFIYRGKEYERWEDFVARLLTQFPNAEKMKTTTAPSEDLRMSSGQYIQCFTVKPM---LELPPKFQNKPVSEQIVSYYTINEVNKFQYSRPVRKGEKDPDNEFANMWIERTTYVTAYKLPGILRWFEALSTSTEEVSPLENAIETMQLTNEKINNMVQRHLSDPNLPINPLSMLLNGIVDPAVMGGFTNYEKAFFTEKYIQDHPEDQEKIDKLKDLIAWQIPYLAEGVRIHGEKVTEALRPFHERLEACFKQLKEKVE--------KQYGVKTLPPMADERRGSRPRSMRPLSVASVTSISSDTSPSRPGSDGYQTHTQTYTPKLSKQKC-NSLKKSDESDKKNDRWTNISLL-KTLFGSVKRFCLFTISPLRPQRPKSQVINLGGDKRLSVSPAPPAQPTASSAPPPITPRLKLSFSTLSSSNLELNGMGYGEKGETPPPLPI 1766          

HSP 2 Score: 68.5514 bits (166), Expect = 7.907e-11
Identity = 90/368 (24.46%), Postives = 155/368 (42.12%), Query Frame = 2
Query:  923 DIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPT-SELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENSFM----------IRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQIL--NLWQFLK 1873
            D+++E    V  + R+G++ L D N K L    RRP       V ++      + +K     F     E+DFL+   +++I  K              E +H  +  ++  D  H ++             I +  D  N      +YV L   +FD+ +K + KNVE  +SV D  G++LE           ++Y S + Y    P+W + IK+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E+S +          +  K +F  P   N  T   C      +SK+   ++ ++CST+L+   N++ L +LK   N  +L  NL Q +K
Sbjct:  290 DLKREKISFVCQIVRVGRMELRDNNTKKLTSGLRRPFGVAVMDVTDIITGKMDDEDKQHFIPFQPVAGESDFLQSVINKVIAAK--------------EVNHKGQGLWIRKDFPHLVDRSTAVARKMGFPEIIMPGDVRND-----IYVTLVQGDFDKGSKTTPKNVEVTMSVYDEDGKRLE------GDEGISEYKSVIYYQVKQPRWFETIKVAIPIEDVNRSHLRFTFKHRSSQDYKDKSEKIFALSFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDSSLYLNLPATKLEMEEKGHF--PTGKNMPTLGNC-----TISKDSFQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLQQNLRQLMK 623          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Match: DOCK2 (dedicator of cytokinesis 2 [Source:NCBI gene;Acc:103035845])

HSP 1 Score: 166.392 bits (420), Expect = 1.382e-40
Identity = 157/647 (24.27%), Postives = 299/647 (46.21%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIE---MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKF---GGQDIPEDVSEI---VNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKL-EAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            +YP +W+++ +  + + +  +    + +    +   +  ++L   +   + AF+TQ+ L+L+ FS +KR KIL  Y DMR      + + +  + +NK   I          MV  +  ++L+P  ++R   +P F  ++    +      +   ++I  +++    G GD  Y   L        Q+ P  ++E+   V++V  L++  L+ R +    S+  +      + + FYK+ +N   ++I Y  KL  L  ++G    EAA  L +    + W++E            +       K  L + II+   + + +EEA  +C      Y +  F+Y+ L   LK+ ++FYE I+   R K  Y+ + + G   P  +R+ + ++ +   + +  + +  L + FP + +    +  P +    SP ++     +  +  IP  L   KN+ +  +I +++K + +  F       KGKVD DNE  ++ + R    T   +P I  W    +    T++P+E A + +   N+    +I++Y  +    +NP SMLL G +D  V GG  KY KAFF+D  T+E   D  ++   KD +  Q  LL   ++LH K VT  +   H+R+E CF+ +   +E
Sbjct:  984 VYPSDWVTMIMVQNRVFLGAINTYADTMNHKFLDNNDFEVQLWNNYFHLAVAFITQESLQLQHFSPTKRNKILAKYGDMRRLIGFAIRDMWYKLGVNKICFIPG--------MVGPMLEMTLIPEEELRRATIPIFFDMMQCEHNHTGHFRKFENEIILKLDHEVEGGGGDVRYMELLQTILLECAQERPPLLAEVRNFVSLVTGLLERLLDYRTVMSDDSRN-NRMSCTVNLLNFYKD-INREGMYIRYLYKLRDL-HLDGENFTEAAYTLLLHSKLLKWSDEHCAPQLDIQGPQSQRQL---KETLYDTIISYFDKGKMWEEAIALCKELSDQYELEVFDYELLGQNLKQQAKFYENIMKILRPKPDYFAVGYYGSGFPQFLRN-KVFIHRGKEYERREDFQGQLMSQFP-SSLRLNTTTMPGDDIKNSPQQYIQCFTVQPVLEIPPRL---KNKPVPDQIINFYKSNYVQKFQYSRPVRKGKVDPDNEFASMWIERTTFNTAYKLPGILRWFEATSMTHTTVSPLENAIETMGNTNEKILTMINQYQCDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTDEYTQEHPEDKEKLFRLKDLIAWQIPLLGRGISLHGKRVTDDLRPFHDRMEECFKQLKKKVE 1611          

HSP 2 Score: 82.8037 bits (203), Expect = 3.237e-15
Identity = 132/573 (23.04%), Postives = 242/573 (42.23%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARM------LTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNN-------KEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLE----AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPK----WKDEKFVFKEIP-LDIRKEG-YLVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKE-----LQSNNEKVKINLFN--LSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQ----YLDLDNDHTLES-------IYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI 1645
            WT+ +    G V   F    +  L L +G+TV I+  + GWY GY  +    D   G FP S++++    E++++K   D      V +A M       TTL   G+IW  +L   NK          +    ++  L +D+M++ +         ++  ++   +   I+  N +L +D  +     ++L   +  V SL + + D    I   +   +E  N++      S + ++S  + L + + NF   +G   EL M   + DP++       +L +    KG PK      + K VF ++   D+ +E  YL+  + R+G++ L D + K      RRP       + +     ++ + EK      +  L+E DFL      + T      G + + VT++    +  Q    Y  L +  T+ +       I +  D  N      +Y+ L   +FD+ NK + KNVE  + V D  G+ +   I          +Y S + Y    P+W +  K+ +   +++  +L   F H ++++ K    K FA  F++L K  E G +
Sbjct:    4 WTRTQTERYGVVKWNFTGKGEKQLSLVVGETVYIQEASEGWYKGY--LTRNKDQK-GAFPASFIEL---KEVIIEKRGDDE----VVTSAEMPLVKEVTTTLREWGTIW-KQLFMANK----------KERFKQVQGLMWDLMEWRSQLLSGTLPGDEFKELKQKVTSKIDYGNKILELDLVVRDVNGNILDPDNASVISLFRAHEDATATINERIK--EEQSNVQMDHSGVSARIQSSPTHSLYVFVRNFVCRIGEESELFMS--LYDPNKQVIISENYL-VRWGDKGFPKDVEMLNNLKVVFTDLGNKDLNREKIYLICQIVRVGRMDLKDTSTKKFTNGLRRPFGVAVMDISDIIKGKMECDEEKQHFIPVHPVLTENDFLHTLLNKV-TASRGDSGGQGLWVTMKALVGDIVQIRKEYPHLVDRSTVVARKLGFPEIIMPGDIRND-----IYLTLHSGDFDKYNKTTQKNVEVIMLVCDEEGKIVPNAICLGAGDQPVHEYRSVIYYQIKQPRWMETFKVAIPLEEMQRIHLRFMFRHRSSQESKDKSEKNFAMAFVRLMK--EDGTV 542          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007652.1 (pep scaffold:Pmarinus_7.0:GL478924:2687:150863:1 gene:ENSPMAG00000006889.1 transcript:ENSPMAT00000007652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 1.604e-50
Identity = 160/669 (23.92%), Postives = 313/669 (46.79%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIEM-LTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETY----DDMRI----EVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH--------------MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEF-LLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETL-PFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYE-VMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXX-VTPAVLQLHERLEFCFRSMSDTIEDLNVFK-GRSSSS 4870
            E++P++W+ + + IS++ +  + ++   +      E+  +++   +   +  F+ Q  L+LE FS  KR +IL  Y    + MRI    EV   + ++  +K+  I      F          V+L+P  ++R  ++P F  ++     K     ++  ++I  ++++  EG GDE+Y                 L +   +   E     V  V +LM+  L+ R    +  +V   +     S + FYK E+N   ++I Y  KL  +     +  EA   L +  + + W+E  L PF      ++   +    K +L  KI++   + + +E    +C      Y + ++Y+ LSS  K  + +Y+ II + RL+  ++++ F G   P  +R+ +++V +   + ++   ++ + ++FP A    +  +P   + +     I I  + P+P   ++ +N  I  +I+ +++ +NIC F  D   +KG  DK+NE K + V R   ++ + +P I  W  +    +  ++P+E A + +  KN   R LI +Y      +LNP SM L G ++A VNGG+ +Y +AFF     +T   D+ +I   KD ++EQ+  +  A     +  V P +  LH +L   F+ M  ++   ++   GR S +
Sbjct:  541 EVFPRDWMVMRMVISSVIVTTMKQLSPALHQNFGNESFDIQIWTFYFSLAVLFINQPSLQLEAFSPLKRKQILTQYGSGMETMRILMAHEVFRMWQSLGDHKAHFIPGLLGPF--------LEVTLVPQTELRRVLIPIFHEMMDCEQRKNGSFKQVEAEIIDKLDSLLSEGRGDEDYRELFSLITPLFGPYPSLLERIEQETWRESGVSFVTSVTRLMERLLDYRD-CMKGDEVEDKKIGCAVSLLNFYKTEINKEEMYIRYIHKLCDMHLQAQNYTEAGFTLLLYCELLGWDERPLGPF-----LHYPAQSEWERKESLLLKILHFFHKGKCWEFGIPLCRELAGQYEALYDYQRLSSVRKTEAAYYDNIIEQQRLEPEFFKVGFYGKKFPFFLRN-KEFVCRGHDYERLETFQQRMLSEFPHAVPMQHAGQPDDATTHADAQYIQIFAVSPVPGVSEVLRNERIPERIKSFYRVNNICKFRYDRPLYKGTKDKENEFKNLWVERTTLILKQPLPGICRWFEVDKREVAEMSPLENAIEAVENKNTELRLLIGQYRTQPPHNLNPLSMCLNGVINAAVNGGIARYQEAFFDKEYLATHPEDVEKIGRLKDVMLEQQVYILGAGLSVHERFVHPEMRPLHRKLLEQFQMMRSSLASQDLMSMGRISPA 1194          

