persulfide dioxygenase ETHE1, mitochondrial

Overview
Namepersulfide dioxygenase ETHE1, mitochondrial
Smed IDSMED30011723
Length (bp)1077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of persulfide dioxygenase ETHE1, mitochondrial (SMED30011723) t-SNE clustered cells

Violin plots show distribution of expression levels for persulfide dioxygenase ETHE1, mitochondrial (SMED30011723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of persulfide dioxygenase ETHE1, mitochondrial (SMED30011723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for persulfide dioxygenase ETHE1, mitochondrial (SMED30011723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011723SMESG000065858.1 Contig5177uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011723SMESG000065858.1 Contig5177newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011723SMESG000065858.1 Contig1214GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011723SMESG000075212.1 SMESG000074907.1 Contig5177uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011723SMESG000075212.1 SMESG000074907.1 Contig5177newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011723SMESG000065858.1 dd_Smed_v4_944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011723SMESG000065858.1 dd_Smed_v4_944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011723SMESG000065858.1 dd_Smed_v4_944_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 283.493 bits (724), Expect = 1.870e-94
Identity = 130/232 (56.03%), Postives = 170/232 (73.28%), Query Frame = 2
Query:  179 SNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
             + + ++ RQ+FEP+SCT++YLL D+ +R+A+LIDPV ET  RD +LIK+L + L + +NTH HADH+TGSG L+S+ P  +SVIS  S A+ D+ +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EF+ IM NLNL  P+QID A+PANM CG+
Sbjct:   18 GSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 267.314 bits (682), Expect = 4.875e-88
Identity = 123/227 (54.19%), Postives = 163/227 (71.81%), Query Frame = 2
Query:  170 HQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKAL 850
             +  + + ++ RQ+FEP+SCT++YLL D+ +R+A+LIDPV ET  RD +LIK+L + L + +NTH HADH+TGSG L+S+ P  +SVIS  S A+ D+ +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EF+ IM NLNL  P+QI + L
Sbjct:   15 QRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIGEQL 241          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: HAGHL (hydroxyacylglutathione hydrolase like [Source:HGNC Symbol;Acc:HGNC:14177])

HSP 1 Score: 78.5666 bits (192), Expect = 3.155e-16
Identity = 53/197 (26.90%), Postives = 97/197 (49.24%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEE-----MGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS------GQMVTTVEEELKHNPRLTKSRDE 790
            Y YL+ ++ TR+A+ +D      +R  +++ +  V+L  +L TH H DH  G+ +L  + P    + +      +   ++H +E++FG   + C  TPGHT G ++Y   E         F+GDAL + GCG     +G A ++Y  + + + +LPP   ++  H+++       Q V    + ++      K RDE
Sbjct:   13 YMYLVIEELTREAVAVD--VAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSC--LEGSAQQMYQSLAE-LGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDE 204          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: HAGHL (hydroxyacylglutathione hydrolase like [Source:HGNC Symbol;Acc:HGNC:14177])

HSP 1 Score: 78.1814 bits (191), Expect = 9.234e-16
Identity = 53/197 (26.90%), Postives = 97/197 (49.24%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEE-----MGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS------GQMVTTVEEELKHNPRLTKSRDE 790
            Y YL+ ++ TR+A+ +D      +R  +++ +  V+L  +L TH H DH  G+ +L  + P    + +      +   ++H +E++FG   + C  TPGHT G ++Y   E         F+GDAL + GCG     +G A ++Y  + + + +LPP   ++  H+++       Q V    + ++      K RDE
Sbjct:   13 YMYLVIEELTREAVAVD--VAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCG--SCLEGSAQQMYQSLAE-LGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDE 204          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: HAGHL (hydroxyacylglutathione hydrolase like [Source:HGNC Symbol;Acc:HGNC:14177])

HSP 1 Score: 76.2554 bits (186), Expect = 1.028e-15
Identity = 47/168 (27.98%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEE-----MGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            Y YL+ ++ TR+A+ +D      +R  +++ +  V+L  +L TH H DH  G+ +L  + P    + +      +   ++H +E++FG   + C  TPGHT G ++Y   E         F+GDAL + GCG     +G A ++Y  + + + +LPP   ++  H+++
Sbjct:   13 YMYLVIEELTREAVAVD--VAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSC--LEGSAQQMYQSLAE-LGTLPPETKVFCGHEHT 175          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Match: ethe-1 (ETHE1 (Human ETHylmalonic Encephalopathy) homolog [Source:UniProtKB/TrEMBL;Acc:O17636])

HSP 1 Score: 254.603 bits (649), Expect = 8.382e-84
Identity = 122/225 (54.22%), Postives = 162/225 (72.00%), Query Frame = 2
Query:  197 IFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACG 871
            IFRQ+ E  S TY+Y++    T  A++IDPV +TV RD ++I+ L+++L + LNTHVHADH+TG+  LK++FP  KSV+SS S  + D  VS  + ++ G  KL  + TPGHT+GCLTYV   +  AFTGDALLIR CGRTDFQQG+   L+D VH  I +LP  +++Y  H+Y+G + TTV EE   NPRLTKS+D+F+ IM NL L+YPKQIDKA+PANM  G
Sbjct:   10 IFRQLIEFKSSTYTYIIGCHKTGKAVIIDPVVDTVSRDIQIIRDLNLDLIYGLNTHVHADHITGTNSLKTVFPTMKSVLSSKSGGEADKYVSDGEIIEIGGLKLEVRETPGHTNGCLTYVEHSLRSAFTGDALLIRACGRTDFQQGNPASLFDSVHDKIFTLPEDYVVYVGHNYNGVLQTTVWEEKNLNPRLTKSKDQFVEIMKNLKLNYPKQIDKAVPANMVDG 234          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Match: Y17G7B.3 (pep chromosome:WBcel235:II:11989024:11992823:1 gene:WBGene00012459.1 transcript:Y17G7B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y17G7B.3)

HSP 1 Score: 80.1073 bits (196), Expect = 5.782e-17
Identity = 52/171 (30.41%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  233 YSYLLADKS-TRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-------EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            + Y++   S  R A+L+D V E  E  K+L  + ++++  +L TH H DH  G+   +  FPN   +        +D  V H D  +F   ++ C  TP HT G + Y            G+ FTGD L I GCGR  F +G A ++   +++ + +LP    ++P H+Y+
Sbjct:   14 FMYIVKKSSEARAALLVDLVNE--EDYKELADKENIDITAVLTTHHHYDHCGGNEGFRRQFPNVMILGGDSRIPAMDRHVKHGDMAEFAGLQIKCLSTPCHTSGHICYHITNPAADSTSPGVVFTGDTLFIAGCGR--FFEGTAPQMDVALNEILKNLPVETQIFPGHEYT 180          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: CG30022 (gene:FBgn0050022 transcript:FBtr0289990)

HSP 1 Score: 256.914 bits (655), Expect = 5.210e-84
Identity = 123/248 (49.60%), Postives = 165/248 (66.53%), Query Frame = 2
Query:  134 RFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            R++ S        +     +  FRQ+F+  S TYSYLLAD     A++IDPV E  +RD +L+K L   LK+ +NTH+HADH+TGSG L+ +    +SVI++ S AK D  ++  D + FG   +    TPGHT+GC+TYV ++ G  FTGD LLIRGCGRTDFQ+G    LY+ VH  I +LP  F +YPAHDY GQM ++V EE ++NPRLTK  +EF+ IM NLNL YPK+ID +LPAN  CG++
Sbjct:   28 RYLSSFGTMSLPERQPFSPDFFFRQLFDGESSTYSYLLADLKNGQAVIIDPVLEQAKRDAQLVKDLGFELKYAINTHMHADHITGSGWLRKL-TGCQSVIAAASGAKADRHLNEGDRIDFGTHVIDALATPGHTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQEGCPRNLYENVHSKIFTLPENFRIYPAHDYKGQMESSVWEEKRYNPRLTKDIEEFVKIMENLNLPYPKKIDASLPANRECGVY 274          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078252)

HSP 1 Score: 78.1814 bits (191), Expect = 3.343e-16
Identity = 52/180 (28.89%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSK-AKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEM-----GMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQ 727
            ++   +   Y YL+ D  TR+A ++DPV    E   K +++  + L  +L TH H DH  G+ KL  ++     V     +   ++  V  DD    G   + C  TP HT G + Y          G  FTGD L   GCGR  F +G   ++Y+ +   + +LP    ++  H+Y+ Q
Sbjct:   16 KILPALQDNYMYLIVDTKTREAAVVDPVEP--ELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 191          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078253)

HSP 1 Score: 78.1814 bits (191), Expect = 5.375e-16
Identity = 52/180 (28.89%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSK-AKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEM-----GMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQ 727
            ++   +   Y YL+ D  TR+A ++DPV    E   K +++  + L  +L TH H DH  G+ KL  ++     V     +   ++  V  DD    G   + C  TP HT G + Y          G  FTGD L   GCGR  F +G   ++Y+ +   + +LP    ++  H+Y+ Q
Sbjct:   50 KILPALQDNYMYLIVDTKTREAAVVDPVEP--ELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078254)

HSP 1 Score: 78.1814 bits (191), Expect = 8.818e-16
Identity = 52/180 (28.89%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSK-AKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEM-----GMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQ 727
            ++   +   Y YL+ D  TR+A ++DPV    E   K +++  + L  +L TH H DH  G+ KL  ++     V     +   ++  V  DD    G   + C  TP HT G + Y          G  FTGD L   GCGR  F +G   ++Y+ +   + +LP    ++  H+Y+ Q
Sbjct:   93 KILPALQDNYMYLIVDTKTREAAVVDPVEP--ELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 268          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 285.419 bits (729), Expect = 5.122e-95
Identity = 135/226 (59.73%), Postives = 171/226 (75.66%), Query Frame = 2
Query:  197 IFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            +FRQ+FE  SCTY+YLLAD  TR+A+LIDPV ETV+RD +LI+QL +NL   LNTH HADH+TG+G LK      KS IS +S A  D+ +S  D + FG+  L+ + TPGHTDGC+TYV  +  MAFTGDALLIRGCGRTDFQQG   +LY+ VH+ I SLP +  +YPAHDY GQ V+TV+EE K NPRLTK+ +EF+ IM+NLNL  PK+ID ++PAN+ CG+
Sbjct:   51 LFRQLFESESCTYTYLLADPDTREAVLIDPVLETVDRDLQLIQQLGLNLTVALNTHCHADHITGTGLLKKKVFGLKSGISKHSGAAADIQLSDGDSITFGKHCLMVRETPGHTDGCVTYVTGDQRMAFTGDALLIRGCGRTDFQQGSPHRLYESVHQKIFSLPGHCFIYPAHDYKGQTVSTVDEEKKFNPRLTKTVEEFVKIMDNLNLPKPKKIDISVPANLVCGL 276          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:336977])

HSP 1 Score: 90.5077 bits (223), Expect = 3.536e-20
Identity = 63/209 (30.14%), Postives = 99/209 (47.37%), Query Frame = 2
Query:  125 LSNRFIHSSLRFCCQHQHSNKSNLIFR-----QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            LS +F  ++L     H    KS+L+ +     ++   ++  Y YLL D+ T++A ++DPV      D   +K+  V LK +L TH H DH  G+ KL  + P             +   V+H +  K G   + C  TP HT G + Y        E    FTGD L + GCG+  F +G A ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   19 LSQKFAPTALF----HSAIRKSSLVEQSDMKVELLPALTDNYMYLLIDEETKEAAIVDPVEPQKVVDA--VKKHGVKLKTVLTTHHHWDHAGGNEKLVKLMPGLTVYGGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKENSTEAPAVFTGDTLFVAGCGK--FFEGTADEMYKALIEVLGRLPPETRVYCGHEYT 219          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:336977])

HSP 1 Score: 90.5077 bits (223), Expect = 3.536e-20
Identity = 63/209 (30.14%), Postives = 99/209 (47.37%), Query Frame = 2
Query:  125 LSNRFIHSSLRFCCQHQHSNKSNLIFR-----QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            LS +F  ++L     H    KS+L+ +     ++   ++  Y YLL D+ T++A ++DPV      D   +K+  V LK +L TH H DH  G+ KL  + P             +   V+H +  K G   + C  TP HT G + Y        E    FTGD L + GCG+  F +G A ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   19 LSQKFAPTALF----HSAIRKSSLVEQSDMKVELLPALTDNYMYLLIDEETKEAAIVDPVEPQKVVDA--VKKHGVKLKTVLTTHHHWDHAGGNEKLVKLMPGLTVYGGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKENSTEAPAVFTGDTLFVAGCGK--FFEGTADEMYKALIEVLGRLPPETRVYCGHEYT 219          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: pnkd (PNKD metallo-beta-lactamase domain containing [Source:ZFIN;Acc:ZDB-GENE-050208-278])

HSP 1 Score: 61.6178 bits (148), Expect = 3.930e-10
Identity = 47/175 (26.86%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLK------SIFPNSKSVISSYSKAKVDVAVSHDDEVKFG-EFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            YSY++ D ++  A+++DP     +  +  ++   V L+ +L TH H DH  G+  LK       ++ N+   I   +   +D      D + FG +      +TPGHT G + Y+ +   +      F+GD + + GCGR    +G+A  +   +   + SL    LL+P H+Y+
Sbjct:  106 YSYVVIDTASNTAVVVDPA--DPQPVQACLEAEGVALQAVLCTHKHWDHSGGNRALKRRYSSCRVYGNAMDNIPGLTHPLLD-----KDTIDFGTQLHFRAFYTPGHTVGHMIYLLDGRAIGGPSSLFSGDLVFLSGCGR--MFEGNASTMLSSLDT-VGSLNDDTLLWPGHEYA 270          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: ethe1 (ethylmalonic encephalopathy 1 [Source:NCBI gene;Acc:448221])

HSP 1 Score: 309.686 bits (792), Expect = 7.158e-105
Identity = 150/248 (60.48%), Postives = 180/248 (72.58%), Query Frame = 2
Query:  143 HSSLRFCCQHQHSNKSN-LIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF*P 883
             ++L  C ++     SN L+FRQ+FEP+SCTY+YLLADK+T++AILIDPV E  ERD KLIK L  N+ F  NTH HADH+TG+G LK + P  KSVIS  S A+ DV +   D++KFG+F +  + TPGHTDGCLTYV  +  MAFTGDALLIRGCGRTDFQQG    LY  VH  I SLP   LLYP HDY+GQ V++VEEE + NPRLTK   EF+ IMNNLNL  PKQID A+PAN+ CGI  P
Sbjct:    8 QAALSQCRRYSAMAASNGLVFRQLFEPVSCTYTYLLADKNTKEAILIDPVLEKAERDAKLIKDLGFNMIFAANTHCHADHITGTGVLKKLLPGCKSVISKDSGARADVYIQEGDQIKFGKFWVEARSTPGHTDGCLTYVLNDQSMAFTGDALLIRGCGRTDFQQGCPKTLYHSVHTKIFSLPDSCLLYPGHDYTGQTVSSVEEEKRLNPRLTKDEAEFVKIMNNLNLPKPKQIDVAVPANLKCGIQDP 255          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: ethe1 (ethylmalonic encephalopathy 1 [Source:NCBI gene;Acc:448221])

HSP 1 Score: 296.975 bits (759), Expect = 3.403e-100
Identity = 142/225 (63.11%), Postives = 167/225 (74.22%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF*P 883
            +FEP+SCTY+YLLADK+T++AILIDPV E  ERD KLIK L  N+ F  NTH HADH+TG+G LK + P  KSVIS  S A+ DV +   D++KFG+F +  + TPGHTDGCLTYV  +  MAFTGDALLIRGCGRTDFQQG    LY  VH  I SLP   LLYP HDY+GQ V++VEEE + NPRLTK   EF+ IMNNLNL  PKQID A+PAN+ CGI  P
Sbjct:    8 LFEPVSCTYTYLLADKNTKEAILIDPVLEKAERDAKLIKDLGFNMIFAANTHCHADHITGTGVLKKLLPGCKSVISKDSGARADVYIQEGDQIKFGKFWVEARSTPGHTDGCLTYVLNDQSMAFTGDALLIRGCGRTDFQQGCPKTLYHSVHTKIFSLPDSCLLYPGHDYTGQTVSSVEEEKRLNPRLTKDEAEFVKIMNNLNLPKPKQIDVAVPANLKCGIQDP 232          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:100216043])