HSP 2 Score: 51.2174 bits (121), Expect = 3.159e-6
Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 2
Query: 1439 DYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            D+ S V YH+NSP+W +++K+ +       S+L  EF HC+TK+K   E+K F   F  L +
Sbjct:   17 DFHSFVLYHNNSPRWGEILKLAIPVDKFRGSHLRFEFRHCSTKEK--GEKKLFGFAFTPLMR 76          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008301.1 (pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-1 gene:ENSPMAG00000007508.1 transcript:ENSPMAT00000008301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 8.898e-35
Identity = 96/343 (27.99%), Postives = 175/343 (51.02%), Query Frame = 2
Query: 3830 KTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            K  L   II    + + +EEA  +C    + Y    F+Y++LS+ L++ ++FYE IIT  R K  Y+ + + G   P  +R+ + ++++   + +  + +  L   FP+AE +   + PP E    +P ++   I    + P+  D    KN++++ +I +++K + +  F+      KG  D DNE   + + R    TE  +P I  W  +I  +   ++P+E A + + K N+   +L++++  +    +NP SMLL G +D  V GG + Y KAFF++    E   D  +I   KD +  Q  +L   + +H   V+ A+   HER+E CFR + + +E
Sbjct:   63 KEMLYGDIIGYFDKGKMWEEAIGLCKELAQQYETEIFDYEQLSNILRRQAKFYENIITVMRPKPDYFAVGYFGQGFPSFLRN-KMFIYRGKEYERREDFEARLLAQFPNAE-KMKTTSPPGENVRSAPSQN---IQCFTVQPLQRDQPKFKNKSVNDQILNFYKVNEVQCFTYSRPVRKGDKDPDNEFANMWIERTTYSTEYRLPGILRWFEVIETSKVEISPLENAIETMNKTNEKILNLVNQHQNDGSLPINPLSMLLNGIVDPAVMGGFSNYEKAFFTEKYEREHPEDEEKINKLKDLIAWQIPMLGAGIKIHGDKVSEALRPFHERMEGCFRQLREKVE 400          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010350.1 (pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 gene:ENSPMAG00000009372.1 transcript:ENSPMAT00000010350.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.084e-28
Identity = 136/556 (24.46%), Postives = 246/556 (44.24%), Query Frame = 2
Query: 3263 FALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHE-----FLLFSFMMFYKE----EVNIHSLFILYSDKLSQL-LEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHY-ISTFNYKELSSTLKKMSEFYELIIT--ESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE--SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            F   M+  I  ++L+P  ++R   +P F  ++        +  +   ++I  +++    G GDE+Y              H FL + G           V +V +L++  L+ R I  + +K              + + FYKE    E+ I SL  LY  KL  L LE E    EAA  L +    + W+++      +   +         K +L   II    + + +EEA  +C    + Y +  F+Y++LS  L+K + FY+ II     R K  Y+ + + G   P  +R+ + +V +   + +  + +  +   FP+AE +   + PP +       +  +    + PI  +    K +N+   +  ++K++++  FS    F KG+ D DNE  T+ + R   +T   +P I  W          ++P+E A + +   N     ++ +++ N    +NP SM L G +D  V GGL  Y KAFF+D   +E   D  +++  KD +  Q  +L  A+ +H + +   +  LHER+E CF  +   +E
Sbjct:    7 FIPGMIGPILEMTLVPEMELRKATIPIFFDMMQCEYHYTREFKKFENELITKLDHEVEGGRGDEQYKVLFERILSDCCRRHKFLSRTG--------EAFVLLVSRLLERLLDYRSITSEENKENRENRENRMSCTVNLLNFYKEIEREEMYI-SLRYLY--KLCDLHLESENF-TEAAYSLLLHAKLLKWSDDLCVGHEMQRNSHHADTHRQLKESLYQDIIKYFDDGKMWEEAIVLCKELAEQYEMEIFDYEQLSQLLQKQALFYQKIINIKNPRPKRDYFSVGYYGYRFPTFLRN-KVFVHRGGEYERREDFEMRIMTMFPNAE-KMKTTSPPGDDIRNASGQQDVQCFTVQPILEEQPQFKGKNVPESLMSFYKNNHVHKFSYSRPFRKGEKDPDNEFATMWIERTIFVTAYKLPGILRWFETNRYLQVEISPLENAIEAMGIANDEILTMVLQHHNNPNLPINPLSMRLSGIVDPAVMGGLANYEKAFFNDKYEKEHPEDYEKLEKLKDLIAWQTPMLAAAVKIHGEKIPEDLRPLHERVEKCFHQLKAKVE 548          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010277.1 (pep scaffold:Pmarinus_7.0:GL478006:150137:181148:-1 gene:ENSPMAG00000009296.1 transcript:ENSPMAT00000010277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 5.516e-11
Identity = 66/250 (26.40%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  941 YLVVYVYRIGQL-LTDPNKLLICKFRRPVAFGSFSVKELQSNN---EKVKINLFNL----SETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSA-KNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK 1624
            YLV  + R G + L D NK      RRP       + ++   N   ++ K + F      +E DFL+            Q  N+ + V+++  + +  Q +  D  H ++             I +  D  N      +Y+ L   EFD+ + K+  KNVE  + V D +G+ LE  I         T+Y S V Y    PKW + +K+ +   D+  S+L   F H +++D K    K FA CF++L +
Sbjct:   94 YLVCQIVRNGCMDLKDNNKKCTIGLRRPFGVAVMDITDIVKGNIETDEDKQHFFPFHQVTAENDFLQNIINKAHFWQRKQHENQGLWVSMKMLNGDIKQ-VKKDFPHLIDRSTAIARKMGFPEIIMPGDVRND-----VYITLVQGEFDKGSSKTTQKNVEVTMVVCDDTGKILENVIWIGAGDQPITEYKSIVYYQVKQPKWFETVKVAVPIEDVYRSHLRFTFRHRSSQDSKDRSEKNFAMCFVKLMR 337          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Yeast
Match: DCK1 (Dock family protein (Dedicator Of CytoKinesis), homolog of human DOCK1; upstream component for regulation through the small GTPase Rho5p; may form a complex with Lmo1p that acts as a GEF for Rho5p; interacts with Ino4p; cytoplasmic protein that relocates to mitochondria under oxidative stress; implicated in mitophagy; not an essential protein; DOCK proteins act as guanine nucleotide exchange factors [Source:SGD;Acc:S000004414])

HSP 1 Score: 61.6178 bits (148), Expect = 1.296e-9
Identity = 67/288 (23.26%), Postives = 134/288 (46.53%), Query Frame = 2
Query: 3875 QEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDA-------EIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRN-------IHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQ--KDLN----PFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF 4675
            Q+ E+A  +  + IK Y    ++   L+    +++  Y  + +  RL  +Y++++F+G   P S+R+ + +VF+   +  ++++ + L   +  +       E++     PP+         I++A ++P    L ++ N N       I+ K+R Y ++ ++  FS+       K   D  V+      Y  M  T P +   + I+      L+P+E A   +  K Q    L +  N+ L+   D+N      S  + GT+ A VNGG+++Y KAF   S++++F
Sbjct: 1490 QKPEKALAVYKDLIKAYDEINYDLNGLAFVHDQIAGIYTRLQSIDRLVPTYFKVSFMGFGFPKSLRN-KSFVFEGLPFEHITSMHDRLLRSYHGSNIVHSQEEVDMLLMNPPMGK------YIHVASVEPC---LSISDNYNSSDKKSSINNKVRMYIENRDLRTFSNSRRLPGAKGVTDLWVEEYT---YHTMN-TFPTLMNRSEIVKVTKSKLSPLENAIRSLQVKIQELYGLENMCNKTLKDHGDVNDLFTELSTNITGTISAPVNGGISQY-KAFLEPSTSKQF 1762          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Nematostella
Match: EDO48794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIE1])

HSP 1 Score: 169.088 bits (427), Expect = 6.856e-42
Identity = 167/661 (25.26%), Postives = 301/661 (45.54%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETH----------MRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY----HMFLCKFGGQ--DIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQL-LEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYI-STFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICN-FSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQ--IKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSVP 4876
            +YPK+W+ + +  +   + V   I   I+  +   H           +L   F   S AF+TQ+ L+LE FS +K+ KILE Y DMR+ +  +  ++  +  S    F       +V     ++L+P   +R   +P F  +I +          +  +++  ++ +   G G+ +Y    H  L +   +   + E+    V ++ +LM+  L+ R +      + +    + + + FYKE +    +FI Y  KL  + L +E +  EAA  L +  D + W ++ +         +        K +L   +I+   + + +EEA  +C    K Y   TF+Y +LS  L K ++FY+ IIT+ R +  Y+R+ F G   P  +R  + ++++   + ++S+    +++ +P A++  Y ++P        + II  +    +P    L+   N H  + + F D N  N F     FHKG  DK+ E KT+ + R  + T+   P I  W  +I+ ++  ++PI  A + ++ KN+  R LI     +   ++NP +  LQGT+DA V GG + Y K F      +E    Q  +   K+ LVEQ  +L   + LH   +   +  LHE +E  F+      E        S SS P
Sbjct:  972 VYPKDWVVMTMVQNRQGLTV---ILNTIQYFSEALHDSFFRDGEFEYQLWNNFFHLSVAFITQESLQLEDFSQAKQDKILEKYSDMRMIIGLKINDMWHSLGSHKIKFIPG----LVGPFLEMTLIPQTDLRKATIPIFYDMIEVEHRTTGGFVTVETEMMSKLDVLVEGGKGNADYKELFHQILFELFNRHPQLKEEGLRFVQLLTQLMERLLDYRTVVQGDENIDNRMSCIVNVLNFYKE-IRREEMFIRYVYKLCDMHLAIENYT-EAAFTLLLHADLLEWCDQPV---FTGQGKYQAATQRQLKESLYTDMIDYFDKGKCWEEAISMCKQLSKQYEEQTFDYIKLSHILNKQAKFYDNIITQVRGEPEYFRVAFYGKGFPTFLRD-KVFIYRGKEYERLSDFCVRIQSQYPSAKMLNYLTRP-------EEDIINSSGQRILP---QLDFVFNNHGSVNNLFYDVNSINKFQYSRVFHKGIRDKECEFKTMWLERTILYTKYKFPGILCWFEVISSDLEEVSPIRNALETMMSKNKELRSLIGMLKADPNLNVNPLTQNLQGTVDAAVMGGTSNYEKLFLIPEYLKENPDHQQYVDQLKELLVEQVDVLEEGIRLHGTRIKDNIRPLHEIIETGFKQKKAHFEQFRKKAKPSVSSAP 1609          

HSP 2 Score: 96.2857 bits (238), Expect = 1.012e-19
Identity = 143/632 (22.63%), Postives = 263/632 (41.61%), Query Frame = 2
Query:   95 VTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNA-----RMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNY--------FQIKALLADFDEAHNLE---AFS-TQPKTSQLNDLVITMNNFE--FLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDI------RKEGYLVVYVYRIGQL-LTDP-NKLLICKFRRPVAFGSFSVKELQSNNEKVK------INLFNLSETDFLKPTSELIKTKLPSQLGN-----RFVQVTLETSHPNETQYLD----LDNDHT-------LESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILS-NPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKK----CFESGKIENSFMIRTKKNFVIPKNLNHSTSI-----ICNDPDKNLSKELC------NLTLVLCSTELS 1795
            V + F     H L L LG+TV +  +N GWY G+SL      NS GIFP SYVK+         +  K+      VL        M + L   G++W +   R          ++ +  + ++++    I+  +   ++L ++   +   I+  N ++ +D  +  +  ++L      V  L +     +         ++   ++  DE+  L+   AFS T      + ++V  +N+    F+ + D    E++        QF   W      + G PK  D+ +    +  D+      R   +LV  + R+G++ L +P +K L    RR       ++ +L S   + +      + L  + E  F+    + IK  + SQL +     + + V+++    NE Q  +    L N HT          + +  D  N      LYV +   EF+R +K + KN+E  + V   +G  LE ++S     +  ++Y S + YHS  P+W++ IK+ +      ES+L   F H ++ ++K   +K FA  F++L +      + G  E   + +     V+P     S S      + N P K  +          N+  +LCST+L+
Sbjct:   12 VIYNFNEKGAHKLKLQLGETVQVLEENGGWYRGFSLRN---KNSRGIFPISYVKL---------RQQKNGQVRYGVLQEISLVEEMTSVLREWGNMWQNLYLRREDHLF----LLVKKQMAELMDWRRQILSETLPGDQLKQLKQKVTSTIDYGNRIIGLDLVVRNDDGNILDPDSTGVIELYRRVSVGHKPYCRTTIIELYRRVSSRDESKKLKREAAFSSTHNIYVNIKNVVCNINDDAEVFISLYDARDGEFI------SEQFVVNW-----DKAGMPKEIDKLYNLTVLFTDLGTKDLKRDRVFLVCQIIRVGRMDLKEPASKKLTKNLRRCFGGAVLNLSDLMSGKVQYEDDKEHFLQLHVVPENQFM---HDWIKKMIASQLADSKGTGQGIWVSVKVLEGNEEQIREENPLLMNKHTAIARKQGFPEVIMPGDVRND-----LYVTVLSGEFERGHKTANKNIEVTMHVLSDNGDILENVISYGAGEDLVSEYRSVIYYHSGKPEWHETIKLAVPIEQFYESHLRFTFKHRSSGEEKDKSQKVFAFAFVRLMQRDGTTLKDGTHE-LMVFKCNSTKVLPSTYLQSASFKIEQTLMNPPTKGGADAAAYCNDKFNIKTLLCSTKLT 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Nematostella
Match: EDO35873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKA6])

HSP 1 Score: 117.857 bits (294), Expect = 8.094e-29
Identity = 65/231 (28.14%), Postives = 123/231 (53.25%), Query Frame = 2
Query: 3974 SEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPP---IESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFS 4654
            ++FY+ I+++ R +  Y+R+   G   P S+R+ + +V++   + K+ +    ++  FPDA++    + P    +ESP ++   +   ++ P+    D    R++  +I  Y+K +++  F+ D  FHKG  DK NE  ++ + R  + +   +P I  W P+I+     ++PI  A + +  KN + R LI  +  +    +NP SM+L G +DA V GG +KY   FF+
Sbjct:   44 AKFYDNIMSKLRPEPEYFRVGLFGKGFPTSIRN-KSFVYRGLEYEKMGDFNRRMQAQFPDAQMMDKLTDPEADILESPGQY---MQTCRLLPLSDHEDRFMGRDVDERITSYYKVNHVQRFTFDRPFHKGVKDKSNEFASLWLERTSITIASPLPGILKWFPVISTTKEEISPIRNAVETVQNKNADLRSLIARHTADPSLSINPLSMILNGVIDAAVMGGTDKYTNIFFA 270          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Nematostella
Match: EDO31872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWP8])

HSP 1 Score: 87.4261 bits (215), Expect = 2.735e-17
Identity = 68/246 (27.64%), Postives = 113/246 (45.93%), Query Frame = 2
Query:  941 YLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVK-INLFN----LSETDFLKPTSELIK-----TKLPSQLGNRFVQVTLETSHPNETQY---------LDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQL 1618
            YLV ++ R+G++L +  K+    +RRP       + +L    E+++   LF      SET+FL     +IK       LP      +V + L      + Q          + +        I +  D  N      +YV +   EF+++ K +AKNVE  +SV  ++G+ +E CI         T+Y S + YH++SPKWN+ +K+ + S     S L   F H +  ++K  E K FA  F++L
Sbjct:  229 YLVAHLIRVGKMLPESKKVSSVSYRRPYGCAVLDIVDLLQGKEEIENSELFMPIQFTSETEFLTIHESIIKKLQSKNGLPESSTGIYVSMRLLHGELEKIQQENPLLFPEGIAVARKLGFPEIIMPGDVRND-----VYVTIEKGEFEKSGKTTAKNVEVSMSVIGANGRLIEDCIYLGAGGKPCTEYESFIYYHNSSPKWNETVKVRIPSDKFVGSLLRFGFRHVSKFEEKHKELKTFAFSFVKL 469          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Nematostella
Match: EDO28006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7P3])

HSP 1 Score: 56.9954 bits (136), Expect = 1.515e-9
Identity = 27/69 (39.13%), Postives = 44/69 (63.77%), Query Frame = 2
Query: 1295 LYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIK 1498
            +YV +   EF+++ K +AKNVE  +SV  ++G+ +E CI         T+Y S + YH++SPKWN+ +K
Sbjct:    6 VYVTIEKGEFEKSGKTTAKNVEVSMSVIGANGRLIEDCIYLGAGGKPCTEYESFIYYHNSSPKWNETVK 74          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Match: dock4b (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:101157988])

HSP 1 Score: 197.978 bits (502), Expect = 3.676e-50
Identity = 150/578 (25.95%), Postives = 277/578 (47.92%), Query Frame = 2
Query: 2957 EIYPKNWLSIYLKISNISMKVLYKIGENIE--MLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYH-----MFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENR---KIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEH-KMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEV-MTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFS 4654
            E++PK+W  + L  +N+ +  +  + + +    L  +   ++  ++   S  F+ Q CL+LE FS SK+ KILE Y DMR+ +     ++  N      NF  A    M+     V+L+P P +R  ++P F  ++     +  +  ++  ++I  ++++  EG GDE Y      + L K   +   E    ++  V +LM+  L+ R   K+     K +       S + FYK E+N   ++I Y  KL  L     +  EA+  L +  + + W++  L      F N+   +    K  L   II      + +E    +C      Y S ++Y+ LS      +  Y+ I+ + RL+  ++R+ F G   P  +R+ +++V +   + ++   ++ + N+FP A I       P ++ Y+     + I  + PIP   D+ +   +   I+ ++K ++I  F  D  FHKG  DK+NE K++ V R  + + +++P I  W  +    +  ++P+E A ++I  KN   R LI +      +++NP +M L G +DA VNGGL +Y +AFF+
Sbjct:  964 EMFPKDWTVMRLVTNNVIITTVLYLSDALRKNFLNDKFDYKVWDSYFYLSVIFINQPCLQLESFSPSKKKKILEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPA----MIGPFLEVTLVPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIG---CTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSDRPL----REFLNYPMQSEWQRKEYLHITIIQNFDRGKCWENGIILCRELADQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRN-KEFVCRGHDYERLEAFQQRMLNEFPHA-IAMQHVNQPDQTIYQADAQYLQIYAVTPIPESQDVLQRDGVPDNIKSFYKFNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLVQSLPGISRWFEVEKRELVEVSPLENAIEVIENKNLQLRTLITQCQNRQMQNINPLTMCLNGVIDAAVNGGLARYQEAFFA 1528          