HSP 1 Score: 80.4925 bits (197), Expect = 1.158e-16
Identity = 52/168 (30.95%), Postives = 79/168 (47.02%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            Y YLL D+ +++A ++DPV      D   +K+  V L  +L TH H DH  G+ KL  +    K          +   VSH    + G   + C +TP HT G + Y        E    FTGD L + GCG+  F +G   ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   28 YMYLLIDEESKEAAIVDPVQPQKVVDA--VKKHGVKLTTVLTTHHHWDHAGGNEKLVKMVSGLKVYGGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPNSTEPPAVFTGDTLFVAGCGK--FFEGTPEEMYAALIEVLGRLPPETRVYCGHEYT 191          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:100216043])

HSP 1 Score: 80.1073 bits (196), Expect = 1.445e-16
Identity = 52/168 (30.95%), Postives = 79/168 (47.02%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            Y YLL D+ +++A ++DPV      D   +K+  V L  +L TH H DH  G+ KL  +    K          +   VSH    + G   + C +TP HT G + Y        E    FTGD L + GCG+  F +G   ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   35 YMYLLIDEESKEAAIVDPVQPQKVVDA--VKKHGVKLTTVLTTHHHWDHAGGNEKLVKMVSGLKVYGGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPNSTEPPAVFTGDTLFVAGCGK--FFEGTPEEMYAALIEVLGRLPPETRVYCGHEYT 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:100216043])

HSP 1 Score: 80.1073 bits (196), Expect = 1.892e-16
Identity = 52/168 (30.95%), Postives = 79/168 (47.02%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            Y YLL D+ +++A ++DPV      D   +K+  V L  +L TH H DH  G+ KL  +    K          +   VSH    + G   + C +TP HT G + Y        E    FTGD L + GCG+  F +G   ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   55 YMYLLIDEESKEAAIVDPVQPQKVVDA--VKKHGVKLTTVLTTHHHWDHAGGNEKLVKMVSGLKVYGGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPNSTEPPAVFTGDTLFVAGCGK--FFEGTPEEMYAALIEVLGRLPPETRVYCGHEYT 218          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Ethe1 (ethylmalonic encephalopathy 1 [Source:MGI Symbol;Acc:MGI:1913321])

HSP 1 Score: 286.96 bits (733), Expect = 4.691e-96
Identity = 132/238 (55.46%), Postives = 173/238 (72.69%), Query Frame = 2
Query:  170 HQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF*P 883
             Q ++ + ++ RQ+FEP SCTY+YLL D+ +R+A+LIDPV ET  RD +LIK+L + L + +NTH HADH+TG+G L+S+ P  +SVIS  S A+ D+ +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EFI +M+NLNL  P+QID A+PANM CG+  P
Sbjct:   15 QQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPQQIDIAVPANMRCGVQTP 252          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 83.5741 bits (205), Expect = 2.901e-18
Identity = 54/180 (30.00%), Postives = 90/180 (50.00%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLI---KQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            ++   ++  Y YL+ D+ T++A ++DPV     + +K+I   K+  V L  +L TH H DH  G+ KL  + P  K          +   V+H   ++ G   + C  TP HT G + Y   + G +     FTGD L + GCG+  F +G A ++Y  + + +  LPP   +Y  H+Y+
Sbjct:    4 ELLPALTDNYMYLIIDEDTQEAAIVDPV-----QPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Haghl (hydroxyacylglutathione hydrolase-like [Source:MGI Symbol;Acc:MGI:1919877])

HSP 1 Score: 83.5741 bits (205), Expect = 4.542e-18
Identity = 54/197 (27.41%), Postives = 94/197 (47.72%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEE-----MGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS------GQMVTTVEEELKHNPRLTKSRDE 790
            Y YL+ ++ TR+A+ ID      ER  ++  +  V+L  +L+TH H DH  G+ +L  I P    + +      +   + H + ++FG   + C  TPGHT G ++Y   E         F+GDAL + GCG     +  A ++Y  + K + +LPP   ++  H+++       Q V    E ++      + RD+
Sbjct:   13 YMYLIIEEHTREAVAID--VAVAERLLEIAGREGVSLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRCLLTPGHTSGHMSYFLWEDDCPDSPALFSGDALSVAGCGW--HLEDTAQQMYQSLAKTLGTLPPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDD 205          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 83.5741 bits (205), Expect = 5.276e-18
Identity = 54/180 (30.00%), Postives = 90/180 (50.00%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLI---KQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            ++   ++  Y YL+ D+ T++A ++DPV     + +K+I   K+  V L  +L TH H DH  G+ KL  + P  K          +   V+H   ++ G   + C  TP HT G + Y   + G +     FTGD L + GCG+  F +G A ++Y  + + +  LPP   +Y  H+Y+
Sbjct:    4 ELLPALTDNYMYLIIDEDTQEAAIVDPV-----QPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 83.9593 bits (206), Expect = 8.155e-18
Identity = 52/184 (28.26%), Postives = 92/184 (50.00%), Query Frame = 2
Query:  185 KSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            + +++  ++   ++  Y YL+ D+ T++A ++DPV    ++  +  K+  V L  +L TH H DH  G+ KL  + P  K          +   V+H   ++ G   + C  TP HT G + Y   + G +     FTGD L + GCG+  F +G A ++Y  + + +  LPP   +Y  H+Y+
Sbjct:   46 QQDIMKVELLPALTDNYMYLIIDEDTQEAAIVDPVQP--QKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9DCM0|ETHE1_MOUSE (Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus OX=10090 GN=Ethe1 PE=1 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 3.281e-95
Identity = 132/238 (55.46%), Postives = 173/238 (72.69%), Query Frame = 2
Query:  170 HQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF*P 883
             Q ++ + ++ RQ+FEP SCTY+YLL D+ +R+A+LIDPV ET  RD +LIK+L + L + +NTH HADH+TG+G L+S+ P  +SVIS  S A+ D+ +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EFI +M+NLNL  P+QID A+PANM CG+  P
Sbjct:   15 QQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPQQIDIAVPANMRCGVQTP 252          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3T094|ETHE1_BOVIN (Persulfide dioxygenase ETHE1, mitochondrial OS=Bos taurus OX=9913 GN=ETHE1 PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 6.914e-94
Identity = 137/257 (53.31%), Postives = 180/257 (70.04%), Query Frame = 2
Query:  113 SILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF*P 883
            S+LK++ R +        QH  S  + ++ RQ+FEP SCTY+YLL D+ +R+A+LIDPV ET +RD +L+K+L + L + +NTH HADH+TGSG L+S+ P  +SVIS  S A+ D  +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EF+ +M+ LNL  P+QID A+PANM CGI  P
Sbjct:    4 SVLKIAGRRLS-------QHTGSG-APVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAQRDAQLVKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADWHIEDGDSIQFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAETLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFVKVMDKLNLPKPQQIDFAVPANMRCGIQTP 252          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|O95571|ETHE1_HUMAN (Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 8.978e-94
Identity = 130/232 (56.03%), Postives = 170/232 (73.28%), Query Frame = 2
Query:  179 SNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
             + + ++ RQ+FEP+SCT++YLL D+ +R+A+LIDPV ET  RD +LIK+L + L + +NTH HADH+TGSG L+S+ P  +SVIS  S A+ D+ +   D ++FG F L  + +PGHT GC+T+V  +  MAFTGDALLIRGCGRTDFQQG A  LY  VH+ I +LP   L+YPAHDY G  V+TVEEE   NPRLT S +EF+ IM NLNL  P+QID A+PANM CG+
Sbjct:   18 GSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9C8L4|ETHE1_ARATH (Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLY3 PE=1 SV=3)