HSP 2 Score: 127.102 bits (318), Expect = 1.442e-28
Identity = 149/647 (23.03%), Postives = 286/647 (44.20%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFP-------NSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQF-EHFWLPILEARKGKPKWKDEKFVFKEIPL---DIRKEGYLVVYVYRIGQLLTDPNK-LLICKFRRPVAFGSFSVKELQSNNEK----VKINLFNLSETDFLKPTSELIK---TKLPSQLGNRFVQVTLETSHPN------ETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQ--KLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI--------------ENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEV 1879
            W    E  +  +   F+  +QHGL L++GDTV I  +  GWY G+ L      N  GIFP       N++VK  G+ E V+  +        + +   M +TL   G++W    K+L  ++  +      + +N+I++L   ++      +++  +  H+   ++  N  L +D  + +   S++   +L V  L ++  + + + +                  P  +  + L + + +     + +EL + + I D  +     E F++ + ++   K   K E+     + L   D+RK+ Y+VV++ RIG++     K L   ++RRP+     S+ +L + + K    +K+   N +E+++ +    +IK   ++      N  + V L+  H +      E   L          +  S+     + ++ LY+ L   EF++  K  A+NVE  + V DS GQ  K+    +        +Y S V YH+NSP+W + IK+ +       S++  EF HC+TKDK   E+K F   F+ L +  E G+               EN+ +    +   +P +     ++  N+     +KE   +T  LCST+L+    + +L+  ++   +IL+    LKE+
Sbjct:    2 WPNSHEWYLSPLLASFRGTIQHGLPLEIGDTVQILEKCEGWYRGFILKN---PNIKGIFPSCFIHLKNAHVKNKGQFETVIPVE--------DSVITEMTSTLREWGAMW----KQLYVKNEGDLFHRLWHVMNEILDLRRQVLVGHLTHDRMRDVKQHITARLDWGNEQLGLDL-VPRQEFSMVDPDELSVTELYRMMENRHRKKET-----------------PAPASTHHLFVHVKSLMSANLGEELEVFFHIYDGREGRPLSERFFVRLNKSGLPKSPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCSVQYRRPLGCAVVSIADLLTADSKDDHLLKVYTCN-TESEWYQIHENIIKKANSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITRKLGFSDIIMPGEMRNDLYITLERGEFEKGGKSVARNVEITVYVLDSDGQILKVNHAAAGSGEPGGDEYHSLVLYHNNSPRWAEQIKLPIPVDMFRGSHVRFEFRHCSTKDK--GEKKLFGYSFVPLMQ--EDGRTLPDGTHELIIHKCEENTNLADCSRYLKLPCS---KANLPSNNQTLKSTKESFWITSFLCSTKLTQNGEMLDLLKWRAHPERILDSLSKLKEI 607          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Match: ENSORLT00000046371.1 (dedicator of cytokinesis protein 3 [Source:NCBI gene;Acc:101165978])

HSP 1 Score: 170.629 bits (431), Expect = 6.917e-42
Identity = 153/658 (23.25%), Postives = 303/658 (46.05%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRI----EVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPED---------VSEIVNVVCKLMDLH-------LENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRH----CRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYE-VMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLN 4843
            I+P++W  + L  S+I +     +   +    TE     ++  +F   +  ++ Q  L+LE    +KR K L+ Y DMR+    E+   +  +  NK   I          M+     V+L+P P+IR  ++P F  ++     K  +  ++  +++  ++++  +G GD+ +         + I ++         V+ +  +V +++D         +E++KI    +            M FYK EVN   ++I Y  KL  L        EAA  L + ++ + W +  L      F ++   +    K NL  KI++   + + +E    +C      Y + ++Y+ LS   K  + +Y+ II + R++  ++++ F G   P  +R+    CR Y ++     ++ + ++ +  +FP A    + ++P           + I  + P+    D+ +   +  +I+ +++ +N+  F  D  FHK   D++NE +++ + R   +++  +P I  WA +    +  ++P+E A  ++  K Q  R LI +Y +     ++N  SM L G +DA VNGG+ +Y +AFF     ++   DI +I   KD + EQ  +L   LA+H+KLV P +  LH++L   F  M   +  ++
Sbjct:  999 IFPRDWSIMRLLTSHIIVVTTQFLSPALHKNFTEADFDFKVWNSFFSLAVLYINQPSLQLEALGPAKRKKTLDKYSDMRVIMAYELCSMWQKLGENKPHFIPG--------MMGPFLGVTLVPQPEIRNIMIPIFHDMMDWEQRKNGNFKQVEAELMDKLDSMVSDGKGDDNHRELFSLLLLEKIEQETWRETGISFVTSVTRLVERILDYRDCMKGDEVESKKIGGSVN-----------LMNFYKSEVNKEDMYIRYIHKLCDLHLQAEDFTEAAFTLLLYWELLQWEDRPL----RDFLHYPCQSEWQRKENLSRKILHYFNKGKCWEYGISLCRELAFQYETLYDYQSLSWIRKMEAAYYDNIIEQQRIEPEFFKMGFYGKKFPFFLRNKEFVCRGYDYE-----RLEDFQQRMLGEFPQAIAMQHTNQPDDTILQSDAQYLQIYTVTPVSDISDVPQLERVPERIKSFYRINNVSRFHYDRPFHKVPKDRENEFRSLWIERTTLILSRPLPGISRWAEVERREVVEVSPLENAIYVVENKTQELRTLISQYQHRQHHGNINSLSMCLNGVIDAAVNGGIARYQEAFFDKDYINSHPEDIERITHLKDLMQEQVHILGVGLAVHEKLVHPEMRPLHKKLVDQFHMMRTGLHHVS 1628          

HSP 2 Score: 94.7449 bits (234), Expect = 8.397e-19
Identity = 95/385 (24.68%), Postives = 172/385 (44.68%), Query Frame = 2
Query:  923 DIRKEGYLVVYVYRIGQLLTDPNK--LLICKFRRPVAFG------------------SFSVKELQSNNE----KVKINLFNLSETDFLKPTS--------ELIKTKLPS------QLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESG-----KIENSFMIRTKKN---------FVIP---KNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILK 1909
            D++++ Y+V +V R G++L + +K  L   ++RRP                       F +K    NNE    ++  N+   S T +  P++        +L++ +L         + NR + +T +   P+     D+ ND                    LY+ L   EF+R  K   KN+E  L V  + G  L +CI       N ++Y S V YH+NSP+W++++K+ +       S+L  EF HC+TKDK   E+K F   F  L +  E G     +I   ++ +  +N           +P   ++ N   ++  N P +   KE   ++ +LCST+L+   ++  L+  K+   +IL++   L  ++ I+ ++I+K
Sbjct:  289 DLKRDLYIVAHVVRTGRMLLNDSKKGLPHVQYRRPYGCAVLAMSDVFHTITDLKEEKDFVLKIYTCNNENEWYQIHENIIRKSNTKYSAPSTNYGLIISLQLLRGELEQIRRENQAVFNRALALTRKLGFPDVILPGDIRND--------------------LYLTLERGEFERGGKSVQKNIEVTLYVLYADGDTLKDCISLGSGELNSSEYRSFVLYHNNSPRWSEMVKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFTPLMR--EDGTTLSDEIHELYVYKCDENTTFSNQGLYLSLPCCKEDFNSCPTLPANLPFQRSPKETFWVSTILCSTKLTQNVDLLALLNWKAHPDRILDI---LGRLRQISGEEIVK 646          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Match: dock1 (dedicator of cytokinesis 1 [Source:NCBI gene;Acc:101155391])

HSP 1 Score: 169.859 bits (429), Expect = 1.123e-41
Identity = 151/654 (23.09%), Postives = 296/654 (45.26%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVL--YKIGENIEMLT-TETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMR----IEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEY--------------HMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE----SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTE-TMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEF--DIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            +YP +W+ + +  + + ++ +  Y    N + L  T   ++L   +   + AF+TQ+ L+LE FS  KR KI + Y DMR     E+ + + N+  +K          F  EMV  I  ++L+P  ++R   +P F  ++               ++I  +++    G+GDE+Y              H +L + G   +   V  +  ++     +H EN++     +          + + FYKE ++   ++I Y  KL  L     +  EAA  L +    + W++E         + +        K  L  +IIN   + + +EEA  +     + Y +  F++++LS++L+K ++FYE I+   R +  Y+ + + G   P  +R+ + ++++   + +  + +  L   FP+AE +   + PP E    S  ++     +  +  +P      +N+ +  +I  ++  + +  F       KG+ + DNE   + + R    T   +P I  W  + + +   ++P+E A + +   N+    ++  +  +    +NP SMLL G +D  V GG   Y KAFF+D   +E   D+ +I+  KD +  Q   L   + +H + VT A+   H+RLE CF+ + + +E
Sbjct:  975 VYPSDWIIMNMMQNKVFLRAISQYAAVLNKKFLDLTNFELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFQKYQDMRRQIGFEIRDMWYNLGPHKIK--------FIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFTCSFQRFENEIITKLDHEVEGGHGDEQYKLLFQKILLEHCRKHKYLARMGELFVNLVVRLLERLLDYRTIMHDENKENRMSCT---------VNVLNFYKE-IDREEMYIRYLYKLCDLHRECDNYTEAAYTLLLHAKLLKWSDEPCAAHLTQRDGYQAATQGQLKDQLYQEIINYFDKGKMWEEAIILSKELAEQYENEMFDFEQLSASLRKQAQFYENIVKVIRPRPDYFAVGYYGMGFPSFLRN-KMFIYRGKEYERREDFEARLLTQFPNAE-KMKTTTPPSEDLKNSSLQYIQCFTVKTILELPAKF---QNKPVSEQIVSFYTVNEVHKFQYSRPVRKGENNPDNEFANMWIERTTYTTAYKLPGILRWFEVKSVSTEEISPLENAMETMQLTNEKISSMVQRHLSDPNLPINPLSMLLNGIVDPAVMGGFANYEKAFFNDKYVQEHPEDLEKIEKLKDLIAWQIPHLAEGVRIHGEKVTEALRPFHDRLEACFKQLREKVE 1605          

HSP 2 Score: 75.485 bits (184), Expect = 5.982e-13
Identity = 166/764 (21.73%), Postives = 314/764 (41.10%), Query Frame = 2
Query:  131 LMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNN-------KEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIK-ALLADFDEAHNLE-----AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEIPL-DIRKEGY-LVVYVYRIGQL-LTDPN-KLLICKFRRPVAFGSFSVKEL----QSNNEKVKINLFN--LSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLE------------SIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKC----------------FESGKIENS---FMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINEL-ILKKSENFQIL--NLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFI---ELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNEL 2224
            L L +GDTV I      WY G+ L +    +  GIFP  Y+ +  K+  V     +        L   + TTL    +IW  +L   +K  +           N + ++ +D++++ +        +++L ++   +   I+  N  L++D  +     ++L        SL + +     QI+  +  +  +  N++      F++ P  +    L +T+ N    +G   E++M   + DP +       +L +  +  G  K  D+    + VF ++   D+++E    V  + R+G++ L D N K L    RRP       V ++      + +K     F     E DFL+     + T        + + VTL+   P +   +  D  H ++             I +  D  N      +Y+ L   +FD+ +K + KNVE  +SV D  G+KLE  I      +  ++Y S + Y    P+W + IK+ +   D+  S+L   F H +++D K    K FA  F++L +                  E+ K+E+S     +   K  +  K  + +     N     ++K+   ++ ++CST+L+   N++ L +LK   N  +L  NL Q +K    +   +++K  L+  +  +      +S  +  D L  +  +  + L         N  L  Y+R  +        L   +KN  +NA KL    E L  +M ++E +F  + ++  L
Sbjct:   26 LSLQIGDTVHILETYEEWYRGHLLRR---KSKKGIFPACYIHL--KDATVEGSGSETVIPTELPLVQEVTTTLREWATIW-RDLYVGDKREM----------FNCVRDMIYDLIEWRSQILSGTLPQDELTELKQKVTSKIDYGNKYLDLDLVVRDKDGNILDPELTSAISLFRAHEAASKQIEDRIQEEKSQRQNIDLTRQAKFASTPSFA----LFVTLKNVVCKIGEDAEVLMS--LYDPMESKFISENYL-VKWSSAGLAKDIDQLHNLRAVFTDLGSEDLKRERISFVCQIVRVGRMELRDNNTKKLTSGLRRPFGVAVMDVTDIITGKMDDEDKQHFIPFQPVAGENDFLQTVINKVITAKEVNHKGQGLWVTLKLL-PGDIHQIRKDFPHLVDRSTAVARKMGFPEIIMPGDVRND-----IYITLVQGDFDKGSKTTPKNVEVTMSVYDEEGKKLENVIFPGAGESVISEYKSIIYYQVKQPRWFETIKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFAFSFVKLMRFDGTTLRDGEHDLIVYKAEAKKLEDSNHYLTLPATKVEMEEKGYSTTGKSTQNQGACIITKDSLQISTLVCSTKLT--QNVDLLGLLKWRSNTSLLEKNLRQLMK----VEGGEVVK-FLQDTLDALFNIMMENSDSEAFDTLVFDALVFIIGLIADRKFQHFNPVLETYIRKHFSATLAYTKLTKVLKNYVENAEKLT---EQLLGAMKALEYIFKFIVRSRVL 750          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Match: ENSORLT00000012503.2 (dedicator of cytokinesis protein 3 [Source:NCBI gene;Acc:101165978])

HSP 1 Score: 167.548 bits (423), Expect = 6.089e-41
Identity = 157/668 (23.50%), Postives = 305/668 (45.66%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHM--RLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRI----EVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGD----EEYHMFLCKFGG-----QDIPED---------VSEIVNVVCKLMDLH-------LENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRH----CRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYE-VMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEY-NENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDS--STEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNV 4846
            I+P++W  + L  S+I +     +   +    TE     ++  +F   +  ++ Q  L+LE    +KR K L+ Y DMR+    E+   +  +  NK   I          M+     V+L+P P+IR  ++P F  ++     K  +  ++  +++  ++++  +G GD    E + +    FG      + I ++         V+ +  +V +++D         +E++KI    +            M FYK EVN   ++I Y  KL  L        EAA  L + ++ + W +  L      F ++   +    K NL  KI++   + + +E    +C      Y + ++Y+ LS   K  + +Y+ II + R++  ++++ F G   P  +R+    CR Y ++     ++ + ++ +  +FP A    + ++P           + I  + P+    D+ +   +  +I+ +++ +N+  F  D  FHK   D++NE +++ + R   +++  +P I  WA +    +  ++P+E A  ++  K Q  R LI +Y +     ++N  SM L G +DA VNGG+ +Y +AFF     ++   DI +I   KD + EQ  +L   LA+H+KLV P +  LH++L   F  M   +    V
Sbjct:  992 IFPRDWSIMRLLTSHIIVVTTQFLSPALHKNFTEADFDFKVWNSFFSLAVLYINQPSLQLEALGPAKRKKTLDKYSDMRVIMAYELCSMWQKLGENKPHFIPG--------MMGPFLGVTLVPQPEIRNIMIPIFHDMMDWEQRKNGNFKQVEAELMDKLDSMVSDGKGDDNHRELFSLLTQLFGPYPSLLEKIEQETWRETGISFVTSVTRLVERILDYRDCMKGDEVESKKIGGSVN-----------LMNFYKSEVNKEDMYIRYIHKLCDLHLQAEDFTEAAFTLLLYWELLQWEDRPL----RDFLHYPCQSEWQRKENLSRKILHYFNKGKCWEYGISLCRELAFQYETLYDYQSLSWIRKMEAAYYDNIIEQQRIEPEFFKMGFYGKKFPFFLRNKEFVCRGYDYE-----RLEDFQQRMLGEFPQAIAMQHTNQPDDTILQSDAQYLQIYTVTPVSDISDVPQLERVPERIKSFYRINNVSRFHYDRPFHKVPKDRENEFRSLWIERTTLILSRPLPGISRWAEVERREVVEVSPLENAIYVVENKTQELRTLISQYQHRQHHGNINSLSMCLNGVIDAAVNGGIARYQEAFFDKDYINSHPEDIERITHLKDLMQEQVHILGVGLAVHEKLVHPEMRPLHKKLVDQFHMMRTGLHHQGV 1631          

HSP 2 Score: 131.339 bits (329), Expect = 6.868e-30
Identity = 160/678 (23.60%), Postives = 302/678 (44.54%), Query Frame = 2
Query:   62 WTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLE-VLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEK----FVFKEIPL-DIRKEGYLVVYVYRIGQLLTDPNK--LLICKFRRPVAFG------------------SFSVKELQSNNE----KVKINLFNLSETDFLKPTS--------ELIKTKLPS------QLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKL-ECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESG-----KIENSFMIRTKKN---------FVIP---KNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILK 1909
            W   EE  IG V   F+++V   L+L++G+TV I  +  GWY GYS  K    +  GIFP SYV +  K   V  +   +    LE  +     +TL   G +W  +L   +K  L  +     + +N++++L   +++   ++E+  +I  H+ + ++  N  L +D    K    ++    + V+ L KL+V +    +      D +        +   S  + L I + +F +  ++++  + + + D  +  Q    ++  L  + G PK  ++      +F ++   D++++ Y+V +V R G++L + +K  L   ++RRP                       F +K    NNE    ++  N+   S T +  P++        +L++ +L         + NR + +T +   P+     D+ ND                    LY+ L   EF+R  K   KN+E  L V  + G  L +CI       N ++Y S V YH+NSP+W++++K+ +       S+L  EF HC+TKDK   E+K F   F  L +  E G     +I   ++ +  +N           +P   ++ N   ++  N P +   KE   ++ +LCST+L+   ++  L+  K+   +IL++   L  ++ I+ ++I+K
Sbjct:    2 WIPTEEEKIGVVICNFRSSVCQALILEIGETVQILEKCDGWYRGYSTKK---PSIKGIFPISYVHL--KKSTVTNRGLCETVVPLEDPIITETTSTLQEWGILW-KQLYVKHKVDLFHKL---RHVMNELIDLRRQLIQGHLSQEQTREIKRHITVRLDWGNEHLGLDLVPRKE-FEMVDPDQISVSELYKLHVSSRHCGQQSTNQSDSSKQRHGDGCRVPVS--HHLFINLKSFTYNSISEDADVFFFLYDTREAKQISEKFMVRLN-KNGGPKNPEKADRLCALFTDLSSKDLKRDLYIVAHVVRTGRMLLNDSKKGLPHVQYRRPYGCAVLAMSDVFHTITDLKEEKDFVLKIYTCNNENEWYQIHENIIRKSNTKYSAPSTNYGLIISLQLLRGELEQIRRENQAVFNRALALTRKLGFPDVILPGDIRND--------------------LYLTLERGEFERGGKSVQKNIEVTLYVLYADGDTLKDCISLGSGELNSSEYRSFVLYHNNSPRWSEMVKLPIPIDRFRGSHLRFEFRHCSTKDK--GEKKLFGFAFTPLMR--EDGTTLSDEIHELYVYKCDENTTFSNQGLYLSLPCCKEDFNSCPTLPANLPFQRSPKETFWVSTILCSTKLTQNVDLLALLNWKAHPDRILDI---LGRLRQISGEEIVK 639          
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Match: DOCK2 (dedicator of cytokinesis 2 [Source:NCBI gene;Acc:101168874])

HSP 1 Score: 148.288 bits (373), Expect = 4.479e-35
Identity = 160/641 (24.96%), Postives = 292/641 (45.55%), Query Frame = 2
Query: 2960 IYPKNWLSIYLKISNISMKVL--YKIGENIEMLTTET-HMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDK-AFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFL------CKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQL-LEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYIS-TFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIE---SPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMT-ETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIE 4834
            +YP +W+++ +  + + ++ +  Y +  N + L  +   ++L   +   + AF+TQ+ L+L+ FS +KR KIL  Y DMR     R +   +          K  F   MV  I  ++L+P  ++R   +P F  +I     +  +  +   ++I  +++    G GDE+Y   L      C      +   V   V++V  L+   L+ R +    S+  +      + + FYK+ +N   ++I Y  KL  L LE E +  EAA  L +    + W+++       F  + T       K  L + II+   + + +EEA  +C    + Y +  F+Y+ LS  L+K ++FYE I+   R K  Y+ + F G   P  +R+ + ++ +   + +  + +  L + FP A      + P  E   SP ++     +  +  IP  L   KN+ +  +I +++K + +  F       KG VD DNE  ++ + R    T   +P I  W         TL+P+E A + +   N+   ++I++Y  +    +NP SMLL G +D  V GGL+    ++F          +Q+  ++   +   G     +ALH K VT  +   HER+E CF+ +   +E
Sbjct:  955 VYPSDWMAMIMVQNRVFLRAINTYAVTMNQKFLNNDDFEVQLWNNYFHLAVAFITQESLQLQHFSPTKRNKILVKYGDMR-----RLIGFAIRDIWYKLGSHKICFIPGMVGPILEMTLIPDEELRRATIPIFFDMITCEHTQFGNFQKFENEIILKLDHEVEGGGGDEQYMQLLETILLDCSAERPMLKPQVQHFVSLVKGLLVRLLDYRTVMGDDSRN-NRMSCTVNLLNFYKD-INREGMYIRYLYKLRDLHLEGENYT-EAAYTLLLHSRLLKWSDDMCSPQFEFHGSQTQRQL---KETLYDTIIDYFDKGKMWEEAITLCKELAEQYENEIFDYELLSKRLEKQAKFYENIMKILRPKPDYFAVGFYGQGYPPFLRN-KVFIHRGKEYERREDFQNHLMSQFPSAVRLNTTTMPGDEYKNSPLQYIQCFTVQPVLEIPPRL---KNKPVPDQIINFYKSNYVQRFHYSRPVRKGPVDPDNEFASMWIERTTFTTVYKLPGILRWFET------TLSPLENAIETMESTNEKILNMINQYQADWSLPINPLSMLLNGIVDPAVMGGLS---VSYF----------LQLIPWQCIPLLGGG-----IALHGKRVTDDLRPFHERMEECFKQLKKKVE 1556          