HSP 1 Score: 265.774 bits (678), Expect = 2.638e-86
Identity = 135/235 (57.45%), Postives = 170/235 (72.34%), Query Frame = 2
Query:  194 LIFRQVFEPISCTYSYLLADKSTRD--AILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMG------MAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            L+FRQ+FE  S T++YLLAD S  D  A+LIDPV +TV+RD KLI +L + L + +NTHVHADHVTG+G LK+  P  KSVIS  S +K D+ +   D+V  G+  L  + TPGHT GC+TYV  E        MAFTGDA+LIRGCGRTDFQ+G + +LY+ VH  I +LP   L+YPAHDY G  V+TV EE++HNPRLTK ++ F TIM+NLNLSYPK ID A+PANM CG+
Sbjct:   52 LLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGL 286          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3JRV4|Y2304_BURP1 (Probable metallo-hydrolase BURPS1710b_2304 OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=BURPS1710b_2304 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.864e-24
Identity = 82/270 (30.37%), Postives = 123/270 (45.56%), Query Frame = 2
Query:  212 FEPISCTYSYLLADKSTRDAILIDPVYE---------TVERDKKL--IKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDV---------AVSHD-----------DEVKFGEFKLICKHTPGHTDGCLTYVFEE--------MGMAFTGDALLIR--GCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSG-----QMVTTVEEELKHNPRLTK--SRDEFITI--MNNLNLSYPKQIDKALPANMACG 871
            F+P +CT SYLL D  + +  LID V +         T   D+ +  +  L   ++++L THVHADH++ +  LK+      ++    ++ + DV         A +HD           D +  G   +   HTPGHT  C+TYV  E           AF GD L +   G  R DF  GDA  LY  + K +LSLPP   LY  HDY       Q  +TV +EL+ N  + +  + D+F+ +    +  L  P  +  ++  NM  G
Sbjct:    7 FDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQ-DVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRK-VLSLPPATRLYMCHDYQPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAG 274          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1S3I365 (persulfide dioxygenase ETHE1, mitochondrial isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160274 PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.706e-104
Identity = 151/239 (63.18%), Postives = 180/239 (75.31%), Query Frame = 2
Query:  161 CCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            C     +     IFRQ+F+  S TYSYL+AD ++++A+LIDPVYE V RD K+I +L +NLK  +NTH+HADHVTGSGKLK      KSVIS YS A+ D+ +   D  +FG+FK+  K TPGHTDGC+T+++ E G+AFTGDALLIRGCGRTDFQQG+ G LYD VH  ILSLPP  LLYPAHDY+GQ VTTV EE K NPRLTKS++EFI IM NLNL YPKQID ALP N  CGIF
Sbjct:   47 CMCAAAAGPKGFIFRQLFDHTSFTYSYLIADANSKEAVLIDPVYELVSRDLKVINELGLNLKLTVNTHMHADHVTGSGKLKQEIAGCKSVISKYSGAQADIYLDDGDTFEFGKFKMEAKKTPGHTDGCMTFIWHEQGIAFTGDALLIRGCGRTDFQQGNPGTLYDSVHNVILSLPPDTLLYPAHDYTGQSVTTVAEEKKCNPRLTKSKEEFIKIMENLNLPYPKQIDHALPKNQVCGIF 285          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A267FQS0 (Lactamase_B domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008923g5 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 2.851e-104
Identity = 151/258 (58.53%), Postives = 187/258 (72.48%), Query Frame = 2
Query:  101 MAIFSILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            M +F  L L    + ++ RFC     S    +IFRQ+FEP SCTY+YL+  ++TR+A+ IDPV ET ERD  L+KQL +NL + +NTH+HADHVTG+G+LK++ P  +SVIS   KA+ DV +    ++ FG  +L  + TPGHTDGCLTYV     MAFTGDALLIRGCGRTDFQQG   +LY+ VH  I  LP ++LLYPAHDY+GQ VTTV EE K+N RLTKS+ EFI IMNNLNL YPKQID ALPANM CG+
Sbjct:    7 MRLFRPLSL----LLATRRFC-SGGGSGSDRIIFRQLFEPKSCTYTYLIGCQATRNAVYIDPVIETAERDANLVKQLGLNLVYAINTHLHADHVTGTGRLKALLPGCRSVISGAYKARADVHIEDGTKIDFGRLQLETRSTPGHTDGCLTYVLHSHAMAFTGDALLIRGCGRTDFQQGSPDRLYESVHSQIFGLPEHYLLYPAHDYTGQSVTTVAEEKKYNSRLTKSKAEFINIMNNLNLPYPKQIDTALPANMICGM 259          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1S3I1Y3 (persulfide dioxygenase ETHE1, mitochondrial isoform X2 OS=Lingula unguis OX=7574 GN=LOC106160274 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 3.040e-104
Identity = 149/239 (62.34%), Postives = 181/239 (75.73%), Query Frame = 2
Query:  161 CCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            C     +     IFRQ+F+  S TYSYL+AD ++++A+LIDPVYE V RD K+I +L +NLK  +NTH+HADHVTGSGKLK      KSVIS YS A+ D+ +   D  +FG+FK+  K TPGHTDGC+T+++ E G+AFTGDALLIRGCGRTDFQQG+ G LYD VH  ILSLPP  LLYPAHDY+GQ VTTV EE K NPRLTKS++EFI IM NLNL YPKQID+A+P N  CG+F
Sbjct:   47 CMCAAAAGPKGFIFRQLFDHTSFTYSYLIADANSKEAVLIDPVYELVSRDLKVINELGLNLKLTVNTHMHADHVTGSGKLKQEIAGCKSVISKYSGAQADIYLDDGDTFEFGKFKMEAKKTPGHTDGCMTFIWHEQGIAFTGDALLIRGCGRTDFQQGNPGTLYDSVHNVILSLPPDTLLYPAHDYTGQSVTTVAEEKKCNPRLTKSKEEFIKIMENLNLPYPKQIDRAIPLNKVCGVF 285          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1I8IEW8 (Lactamase_B domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 4.927e-104
Identity = 151/258 (58.53%), Postives = 187/258 (72.48%), Query Frame = 2
Query:  101 MAIFSILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            M +F  L L    + ++ RFC     S    +IFRQ+FEP SCTY+YL+  ++TR+A+ IDPV ET ERD  L+KQL +NL + +NTH+HADHVTG+G+LK++ P  +SVIS   KA+ DV +    ++ FG  +L  + TPGHTDGCLTYV     MAFTGDALLIRGCGRTDFQQG   +LY+ VH  I  LP ++LLYPAHDY+GQ VTTV EE K+N RLTKS+ EFI IMNNLNL YPKQID ALPANM CG+
Sbjct:    1 MRLFRPLSL----LLATRRFC-SGGGSGSDRIIFRQLFEPKSCTYTYLIGCQATRNAVYIDPVIETAERDANLVKQLGLNLVYAINTHLHADHVTGTGRLKALLPGCRSVISGAYKARADVHIEDGTKIDFGRLQLETRSTPGHTDGCLTYVLHSHAMAFTGDALLIRGCGRTDFQQGSPDRLYESVHSQIFGLPEHYLLYPAHDYTGQSVTTVAEEKKYNSRLTKSKAEFINIMNNLNLPYPKQIDTALPANMICGM 253          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: I3PG26 (ETHE1 OS=Urechis unicinctus OX=6432 PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.719e-104
Identity = 147/253 (58.10%), Postives = 190/253 (75.10%), Query Frame = 2
Query:  119 LKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            LKL  + + + + +     + +   ++FRQ+F+  S TY+YLL D ++++A+LIDPV E V+RD +++K+L +NLK+ +NTHVHADHVTG+G++K   P  KSVI+  S+AK DV ++  D ++FG+FKL C+ TPGHTDGC TYV+ E GMAFTGDALLIRGCGRTDFQQG +  LY  VH  ILSLP  F+LYPAHDY+GQ  TTV EE  HNPRLTK  D FI IM+ LNL YPKQ+D+ALPANM CGIF
Sbjct:   32 LKLETKPVCTRVMYRSYSANMHGQEVVFRQLFDNTSFTYTYLLGDAASKEAVLIDPVIELVDRDVRIVKELGLNLKYAVNTHVHADHVTGTGEIKKRIPTCKSVIAECSQAKADVFINEGDGIEFGQFKLECRSTPGHTDGCFTYVWHEKGMAFTGDALLIRGCGRTDFQQGSSEALYKSVHGKILSLPEQFILYPAHDYTGQTSTTVREEKNHNPRLTKPIDVFIRIMSELNLPYPKQLDRALPANMVCGIF 284          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 214.157 bits (544), Expect = 2.615e-68
Identity = 110/222 (49.55%), Postives = 140/222 (63.06%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            +FE  S TYSYLLAD  + +A+LIDPV ET                                  + +F   KS IS +S A  D+ +S  D +KFG+  L  + TPGHTDGC+T+V  +  MAFTGDALLIRGCGRTDFQQG + KLY+ VH+ I +LP + L+YPAHDY GQ V++V+EE K NPRLTKS  EF+ IM+NLNL  P +ID A+PAN+ CG+
Sbjct:   16 LFEAESSTYSYLLADAGSGEAVLIDPVLET----------------------------------QRVF-GLKSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 202          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 213.772 bits (543), Expect = 3.700e-68
Identity = 110/222 (49.55%), Postives = 140/222 (63.06%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            +FE  S TYSYLLAD  + +A+LIDPV ET                                  + +F   KS IS +S A  D+ +S  D +KFG+  L  + TPGHTDGC+T+V  +  MAFTGDALLIRGCGRTDFQQG + KLY+ VH+ I +LP + L+YPAHDY GQ V++V+EE K NPRLTKS  EF+ IM+NLNL  P +ID A+PAN+ CG+
Sbjct:   12 LFEAESSTYSYLLADAGSGEAVLIDPVLET----------------------------------QRVF-GLKSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 212.616 bits (540), Expect = 1.396e-67
Identity = 110/222 (49.55%), Postives = 140/222 (63.06%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            +FE  S TYSYLLAD  + +A+LIDPV ET                                  + +F   KS IS +S A  D+ +S  D +KFG+  L  + TPGHTDGC+T+V  +  MAFTGDALLIRGCGRTDFQQG + KLY+ VH+ I +LP + L+YPAHDY GQ V++V+EE K NPRLTKS  EF+ IM+NLNL  P +ID A+PAN+ CG+
Sbjct:   26 LFEAESSTYSYLLADAGSGEAVLIDPVLET----------------------------------QRVF-GLKSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 212          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 200.29 bits (508), Expect = 7.070e-63
Identity = 107/222 (48.20%), Postives = 136/222 (61.26%), Query Frame = 2
Query:  203 RQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMAC 868
            R +FE  S TYSYLLAD  + +A+LIDPV ET                                  + +F   KS IS +S A  D+ +S  D +KFG+  L  + TPGHTDGC+T+V  +  MAFTGDALLIRGCGRTDFQQG + KLY+ VH+ I +LP + L+YPAHDY GQ V++V+EE K NPRLTKS  EF+ IM+NLNL  P +I     A++AC
Sbjct:    6 RSLFEAESSTYSYLLADAGSGEAVLIDPVLET----------------------------------QRVF-GLKSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIGT---AHLAC 189          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:103027791])