HSP 2 Score: 55.4546 bits (132), Expect = 7.017e-7
Identity = 82/343 (23.91%), Postives = 146/343 (42.57%), Query Frame = 2
Query:  701 AFSTQPKTSQLNDLVITMNNFEF-LGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDE----KFVFKEIP-LDIRKEG-YLVVYVYRIGQLLTDP--NKLLICKFRRPVAFGSFSVKE-----LQSNNEK-VKINLFNL-SETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQ----YLDLDNDHTLES-------IYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLE-CILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKI 1645
              S + ++S  + L + + NF   +G   EL M   + DP +       +L +    KG PK  D     K VF ++   D+ +E  YL+  + R+G++      NK      RRP       + +     L+ + EK   I  F + +E DFL      + T      G + + VT++    +  Q    Y  L +  T+ +       I +  D  N      +Y+ ++  +FD+ NK + KNVE  + V D  G+ ++  I         ++Y S + Y    P+W +  K+ +   ++   +L   F H ++++ K    K FA  F++L K  E G +
Sbjct:  179 GISARIQSSPTHSLYVFVRNFVCRIGEDSELFMS--LYDPIKQKIISENYL-VRWGSKGFPKEIDMLNNLKVVFTDLGNKDLNREKIYLICQIVRVGRMDLKEINNKKCTLGLRRPFGVAVMDITDIIKGKLECDEEKQFFIPFFPVVAENDFLHSLLNKV-TASRGDSGGQGLWVTMKPLVGDIVQIRKEYPHLVDRSTVVARKLGFPEIIMPGDVRND-----IYLTIQSGDFDKYNKTTQKNVEVIMWVCDEEGKVIQNSICLGAGDKPVSEYRSVIYYQIKQPRWMETFKVAVPLEEMHRIHLRFMFRHRSSQESKDKSEKNFAMAFVRLMK--EDGTV 510          
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Match: SMESG000063595.1 (SMESG000063595.1)

HSP 1 Score: 1935.23 bits (5012), Expect = 0.000e+0
Identity = 951/952 (99.89%), Postives = 951/952 (99.89%), Query Frame = 2
Query:   56 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVS 2911
            MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFT DNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVS
Sbjct:    1 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTSDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISVS 952          
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Match: SMESG000063595.1 (SMESG000063595.1)

HSP 1 Score: 1927.52 bits (4992), Expect = 0.000e+0
Identity = 950/951 (99.89%), Postives = 950/951 (99.89%), Query Frame = 2
Query:   56 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISV 2908
            MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFT DNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISV
Sbjct:    1 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTSDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDISV 951          
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Match: SMESG000063595.1 (SMESG000063595.1)

HSP 1 Score: 1921.75 bits (4977), Expect = 0.000e+0
Identity = 950/954 (99.58%), Postives = 950/954 (99.58%), Query Frame = 2
Query:   56 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKT---DEFIPEFEKLYTLLFCYLEEWYKIRNVDISV 2908
            MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFT DNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKT   DEFIPEFEKLYTLLFCYLEEWYKIRNVDISV
Sbjct:    1 MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLMKFTSDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSVHGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLKIYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQIKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWMIVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVYVYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSETDFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIYLSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLECILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFHCTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNHSTSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILNLWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFITCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISCEILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTSDPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILPKEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAETLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRFISRRDSEDLLTNGTSLVCKTVHNDEFIPEFEKLYTLLFCYLEEWYKIRNVDISV 954          
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Match: SMESG000063593.1 (SMESG000063593.1)

HSP 1 Score: 1621.68 bits (4198), Expect = 0.000e+0
Identity = 857/873 (98.17%), Postives = 864/873 (98.97%), Query Frame = 2
Query: 2861 CYLEEWYKIRNVDISVSDLHXXXXXXXXXXETEIYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSXXXXXXXXXXXXXXXKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPXXXXXXXXXXXXXMRSISRKEQSREVPDGKRRHEMEKAKAIDID 5479
            C ++E++ +      +SDLHVVLNNLKKLLETEIYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFI YSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDTIFFENFTGTNTETDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGLLTTALALHKKLVTPAVLQLHERLEFCF+SMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSADEEQLQRLAEEQALKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPKKEKKNNIFKRKFMRSISRKEQSREVPDGKRRHEMEKAKAIDID
Sbjct:  183 CAMDEYHNLLRCLCILSDLHVVLNNLKKLLETEIYPKNWLSIYLKISNISMKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFIYYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDTIFFENFTGTNTETDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGLLTTALALHKKLVTPAVLQLHERLEFCFKSMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSADEEQLQRLAEEQALKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPKKEKKNNIFKRKFMRSISRKEQSREVPDGKRRHEMEKAKAIDID 1055          
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Match: SMESG000063593.1 (SMESG000063593.1)