HSP 1 Score: 88.5817 bits (218), Expect = 1.727e-19
Identity = 63/211 (29.86%), Postives = 100/211 (47.39%), Query Frame = 2
Query:  110 FSILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDK--KLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVF-----EEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            F+  KL + F  S +R     + S+    +  ++   ++  Y YLL D+ T++A ++DPV    E +K  + +K+  V LK +L TH H DH  G+ KL  + P             +   V+H +  K G   + C  TP HT G + Y        E    FTGD L + GCG+  F +G A ++Y  +   +  LPP   +Y  H+Y+
Sbjct:   23 FAPSKLQSAFFSSVVRKSSLVEQSD----MKIELLPALTDNYMYLLIDEDTKEAAIVDPV----EPNKVVEAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLIPGLTVYGGDDRVGALTKKVTHYNTFKVGSLNVKCLFTPCHTSGHICYYVTKENSSEPPAVFTGDTLFVAGCGK--FFEGTADEMYKALIDVLGRLPPETRVYCGHEYT 223          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 284.263 bits (726), Expect = 7.831e-96
Identity = 140/246 (56.91%), Postives = 174/246 (70.73%), Query Frame = 2
Query:  137 FIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            FI+  +R C     S     +  Q+FE +S TY+YLLAD  +R+A+LIDPV ETV+RD ++I ++ V L +  NTH HADHVTG+G LK    + KS+IS  S A  D+ +   D +KFG+F L  + TPGHTDGCLTYV  +  MAFTGDALLIRGCGRTDFQQGDA KLY  VH+ ILSLP    LYPAHDY+GQ ++TV EE K NPR TK   +F+ +MNNLNL  PKQID+A+PAN+ CGI
Sbjct:   10 FIYVCVRACVLCACS-----VHPQLFEHVSSTYTYLLADADSREAVLIDPVLETVDRDLRIINEIGVKLVYAANTHCHADHVTGTGMLKKKLSDCKSIISGQSGAIADIHIKEGDTIKFGKFTLEVRSTPGHTDGCLTYVLSDHSMAFTGDALLIRGCGRTDFQQGDATKLYQSVHEKILSLPGDCALYPAHDYTGQTMSTVAEEKKFNPRFTKPLPQFVELMNNLNLPKPKQIDRAVPANLLCGI 250          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: pnkd (PNKD metallo-beta-lactamase domain containing [Source:ZFIN;Acc:ZDB-GENE-050208-278])

HSP 1 Score: 67.3958 bits (163), Expect = 5.592e-13
Identity = 57/213 (26.76%), Postives = 94/213 (44.13%), Query Frame = 2
Query:  176 HSNKSNLIFRQVF-EPISC---TYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRD 787
            HS    +IF  +   P+      Y Y++ D  +R A+++D      +  +  I+Q  V L+ IL TH H DH  G+  L+ I+          +   +   V+  +E++FG      + TPGHT G + YV +          F+GD L + GCGR  F+      L  +    + SL    LL+P H+ +   ++   E    NP + +  D
Sbjct:   31 HSTVKPVIFNGLMISPVPIMTDNYGYMVTDLESRTAVVLD--ASDPQAIEVCIEQEGVTLEAILATHKHWDHSGGNQVLRKIYKCPVYGCPHDNIPGLTNPVADGEELRFGRLCFRARFTPGHTVGHMVYVLDGQPFGAPDCLFSGDLLFLAGCGRM-FEGTPETMLSSL--DIVSSLADSTLLFPGHECALDNLSFAVEMEPDNPAILQKLD 238          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: LACTB2 (lactamase beta 2 [Source:HGNC Symbol;Acc:HGNC:18512])

HSP 1 Score: 47.3654 bits (111), Expect = 2.048e-6
Identity = 60/215 (27.91%), Postives = 93/215 (43.26%), Query Frame = 2
Query:  206 QVFEPISC---------TYSYLLADKSTRDAILIDP----VYETVERDKKLIKQLDVNLKFILNTHVHADHV-----------TGSG----KLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGE-FKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHK--YILSLPPYFLLYPAHDYSGQMVTTVEEELK 757
            +VF  + C         T +YL+   S R  +LID     + E V   +  + QL  +++ I+ TH H DHV            G+G    KL  + P  + V+       ++     D +V   E   L   +TPGHTD  +  + EE G  F+GD L   G G   F+      LY  +     +L+L P  L+YP H   G +V   +E+++
Sbjct:   14 RVFRVLGCNPGPMTLQGTNTYLVGTGSRR--VLIDTGEPNIPEYVANLQMALAQLGSSVQEIILTHWHHDHVGGISDVCRALAIGTGVRLSKLPRVPPRREEVLDGEG---LEYTFLRDGDVVTTEGATLRVVYTPGHTDDHMVLLLEEEGSVFSGDCL---GEGTAVFED-----LYTYMRSLDLLLNLKPK-LIYPGH---GPVVQDAQEKIR 211          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Match: GLO4 (Mitochondrial glyoxalase II; catalyzes the hydrolysis of S-D-lactoylglutathione into glutathione and D-lactate; GLO4 has a paralog, GLO2, that arose from the whole genome duplication [Source:SGD;Acc:S000005566])