HSP 1 Score: 1568.52 bits (4060), Expect = 0.000e+0
Identity = 821/823 (99.76%), Postives = 822/823 (99.88%), Query Frame = 2
Query: 3011 MKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDXXXXXXXXXXXXXXDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGXXXXXXXXXXXXVTPAVLQLHERLEFCFRSMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSXXXXXXXXXXXXXXXKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPXXXXXXXXXXXXXMRSISRKEQSREVPDGKRRHEMEKAKAIDID 5479
            MKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFI YSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDTIFFENFTGTNTETDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGLLTTALALHKKLVTPAVLQLHERLEFCF+SMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSADEEQLQRLAEEQALKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPKKEKKNNIFKRKFMRSISRKEQSREVPDGKRRHEMEKAKAIDID
Sbjct:    1 MKVLYKIGENIEMLTTETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVMERFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRIIALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPEDVSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHSLFIYYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDTIFFENFTGTNTETDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELSSTLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIWFKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDLDLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYEVMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNENLQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKDALVEQKGLLTTALALHKKLVTPAVLQLHERLEFCFKSMSDTIEDLNVFKGRSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSWQFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSADEEQLQRLAEEQALKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKTPPLPPVNEIQINSPKKEKKNNIFKRKFMRSISRKEQSREVPDGKRRHEMEKAKAIDID 823          
The following BLAST results are available for this feature:
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK19.283e-6122.27dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc... [more]
DOCK13.380e-5522.64dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc... [more]
DOCK35.335e-4924.69dedicator of cytokinesis 3 [Source:HGNC Symbol;Acc... [more]
DOCK45.469e-4924.61dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc... [more]
DOCK42.796e-4824.23dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ced-55.449e-1021.37CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3][more]
ced-55.449e-1021.37CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3][more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spg1.103e-4624.62gene:FBgn0264324 transcript:FBtr0330303[more]
spg1.103e-4624.62gene:FBgn0264324 transcript:FBtr0336766[more]
spg1.412e-4624.62gene:FBgn0264324 transcript:FBtr0330304[more]
spg3.101e-4624.70gene:FBgn0264324 transcript:FBtr0336765[more]
spg3.101e-4624.70gene:FBgn0264324 transcript:FBtr0330305[more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock4b9.446e-5226.34dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
dock4b9.519e-5226.34dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
dock4b9.583e-5226.34dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
dock4b1.136e-5126.34dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
dock4b1.538e-5025.94dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK45.188e-4824.44dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
DOCK46.957e-4824.22dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
DOCK42.631e-4623.76dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
DOCK42.798e-4623.98dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
DOCK43.244e-4623.76dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dock31.701e-5025.00dedicator of cyto-kinesis 3 [Source:MGI Symbol;Acc... [more]
Dock44.173e-4824.40dedicator of cytokinesis 4 [Source:MGI Symbol;Acc:... [more]
Dock44.459e-4824.40dedicator of cytokinesis 4 [Source:MGI Symbol;Acc:... [more]
Dock21.685e-4724.16dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc... [more]
Dock11.624e-4225.53dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14185|DOCK1_HUMAN4.458e-6022.27Dedicator of cytokinesis protein 1 OS=Homo sapiens... [more]
sp|Q8CIQ7|DOCK3_MOUSE2.337e-4925.00Dedicator of cytokinesis protein 3 OS=Mus musculus... [more]
sp|Q8IZD9|DOCK3_HUMAN2.562e-4824.69Dedicator of cytokinesis protein 3 OS=Homo sapiens... [more]
sp|Q8N1I0|DOCK4_HUMAN2.627e-4824.61Dedicator of cytokinesis protein 4 OS=Homo sapiens... [more]
sp|P59764|DOCK4_MOUSE3.119e-4724.40Dedicator of cytokinesis protein 4 OS=Mus musculus... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5MM119.999e-6122.09Dedicator of cytokinesis 1 OS=Lepisosteus oculatus... [more]
U3IT543.572e-6022.58Dedicator of cytokinesis 1 OS=Anas platyrhynchos p... [more]
H0VTH66.059e-6022.69Dedicator of cytokinesis 1 OS=Cavia porcellus OX=1... [more]
U3JEP17.338e-6022.73Dedicator of cytokinesis 1 OS=Ficedula albicollis ... [more]
U3CX332.525e-5922.39Dedicator of cytokinesis protein 1 OS=Callithrix j... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock4b4.211e-5126.34dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-81e3.11.268e-4825.08dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc... [more]
dock31.723e-4724.81dedicator of cytokinesis 3 [Source:ZFIN;Acc:ZDB-GE... [more]
dock11.558e-4223.46dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GE... [more]
DOCK21.382e-4024.27dedicator of cytokinesis 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007652.11.604e-5023.92pep scaffold:Pmarinus_7.0:GL478924:2687:150863:1 g... [more]
ENSPMAT00000008301.18.898e-3527.99pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-... [more]
ENSPMAT00000010350.11.084e-2824.46pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 ge... [more]
ENSPMAT00000010277.15.516e-1126.40pep scaffold:Pmarinus_7.0:GL478006:150137:181148:-... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DCK11.296e-923.26Dock family protein (Dedicator Of CytoKinesis), ho... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO487946.856e-4225.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358738.094e-2928.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318722.735e-1727.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280061.515e-939.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock4b3.676e-5025.95dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000046371.16.917e-4223.25dedicator of cytokinesis protein 3 [Source:NCBI ge... [more]
dock11.123e-4123.09dedicator of cytokinesis 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000012503.26.089e-4123.50dedicator of cytokinesis protein 3 [Source:NCBI ge... [more]
DOCK24.479e-3524.96dedicator of cytokinesis 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Dedicator of cytokinesis 4b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063595.10.000e+099.89SMESG000063595.1[more]
SMESG000063595.10.000e+099.89SMESG000063595.1[more]
SMESG000063595.10.000e+099.58SMESG000063595.1[more]
SMESG000063593.10.000e+098.17SMESG000063593.1[more]
SMESG000063593.10.000e+099.76SMESG000063593.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011727 ID=SMED30011727|Name=Dedicator of cytokinesis 4b|organism=Schmidtea mediterranea sexual|type=transcript|length=5609bp
TTTTAATCTTTAAATATTCTATTGATTTTAATTGTTGATTTTGTTTTCCG
AAAAAATGTCTTGGACGCAATTTGAAGAGCCTCTGATTGGGAAAGTCACT
CATCCATTTAAGAATGCTGTCCAACACGGTCTGATGCTCGACCTTGGAGA
CACAGTTATAATTAAATCGCAAAATTTGGGATGGTATTACGGATACTCGT
TGATGAAGTTCACCCCGGACAATTCTTTGGGAATCTTCCCGAATAGTTAT
GTCAAAATTATTGGAAAAAACGAAATTGTTTTGCAAAAGGATCACAAAGA
CAACAACGAGTATTTAGAAGTCCTAAATGCAAGGATGTTGACAACTCTTT
CAGTTCACGGAAGTATTTGGATTTCAGAACTTAAAAGACTTAATAAAGAA
AGTTTATCAGAGGAAACGATTGTTGCTGAAAACTATATAAATAAAATAGT
TAACTTATTTTTTGACATCATGAAGTTTTCCAACAACAAGGAGAAGTTAC
TGAAGATCTACGACCACATGTGGCTTGCCATTAACAAGTTAAACAATGTT
CTCAATATGGATTTCACCTTGGAAAAAAATACGTTGTCAGTTCTCAAAGT
TACAGATTTGCCAGTTGCCAGTTTAGAAAAGCTTTATGTTGACAATTACT
TTCAAATCAAAGCTTTGCTAGCAGATTTTGATGAAGCGCATAATTTAGAA
GCATTCTCGACTCAGCCTAAAACATCCCAATTGAATGATCTGGTAATAAC
CATGAATAACTTTGAGTTTCTTGGCGTGACAGATGAACTAATTATGGAAT
GGATGATCGTAGATCCCTCTCAAGACCACCAATTTGAACACTTCTGGTTG
CCGATTCTGGAAGCACGCAAAGGTAAACCAAAATGGAAAGATGAAAAATT
TGTTTTCAAAGAAATTCCCTTAGATATAAGAAAGGAGGGTTACCTCGTGG
TTTACGTATATCGGATAGGACAGCTACTAACTGATCCGAATAAGCTACTG
ATTTGCAAATTCAGAAGACCAGTTGCATTCGGAAGCTTCTCTGTAAAAGA
ACTCCAATCAAACAATGAAAAAGTTAAAATCAATCTTTTCAATTTAAGTG
AAACTGATTTCCTTAAACCAACAAGTGAACTTATCAAAACAAAACTGCCA
TCTCAGTTAGGTAACCGATTTGTTCAAGTGACACTAGAAACAAGCCACCC
CAATGAAACACAATATTTGGATTTGGACAATGATCACACCTTAGAAAGTA
TATATCTCTCAAATGATTCTCCAAATAAACAAGACAAGCATTTTCTTTAC
GTTCGACTTCGTGGAGCAGAATTTGATCGGGCGAATAAAAAATCAGCGAA
AAATGTTGAAGCTCAATTATCAGTAAAAGATAGCAGTGGACAAAAACTAG
AGTGCATTTTATCCAACCCTAATTCCAATAATAAAACAGACTATTTCTCA
TCAGTGACTTACCATAGCAATTCCCCGAAATGGAATGATCTGATTAAAAT
TGATCTGAATTCTGTAGACATCGAAGAATCGTATCTTTACATAGAATTCT
TTCATTGTACAACAAAAGATAAAAAAGGTGATGAAAGAAAATATTTCGCT
TGCTGCTTTCTACAATTAAAGAAATGTTTCGAGAGCGGAAAGATCGAAAA
CTCTTTTATGATAAGAACAAAAAAAAATTTTGTTATCCCGAAAAATCTGA
ATCATTCAACCTCGATCATTTGTAATGATCCAGATAAAAATTTATCCAAA
GAACTTTGCAATCTAACACTGGTTCTCTGTTCCACAGAACTCTCAAGCAA
AAACAATATAAATGAATTAATTTTAAAAAAATCCGAAAATTTCCAAATTT
TAAATCTCTGGCAATTTTTGAAAGAAGTTCAAACAATAACTAAAGATGAC
ATTTTGAAACCAAAATTACGAAAACGCATCATGGATATGATCAAATATTA
TTTCATCTCTTCACCTGTTCAAAATAATGACAATTTAGCCATTGAATTAT
TCATTACTTGCGTGATTCTGTTTGACAAGCACATCAAATTGAGGCTGAAT
GAAGAACTATTAGATTATTTGAGAGGAGAATATCAATTCATAGAGTTATT
ATTAAATGGAATAAAAAATGTTTTTCAAAACGCAATCAAGCTCAATATTT
CCTGTGAAATTCTCGCGATGTCCATGAACAGCATGGAGCCAGTTTTTATG
ATTTTGTCTAAAAATAACGAGCTTGAATATCACTATCAGATATCCGAAAG
GATAAAAGAAATCTTGAAATGGAACATAAACCTTTTTGAGGGAAATTACA
CCTCGGATCCCAACAACGATATTCGAAAATTCATTTTCGAATCAGCAAAT
GAAAACCTGAAGCACATCCAAAATCTCACATCGATCGATGTTTTATGTGA
ATATCTTAATTGTTTGTTTAAATCGAAAGATTTCCTCAATGAAAAAATTT
TGCCCAAAGAAAAATTGATTTTTATAGTTCAATTATTGCAATCAGGCATT
ATCTCAAATTGCTTCGATATTCTGACTGCGATATTCCACCCGATTGTTTC
CTTCTGTACAAATCTGATCGACATTTCCAGTCAGCACATCCTTTCAGCTG
CGGAAACCTTACTACTATTGTTTATGGAAACAAAAAACCTAATACAAGAT
GAACGAATCGTACTATTTTCAAGTAAAATAATGCTAAGATTTTTCACCCA
AACCTTCTTAGCATTTGGAAACATGCAAAACAAACAAATTCAAAAACCAA
GGTTCATATCCAGGAGAGACAGCGAAGACCTTCTGACAAATGGAACTTCT
CTGGTTTGCAAAACTGACGAATTTATTCCGGAATTCGAGAAGTTGTATAC
ATTACTGTTCTGCTATTTGGAAGAATGGTACAAAATTAGGAATGTAGACA
TTTCCGTGAGTGACCTACATGTTGTATTAAACAATTTGAAGAAACTATTA
GAAACTGAGATCTATCCTAAAAACTGGCTGTCCATATATTTGAAGATTTC
GAACATCTCAATGAAAGTTTTATACAAAATCGGTGAAAACATTGAAATGT
TAACTACTGAAACTCACATGAGACTTCTTCAAACATTTATTGAAGCTTCC
TTTGCGTTTATGACGCAGGATTGTCTAAAATTGGAAAAATTCTCACACTC
AAAGCGCATGAAAATTTTGGAAACATATGACGACATGAGAATTGAAGTTA
TGGAAAGATTTCTTAATGTCTGTTTAAACAAATCTTCAATGATTCGCAAT
TTTGATAAAGCTTTTGCTTTGGAAATGGTTGTTAAGATATTTAACGTCAG
CCTCCTTCCTGTTCCTAAAATAAGAATTAATATAGTGCCTTTTTTCGGTC
GCATCATTGCTCTTTTGTTGGACAAATGTAACGACAAAAGCGAGATCTGG
CAACAAGTCATTCCAGCAATTGAAAATATTTTTCGTGAAGGCTATGGAGA
TGAGGAATACCATATGTTTTTGTGCAAATTTGGTGGACAGGATATTCCCG
AAGATGTATCAGAAATTGTGAATGTTGTCTGTAAACTGATGGATCTCCAT
TTAGAAAATAGAAAAATTGCTTTCCAAACTTCCAAGGTGTTGCATCACGA
ATTCTTGCTTTTTTCATTCATGATGTTCTATAAGGAAGAGGTAAACATTC
ATTCACTCTTTATCCTCTACAGTGATAAATTGAGTCAACTTCTCGAAATG
GAAGGACACAAATTAGAAGCCGCTATGATTTTGAAAATGCAGTTCGACAC
AATGCCTTGGAATGAAGAGACCCTTCCATTTGACACGATATTCTTTGAGA
ATTTCACTGGAACAAATACAGAAACGGATAAAACAAATCTAGGAAACAAA
ATTATAAATTTATTAATAGAAATGCAGGAGTTTGAGGAGGCATGCTACAT
TTGTGATAATTTTATCAAGCATTATATAAGCACTTTCAATTATAAAGAAT
TGAGTTCTACCTTGAAAAAGATGTCAGAGTTCTATGAATTAATTATCACC
GAATCCAGACTCAAGATGAGTTATTACAGGATCACATTTATTGGAGGAGC
GTTACCCGGATCCATGAGACACTGTCGAGATTACGTATTCAAGTGCTCCA
TTTGGTTTAAAGTGAGCAACCTAAAAGAAATGTTAAAGAATGATTTTCCC
GACGCTGAAATAGAGTTCTATCAATCCAAACCTCCAATTGAATCTCCATA
TGAGCATAAAATGATTATTTACATTGCCAAAATGGATCCGATTCCATTCG
ACTTAGATTTGAATAAAAATAGAAATATCCACACAAAAATCAGAGATTAT
TTCAAAGATCATAACATCTGCAATTTTAGCAGTGACCATGCTTTCCATAA
AGGCAAAGTCGACAAGGATAATGAAGTCAAAACCGTCAATGTTACTCGCT
ATGAGGTGATGACTGAAACGATGCCAAATATTTTTACGTGGGCTCCCATC
ATAAATGAGAATATCCGAACGCTCAATCCCATTGAAGTTGCGACTGATAT
TATATTAAAGAAGAATCAAAATTTTAGAGATCTGATTGATGAATATAATG
AAAATCTGCAAAAAGATTTGAATCCATTTTCAATGCTTTTGCAAGGGACT
TTGGACGCTGGTGTAAATGGGGGGCTAAACAAATATATAAAGGCATTTTT
TAGTGATTCGAGTACTGAAGAATTTGATATTATACAAATAAAAGATTTCA
AAGATGCTTTAGTTGAACAGAAAGGTTTACTAACAACAGCACTGGCACTT
CACAAGAAATTGGTAACTCCCGCAGTCTTACAACTTCACGAGAGATTGGA
ATTCTGTTTTAGAAGTATGAGCGATACAATTGAAGATTTGAATGTGTTCA
AGGGTCGATCATCCAGTTCAGTGCCGACTCTTGACTGTGTCTATGATAGG
TTGGACAGCATCAGCTTCAAAACGATGAGTTTTGATACACAATTTTCAGA
AAAGAATGGTTCTTTCTACCAAGAAGATATAAGAACCAGCGAGACCTTAT
CTTGGCAATTCAGTGAAAATAACAATAGGTTCAGTGATGACTGTCGTTCA
TCAAACAGCACGGTGTTTCCAAAAAGCCATTCCGGATCAGAGAAAAGTAT
ATTAGGTGACACATTGGACCCATACAGATCCAGGAGAAAGGCTTCATCAG
CAGACGAAGAACAGTTACAAAGACTTGCTGAAGAACAGGCGCTAAAAATT
AAAATAAACAAGCTTTCCCCAAACCCTTCGCAATCTTCTCCAGATATTAA
TATGCAATTGAAAGACTACTCAAATGACGATGTTGAACTTTCTCCTCTTA
AAACGCCACCGCTTCCGCCGGTAAACGAAATTCAAATAAATTCTCCAAAA
AAAGAGAAAAAAAATAACATTTTCAAGCGGAAATTTATGAGAAGTATTTC
AAGAAAAGAACAAAGTCGAGAGGTACCCGACGGTAAAAGGCGACACGAAA
TGGAGAAAGCAAAGGCCATTGATATTGACTAAATGATGAAGTTATGAATG
CGGTTTATGTAGAAATAATTCTTGCATGTTAAATCGTTCAATTAATAATT
TTATTTTTTGTTTTAATTTGTTGCTTATTTTCTTAATACTGATATTTTAA
ACACAAAAA
back to top