HSP 1 Score: 70.4774 bits (171), Expect = 2.839e-14
Identity = 56/190 (29.47%), Postives = 87/190 (45.79%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKS------VISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYIL------SLPPYFLLYPAHDYSGQMVTTVEEEL 754
            YSYLL+ +  R++ LIDP  E +E   KL  +   ++  I+NTH H DH  G+  L SI     S      +  S S   V     +  +   G  ++ C  TP HT   + Y  +++       FTGD L I GCGR  F +G  G+  D+    I+      +      +YP H+Y+   V+ +  ++
Sbjct:   27 YSYLLSTEDRRNSWLIDPA-EPLEVSPKLSAEEKKSIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGR--FFEG-TGRDMDMALNQIMLRAVGETNWNKVKIYPGHEYTKGNVSFIRAKI 212          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Match: GLO2 (Cytoplasmic glyoxalase II; catalyzes the hydrolysis of S-D-lactoylglutathione into glutathione and D-lactate; GLO2 has a paralog, GLO4, that arose from the whole genome duplication [Source:SGD;Acc:S000002680])

HSP 1 Score: 69.3218 bits (168), Expect = 6.434e-14
Identity = 56/192 (29.17%), Postives = 87/192 (45.31%), Query Frame = 2
Query:  212 FEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGK----LKSIFPNSKSVISSYSK--AKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGM----AFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSL-----PPYFLLYPAHDYSGQMVTTV 742
            +E     Y YLL+D   + + LIDP  E  E   +L +   ++++ I+NTH H DH  G+      LK   P SK  +   SK   KV +   +  ++  G+ ++ C  TP HT   + Y  ++        FTGD L   GCGR  F +G   ++   ++  IL            +YP H+Y+   V  V
Sbjct:   10 WESGGVNYCYLLSDSKNKKSWLIDPA-EPPEVLPELTEDEKISVEAIVNTHHHYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPCHTRDSICYYVKDPTTDERCIFTGDTLFTAGCGR--FFEGTGEEMDIALNNSILETVGRQNWSKTRVYPGHEYTSDNVKFV 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO42013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J6])

HSP 1 Score: 259.996 bits (663), Expect = 4.372e-86
Identity = 129/228 (56.58%), Postives = 165/228 (72.37%), Query Frame = 2
Query:  188 SNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACG 871
            S L+FRQ+F+  S T++YLL    TR A++IDPV   V+RD KLI +L++ L + +NTHVHADH+TG+G LK +    +S+IS  S A  DV V+  D+V FG+  L    TPGHT+GC+T+V     MAFTGDALLIR CGRTDFQ+G A KLY+ VH  ILSLP  F LYP HDY+G   TTV+EELKHNPRLTKS+ +F+ IM+ L L+ PK+ID+A+P NM CG
Sbjct:    3 SRLVFRQLFDYESYTFTYLLGCGRTRQAVIIDPVDTQVKRDTKLIDELELKLIYAMNTHVHADHITGTGLLKGM-TACQSIISKNSGAIADVFVNDGDKVVFGDESLEVLATPGHTNGCITFVSHMHKMAFTGDALLIRACGRTDFQEGSAEKLYESVHSKILSLPRDFTLYPGHDYTGMSSTTVDEELKHNPRLTKSKGDFVEIMSKLGLTKPKRIDEAVPVNMMCG 229          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO29820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J2])

HSP 1 Score: 163.696 bits (413), Expect = 2.392e-49
Identity = 95/183 (51.91%), Postives = 128/183 (69.95%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQG----DAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTV 742
            Q+F+  +CTY+Y+L   S+R A++IDPV   V RD +L+ +L + L++ +NTHVHADHVTGSG LK +    KS I++ SKAK D  ++H D +++GE  L  + TPGHT GC+T+V     MAFTGDALL+R CGRTDFQQG    DA  LY  +H  ILSLP  +LLYP HDY G+ ++T+
Sbjct:    5 QLFDSETCTYTYILGCMSSRKAVIIDPVDTKVSRDARLLNELKLELEWAVNTHVHADHVTGSGYLKGLI-GCKSAIAAASKAKADKHLNHGDVLQYGEQALEARATPGHTHGCMTFVDHAHRMAFTGDALLVRACGRTDFQQGMARSDATVLYKSIHDQILSLPGDYLLYPGHDYKGKYMSTI 186          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO47915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI7])

HSP 1 Score: 80.1073 bits (196), Expect = 2.179e-17
Identity = 54/176 (30.68%), Postives = 84/176 (47.73%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTY-VFEEMG---MAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
            ++   +S  Y YLL D  T++A ++DPV    E+    +++  V L  +L TH H DH  G+  L  +               +   VSHD+E K G   + C  TP HT G + + V  + G     FTGD L   GCGR  F +G   ++Y  + + + SLP    ++  H+Y+
Sbjct:    4 RLLPALSDNYMYLLVDPKTKEAAVVDPVEP--EKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEGLVKLVSGLTVYGGDERIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDAGKPTAVFTGDTLFSGGCGR--FFEGSPPEMYSALIEVLGSLPENTRVFCGHEYT 175          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO44424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP5])

HSP 1 Score: 77.411 bits (189), Expect = 4.778e-16
Identity = 60/218 (27.52%), Postives = 98/218 (44.95%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEV---------KFGEFKLICKHTPGHTDGCLTY-----VFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDK 844
            YSY++ D +T  A+++DP     E  K ++ +  + L+ +L TH H DH  G+  LK+ FP+     S    A     ++H  +          K  +       TPGHT G + Y     VF  +   F+GD L + GCGR    +G  G++ + +   + SL    LL+P HDY+ + +         N  L    D  + + NN  ++ P  I +
Sbjct:   63 YSYIIVDITTSSAVVVDP--SDPEAVKDVLNKEKLQLEAVLTTHKHWDHSGGNTSLKADFPSVAVYGSELDDAP---GLTHTRKPLCDISNFSGKVSQLSFTAFSTPGHTAGHVVYLLHGAVFNSVDSLFSGDLLFLGGCGR--IFEGAPGEMLESLQT-VSSLKDDTLLWPGHDYAMKNLMFALTIEPSNYHLRAKMDWVVEMRNNKYMTSPSTIGE 272          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO27917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7X9])

HSP 1 Score: 76.2554 bits (186), Expect = 4.798e-16
Identity = 52/164 (31.71%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  206 QVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTY-VFEEMG---MAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLP 685
            ++   +S  Y YLL D  T++A ++DPV    E+    +++  V L  +L TH H DH  G+  L  +               +   VSHD+E K G   + C  TP HT G + + V  + G     FTGD L   GCGR  F +G   ++Y  + + + SLP
Sbjct:   17 RLLPALSDNYMYLLVDPKTKEAAVVDPVEP--EKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEGLVKLVSGLTVYGGDERIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDAGKPTAVFTGDTLFSGGCGR--FFEGSPPEMYSALIEVLGSLP 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc:101159221])

HSP 1 Score: 286.96 bits (733), Expect = 1.648e-95
Identity = 138/251 (54.98%), Postives = 179/251 (71.31%), Query Frame = 2
Query:  131 NRFI---HSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            N FI     S R  C    + +  L+F+Q+FE  SCTY+YLLAD  T+DA++IDPV E ++RD KL+++L +NL   +NTH HADH+T +G +K      KS IS +S A  D+ +S  D++ FG+  L+ K TPGHTDGC T V ++  MAFTGDALLIRGCGRTDFQQG + KLYD +H+ I +LP   L+YPAHDY GQ V+TV EE K NPRLTKS++EFI IM+NLNL  PK+ID A+PAN+ CG+
Sbjct:   43 NSFIEPSRDSRRLYCASM-AMRQGLLFKQLFESESCTYTYLLADTETKDAVIIDPVLEKLDRDVKLVQELGLNLTVAVNTHCHADHITSTGLMKKRILGLKSAISKFSGASADIQLSEGDKIPFGKHYLVVKETPGHTDGCSTLVLDDELMAFTGDALLIRGCGRTDFQQGSSSKLYDSIHQKIFTLPEQCLIYPAHDYLGQTVSTVGEERKLNPRLTKSKEEFIKIMDNLNLPKPKKIDIAVPANLVCGL 292          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc:101159221])

HSP 1 Score: 267.314 bits (682), Expect = 1.184e-88
Identity = 127/222 (57.21%), Postives = 164/222 (73.87%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGI 874
            +FE  SCTY+YLLAD  T+DA++IDPV E ++RD KL+++L +NL   +NTH HADH+T +G +K      KS IS +S A  D+ +S  D++ FG+ +     TPGHTDGC T V ++  MAFTGDALLIRGCGRTDFQQG + KLYD +H+ I +LP   L+YPAHDY GQ V+TV EE K NPRLTKS++EFI IM+NLNL  PK+ID A+PAN+ CG+
Sbjct:   24 LFESESCTYTYLLADTETKDAVIIDPVLEKLDRDVKLVQELGLNLTVAVNTHCHADHITSTGLMKKRILGLKSAISKFSGASADIQLSEGDKIPFGKHE-----TPGHTDGCSTLVLDDELMAFTGDALLIRGCGRTDFQQGSSSKLYDSIHQKIFTLPEQCLIYPAHDYLGQTVSTVGEERKLNPRLTKSKEEFIKIMDNLNLPKPKKIDIAVPANLVCGL 240          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: hagh (hydroxyacylglutathione hydrolase, mitochondrial [Source:NCBI gene;Acc:101161407])

HSP 1 Score: 92.0485 bits (227), Expect = 7.870e-21
Identity = 58/200 (29.00%), Postives = 99/200 (49.50%), Query Frame = 2
Query:  137 FIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS 721
             +HS++R      H  K   +  ++   +S  Y YLL D+ +++A ++DPV     +  + +++  V L  +L TH H DH  G+ K+  + P  K          +   VSH + +K G   + C  TP HT G + Y     G +     FTGD L + GCG+  F +G A ++Y+ + + + +LPP   +Y  H+Y+
Sbjct:   34 LLHSAVR----KPHLVKQADMRVELLPALSDNYMYLLIDEDSKEAAIVDPVEPI--KVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLMPGLKVCGGDDRVDAITKKVSHSNTLKLGSLSIKCLFTPCHTTGHICYYVTREGSSEPPAVFTGDTLFVAGCGK--FFEGTAEQMYEALIEILGNLPPETRVYCGHEYT 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: HAGHL (hydroxyacylglutathione hydrolase-like protein [Source:NCBI gene;Acc:105354603])

HSP 1 Score: 76.6406 bits (187), Expect = 1.827e-15
Identity = 55/197 (27.92%), Postives = 97/197 (49.24%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTY-VFE----EMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS------GQMVTTVEEELKHNPRLTKSRDE 790
            Y YL+ D+ ++ AI +DP      R  +++K+ +++L  +L TH H DH  G+  L    P+ +          +   V++  E+KF    + C  TP HT G + Y V+E    +    FTGD L I GCG+  F +G A +++  + + + SLP    ++  H+Y+        +V    E++K      ++RD+
Sbjct:   13 YMYLVIDEESKQAIAVDPA--VPHRLLEIVKREELSLTAVLTTHHHWDHARGNEALLKELPDLRVYGGDDRIGGLTDKVTNAQELKFSSINVRCLFTPCHTSGHMCYFVWEDECTDAPAVFTGDTLFIGGCGQ--FFEGTAEQMHYNLTQVLGSLPQDTKVFCGHEYTIKNLKFAMLVEPENEKVKEMLSWARARDD 205          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: pnkd (probable hydrolase PNKD [Source:NCBI gene;Acc:101175554])

HSP 1 Score: 68.1662 bits (165), Expect = 2.068e-12
Identity = 57/201 (28.36%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  221 ISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQL----DVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDV-----AVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMA-----FTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYS-GQMVTTVEEELKHNPRLTK 778
            +S  YSYL+ D ++  A+++DP       D +L++ +       L+ IL TH H DH  G+  LK +     S    Y  A  ++      +S  D VK G        TPGHT G + Y+ +   +      F+GD + + GCGR  F+      L  +    + SL    LL+P H+Y+   ++   E E +++ R  K
Sbjct:  101 LSDNYSYLIVDTTSSVAVVVDPA------DPQLVQAVLEDQGAMLEAILCTHKHWDHSGGNKGLKRL----HSACPVYGSAVDNIPGLTHPLSDKDSVKVGRMHFKALFTPGHTVGHMIYLLDGQAVGAPSSLFSGDLVFLSGCGRM-FEGSSTTMLSSL--DTVASLSDGTLLWPGHEYAEDNLLFAAEVEPRNSTRENK 288          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000065858.1 (SMESG000065858.1)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 257/259 (99.23%), Postives = 257/259 (99.23%), Query Frame = 2
Query:  101 MAIFSILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            MAIFSILKL NRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFI IMNNLNLSYPKQIDKALPANMACGIF
Sbjct:    1 MAIFSILKLPNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFINIMNNLNLSYPKQIDKALPANMACGIF 259          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000066710.1 (SMESG000066710.1)

HSP 1 Score: 201.06 bits (510), Expect = 1.023e-64
Identity = 88/111 (79.28%), Postives = 105/111 (94.59%), Query Frame = 2
Query:  545 LTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPANMACGIF 877
            +TY+F+E+GMAFTGD+LLIRGCGRTDFQ+GDAGKL+D VH+ ILSLP +FLLYPAHDY+GQMVTTV+EELK+NPRLTK+R+EFI IM NLNL+YPKQID+ALPAN+ CGIF
Sbjct:    1 MTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDQALPANLNCGIF 111          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000066719.1 (SMESG000066719.1)

HSP 1 Score: 179.104 bits (453), Expect = 6.110e-56
Identity = 83/115 (72.17%), Postives = 102/115 (88.70%), Query Frame = 2
Query:  185 KSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPG 529
            KS+ +FRQ+FEP+SCTY+YLL DK+ ++AILIDPV+ETV RD KLI QL+VNLK+I+NTHVHADH+TGSGKLKS FP+SKSVISSYS AK DV +  +D V+FG+FKL+CKHTPG
Sbjct:    5 KSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPG 119          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000081975.1 (SMESG000081975.1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.387e-17
Identity = 66/228 (28.95%), Postives = 105/228 (46.05%), Query Frame = 2
Query:  209 VFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKA-KVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGM-------AFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSG---QMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKALPAN 859
            VF+ +S  + Y+L DK T    +IDPV      D    ++L +   +IL TH H DH  G+  L S+  N+ +V+    +   ++  V H D +  G  ++ C  TP HT G + Y F ++          FTGD L I GCGR  F +G   ++Y  + + +  LP    +Y  H+Y+    Q   T+E    +N  + K        ++N   + P  I+  L  N
Sbjct:    5 VFKALSDNFMYILLDKHTNKCAVIDPVEPQKIVDFAQSRKLFIT--YILTTHHHWDHAGGNKVLTSLLENNVTVVGGDDRIDSLNKKVFHKDILNVGNIEIECLFTPCHTSGHMCY-FAKLTQDKVQDYAVFTGDTLFIAGCGR--FFEGTPVQMYHALIEILAVLPYTTKIYCGHEYTVKNLQFALTIE---PNNENIVKKLKWAQDQVSNGYFTVPSTINDELLTN 224          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000028194.1 (SMESG000028194.1)