protein sequence of SMED30011727-orf-1

>SMED30011727-orf-1 ID=SMED30011727-orf-1|Name=SMED30011727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1809bp
MSWTQFEEPLIGKVTHPFKNAVQHGLMLDLGDTVIIKSQNLGWYYGYSLM
KFTPDNSLGIFPNSYVKIIGKNEIVLQKDHKDNNEYLEVLNARMLTTLSV
HGSIWISELKRLNKESLSEETIVAENYINKIVNLFFDIMKFSNNKEKLLK
IYDHMWLAINKLNNVLNMDFTLEKNTLSVLKVTDLPVASLEKLYVDNYFQ
IKALLADFDEAHNLEAFSTQPKTSQLNDLVITMNNFEFLGVTDELIMEWM
IVDPSQDHQFEHFWLPILEARKGKPKWKDEKFVFKEIPLDIRKEGYLVVY
VYRIGQLLTDPNKLLICKFRRPVAFGSFSVKELQSNNEKVKINLFNLSET
DFLKPTSELIKTKLPSQLGNRFVQVTLETSHPNETQYLDLDNDHTLESIY
LSNDSPNKQDKHFLYVRLRGAEFDRANKKSAKNVEAQLSVKDSSGQKLEC
ILSNPNSNNKTDYFSSVTYHSNSPKWNDLIKIDLNSVDIEESYLYIEFFH
CTTKDKKGDERKYFACCFLQLKKCFESGKIENSFMIRTKKNFVIPKNLNH
STSIICNDPDKNLSKELCNLTLVLCSTELSSKNNINELILKKSENFQILN
LWQFLKEVQTITKDDILKPKLRKRIMDMIKYYFISSPVQNNDNLAIELFI
TCVILFDKHIKLRLNEELLDYLRGEYQFIELLLNGIKNVFQNAIKLNISC
EILAMSMNSMEPVFMILSKNNELEYHYQISERIKEILKWNINLFEGNYTS
DPNNDIRKFIFESANENLKHIQNLTSIDVLCEYLNCLFKSKDFLNEKILP
KEKLIFIVQLLQSGIISNCFDILTAIFHPIVSFCTNLIDISSQHILSAAE
TLLLLFMETKNLIQDERIVLFSSKIMLRFFTQTFLAFGNMQNKQIQKPRF
ISRRDSEDLLTNGTSLVCKTDEFIPEFEKLYTLLFCYLEEWYKIRNVDIS
VSDLHVVLNNLKKLLETEIYPKNWLSIYLKISNISMKVLYKIGENIEMLT
TETHMRLLQTFIEASFAFMTQDCLKLEKFSHSKRMKILETYDDMRIEVME
RFLNVCLNKSSMIRNFDKAFALEMVVKIFNVSLLPVPKIRINIVPFFGRI
IALLLDKCNDKSEIWQQVIPAIENIFREGYGDEEYHMFLCKFGGQDIPED
VSEIVNVVCKLMDLHLENRKIAFQTSKVLHHEFLLFSFMMFYKEEVNIHS
LFILYSDKLSQLLEMEGHKLEAAMILKMQFDTMPWNEETLPFDTIFFENF
TGTNTETDKTNLGNKIINLLIEMQEFEEACYICDNFIKHYISTFNYKELS
STLKKMSEFYELIITESRLKMSYYRITFIGGALPGSMRHCRDYVFKCSIW
FKVSNLKEMLKNDFPDAEIEFYQSKPPIESPYEHKMIIYIAKMDPIPFDL
DLNKNRNIHTKIRDYFKDHNICNFSSDHAFHKGKVDKDNEVKTVNVTRYE
VMTETMPNIFTWAPIINENIRTLNPIEVATDIILKKNQNFRDLIDEYNEN
LQKDLNPFSMLLQGTLDAGVNGGLNKYIKAFFSDSSTEEFDIIQIKDFKD
ALVEQKGLLTTALALHKKLVTPAVLQLHERLEFCFRSMSDTIEDLNVFKG
RSSSSVPTLDCVYDRLDSISFKTMSFDTQFSEKNGSFYQEDIRTSETLSW
QFSENNNRFSDDCRSSNSTVFPKSHSGSEKSILGDTLDPYRSRRKASSAD
EEQLQRLAEEQALKIKINKLSPNPSQSSPDINMQLKDYSNDDVELSPLKT
PPLPPVNEIQINSPKKEKKNNIFKRKFMRSISRKEQSREVPDGKRRHEME
KAKAIDID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR043162DOCK_C_lobe_C
IPR043161DOCK_C_lobe_A
IPR035892C2_domain_sf
IPR026791DOCK
IPR036028SH3-like_dom_sf
IPR010703DOCK_C
IPR027007DHR-1_domain
IPR001452SH3_domain
IPR027357DHR-2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0007264small GTPase mediated signal transduction
GO:0016477cell migration
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 330..350
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 3..72
e-value: 1.6E-8
score: 36.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1747..1808
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1778..1808
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1663..1701
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1686..1701
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1663..1681
NoneNo IPR availableCDDcd11684DHR2_DOCKcoord: 1201..1592
e-value: 9.52995E-73
score: 246.826
IPR043162Dedicator of cytokinesis, C-terminal, lobe CGENE3DG3DSA:1.20.58.740coord: 1474..1598
e-value: 2.0E-28
score: 100.7
IPR010703Dedicator of cytokinesis, C-terminalPFAMPF06920DHR-2coord: 1255..1593
e-value: 7.5E-48
score: 163.5
IPR043161Dedicator of cytokinesis, C-terminal, lobe AGENE3DG3DSA:1.25.40.410coord: 1178..1318
e-value: 2.7E-19
score: 71.1
IPR027007DHR-1 domainPFAMPF14429DOCK-C2coord: 412..581
e-value: 4.8E-25
score: 88.5
IPR027007DHR-1 domainPROSITEPS51650DHR_1coord: 411..580
score: 30.589
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 412..585
e-value: 5.0E-25
score: 90.3
IPR026791Dedicator of cytokinesisPANTHERPTHR45653FAMILY NOT NAMEDcoord: 3..1654
IPR027357DHR-2 domainPROSITEPS51651DHR_2coord: 1193..1601
score: 43.437
IPR001452SH3 domainPROSITEPS50002SH3coord: 7..71
score: 12.772
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 6..71