HSP 1 Score: 51.2174 bits (121), Expect = 5.965e-7
Identity = 44/186 (23.66%), Postives = 87/186 (46.77%), Query Frame = 2
Query:  233 YSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVK---------FGEFKLICKHTPGHTDGCLTYVFEEMG---------MAFTGDALLIRGCGRTDFQ---QGDAGKLYDVVHKYI-LSLPP-YFLLYPAHDYS 721
            Y +++   +++  ++IDP Y      +++I+  ++ L  +L TH H DH  G   + +++PN +   +   K +  V  + ++E+               +   HTPGHT G   Y  E            + FTGDA+ +   G  +F+   + +   L ++V+  I L++P    +++P H+YS
Sbjct:   63 YGFIIWRDNSQRCLIIDPGY--FPPFQEIIENQNLILDSVLITHKHFDHCGGILSIITLYPNVQIFANKKEKIR-QVTTNINNEIHSFTVCVEDYLDPIFITAYHTPGHTIGHTVYTMEVTSDNLDENTSLLVFTGDAIFMGSIG-ANFECSTKVNMTSLRNLVNNLISLNIPANRIMIFPGHEYS 244          
The following BLAST results are available for this feature:
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETHE11.870e-9456.03ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
ETHE14.875e-8854.19ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
HAGHL3.155e-1626.90hydroxyacylglutathione hydrolase like [Source:HGNC... [more]
HAGHL9.234e-1626.90hydroxyacylglutathione hydrolase like [Source:HGNC... [more]
HAGHL1.028e-1527.98hydroxyacylglutathione hydrolase like [Source:HGNC... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ethe-18.382e-8454.22ETHE1 (Human ETHylmalonic Encephalopathy) homolog ... [more]
Y17G7B.35.782e-1730.41pep chromosome:WBcel235:II:11989024:11992823:1 gen... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG300225.210e-8449.60gene:FBgn0050022 transcript:FBtr0289990[more]
tzn3.343e-1628.89gene:FBgn0037024 transcript:FBtr0078252[more]
tzn5.375e-1628.89gene:FBgn0037024 transcript:FBtr0078253[more]
tzn8.818e-1628.89gene:FBgn0037024 transcript:FBtr0078254[more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ethe15.122e-9559.73ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
hagh3.536e-2030.14hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
hagh3.536e-2030.14hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
pnkd3.930e-1026.86PNKD metallo-beta-lactamase domain containing [Sou... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe17.158e-10560.48ethylmalonic encephalopathy 1 [Source:NCBI gene;Ac... [more]
ethe13.403e-10063.11ethylmalonic encephalopathy 1 [Source:NCBI gene;Ac... [more]
hagh1.158e-1630.95hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
hagh1.445e-1630.95hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
hagh1.892e-1630.95hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ethe14.691e-9655.46ethylmalonic encephalopathy 1 [Source:MGI Symbol;A... [more]
Hagh2.901e-1830.00hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
Haghl4.542e-1827.41hydroxyacylglutathione hydrolase-like [Source:MGI ... [more]
Hagh5.276e-1830.00hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
Hagh8.155e-1828.26hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DCM0|ETHE1_MOUSE3.281e-9555.46Persulfide dioxygenase ETHE1, mitochondrial OS=Mus... [more]
sp|Q3T094|ETHE1_BOVIN6.914e-9453.31Persulfide dioxygenase ETHE1, mitochondrial OS=Bos... [more]
sp|O95571|ETHE1_HUMAN8.978e-9456.03Persulfide dioxygenase ETHE1, mitochondrial OS=Hom... [more]
sp|Q9C8L4|ETHE1_ARATH2.638e-8657.45Persulfide dioxygenase ETHE1 homolog, mitochondria... [more]
sp|Q3JRV4|Y2304_BURP12.864e-2430.37Probable metallo-hydrolase BURPS1710b_2304 OS=Burk... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I3651.706e-10463.18persulfide dioxygenase ETHE1, mitochondrial isofor... [more]
A0A267FQS02.851e-10458.53Lactamase_B domain-containing protein (Fragment) O... [more]
A0A1S3I1Y33.040e-10462.34persulfide dioxygenase ETHE1, mitochondrial isofor... [more]
A0A1I8IEW84.927e-10458.53Lactamase_B domain-containing protein OS=Macrostom... [more]
I3PG266.719e-10458.10ETHE1 OS=Urechis unicinctus OX=6432 PE=2 SV=1[more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe12.615e-6849.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe13.700e-6849.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe11.396e-6749.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe17.070e-6348.20ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
hagh1.727e-1929.86hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ethe17.831e-9656.91ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
pnkd5.592e-1326.76PNKD metallo-beta-lactamase domain containing [Sou... [more]
LACTB22.048e-627.91lactamase beta 2 [Source:HGNC Symbol;Acc:HGNC:1851... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GLO42.839e-1429.47Mitochondrial glyoxalase II; catalyzes the hydroly... [more]
GLO26.434e-1429.17Cytoplasmic glyoxalase II; catalyzes the hydrolysi... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420134.372e-8656.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298202.392e-4951.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479152.179e-1730.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444244.778e-1627.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279174.798e-1631.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe11.648e-9554.98ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc... [more]
ethe11.184e-8857.21ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc... [more]
hagh7.870e-2129.00hydroxyacylglutathione hydrolase, mitochondrial [S... [more]
HAGHL1.827e-1527.92hydroxyacylglutathione hydrolase-like protein [Sou... [more]
pnkd2.068e-1228.36probable hydrolase PNKD [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065858.10.000e+099.23SMESG000065858.1[more]
SMESG000066710.11.023e-6479.28SMESG000066710.1[more]
SMESG000066719.16.110e-5672.17SMESG000066719.1[more]
SMESG000081975.13.387e-1728.95SMESG000081975.1[more]
SMESG000028194.15.965e-723.66SMESG000028194.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011723 ID=SMED30011723|Name=persulfide dioxygenase ETHE1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1077bp
TATGAAGAGCTTAAGAATGCACTAATTATTCTTAACTGTCTGAATTATTA
AGTACTTTTATATTATATATTTTAGTTTTAAAATTTACAAATTGAAATAG
ATGGCCATTTTTTCTATTTTAAAATTATCAAATAGATTTATTCATTCTTC
ATTAAGATTTTGTTGCCAACATCAGCATTCAAATAAATCCAATTTAATAT
TCAGACAAGTTTTTGAACCAATTTCATGTACATATTCTTATTTGTTAGCT
GATAAATCTACACGGGACGCTATTCTAATTGATCCAGTTTATGAAACTGT
TGAAAGGGATAAGAAATTGATCAAGCAATTGGATGTTAATCTGAAATTTA
TACTTAATACTCATGTCCATGCTGATCATGTCACTGGGAGTGGGAAATTG
AAATCGATATTTCCTAATAGTAAAAGTGTCATTAGTTCCTACAGTAAAGC
CAAAGTTGATGTTGCTGTATCTCATGACGATGAGGTTAAATTTGGCGAGT
TTAAACTGATATGCAAACATACACCAGGCCATACAGATGGTTGTTTGACA
TATGTTTTTGAAGAAATGGGAATGGCTTTCACTGGAGATGCATTACTTAT
TCGTGGATGTGGTCGAACGGATTTTCAGCAAGGTGACGCTGGGAAATTAT
ACGATGTAGTGCATAAATACATTTTAAGTCTTCCACCTTATTTCCTGCTT
TATCCAGCTCATGATTACAGTGGACAAATGGTAACGACTGTTGAAGAGGA
ATTAAAGCACAATCCTCGTTTAACTAAATCACGAGATGAGTTTATTACCA
TAATGAATAATTTAAATTTGTCTTATCCAAAGCAAATTGACAAAGCTTTA
CCTGCTAACATGGCTTGTGGAATCTTTTAACCGATATTATTTCGTGATTG
ATGTTATCAGTGGAACTGTTCTTTTATATGTTTTAGCTGAAGGGTTTTTT
CTGTAACATCTTGAAATTTTAATACAAATTGATTAATAATGAAAAATATA
GTTTTAAACTTTCAAATATTGAAATAAAATTGAAAAGAATGTGAAATATT
AATATTTTTTATTAATTGAAATATGAA
back to top

protein sequence of SMED30011723-orf-1

>SMED30011723-orf-1 ID=SMED30011723-orf-1|Name=SMED30011723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MAIFSILKLSNRFIHSSLRFCCQHQHSNKSNLIFRQVFEPISCTYSYLLA
DKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKL
KSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLT
YVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLL
YPAHDYSGQMVTTVEEELKHNPRLTKSRDEFITIMNNLNLSYPKQIDKAL
PANMACGIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036866RibonucZ/Hydroxyglut_hydro
IPR001279Metallo-B-lactamas
Vocabulary: molecular function
TermDefinition
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001279Metallo-beta-lactamaseSMARTSM00849Lactamase_B_5acoord: 43..204
e-value: 2.2E-25
score: 100.3
IPR001279Metallo-beta-lactamasePFAMPF00753Lactamase_Bcoord: 45..185
e-value: 6.4E-15
score: 55.7
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeGENE3DG3DSA:3.60.15.10coord: 27..258
e-value: 2.5E-79
score: 267.5
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeSUPERFAMILYSSF56281Metallo-hydrolase/oxidoreductasecoord: 37..257
NoneNo IPR availablePANTHERPTHR43084FAMILY NOT NAMEDcoord: 22..258
NoneNo IPR availablePANTHERPTHR43084:SF1PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIALcoord: 22..258
NoneNo IPR availableCDDcd07724POD-like_MBL-foldcoord: 33..206
e-value: 8.43807E-76
score: 226.127