Splicing factor, arginine/serine-rich 6

Overview
NameSplicing factor, arginine/serine-rich 6
Smed IDSMED30011715
Length (bp)606
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor, arginine/serine-rich 6 (SMED30011715) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor, arginine/serine-rich 6 (SMED30011715) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor, arginine/serine-rich 6 (SMED30011715) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor, arginine/serine-rich 6 (SMED30011715) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011715

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011715SMESG000041210.1 SmedASXL_008449SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011715SMESG000041210.1 SmedASXL_008449SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011715SMESG000041210.1 dd_Smed_v4_1177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011715SMESG000041210.1 Contig48012newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011715SMESG000041210.1 Contig48012uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 66.2402 bits (160), Expect = 1.755e-13
Identity = 31/85 (36.47%), Postives = 52/85 (61.18%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   +G++  G R++VE  R  RRD   Y  GS
Sbjct:    4 VYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNG----YGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGS 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Match: SRSF4 (serine and arginine rich splicing factor 4 [Source:HGNC Symbol;Acc:HGNC:10786])

HSP 1 Score: 65.4698 bits (158), Expect = 4.110e-12
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRG 350
            MP    +++GRL+ + +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+   +G+D  G R++VE  R  RRD GSY  G
Sbjct:    1 MP---RVYIGRLSYQARERDVERFFKGYGKILEVDLKNG----YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRD-GSYGSG 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Match: SRSF4 (serine and arginine rich splicing factor 4 [Source:HGNC Symbol;Acc:HGNC:10786])

HSP 1 Score: 65.4698 bits (158), Expect = 4.316e-12
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRG 350
            MP    +++GRL+ + +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+   +G+D  G R++VE  R  RRD GSY  G
Sbjct:    1 MP---RVYIGRLSYQARERDVERFFKGYGKILEVDLKNG----YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRD-GSYGSG 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 62.3882 bits (150), Expect = 1.914e-11
Identity = 30/83 (36.14%), Postives = 51/83 (61.45%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            MP    +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   +G++  G R++VE  R  RRD
Sbjct:    1 MP---RVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNG----YGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRD 76          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 62.7734 bits (151), Expect = 2.310e-11
Identity = 28/77 (36.36%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   +G++  G R++VE  R  RRD
Sbjct:    4 VYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNG----YGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRD 76          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-14
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-14
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-14
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-14
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-14
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Match: SF2 (gene:FBgn0283477 transcript:FBtr0083272)

HSP 1 Score: 61.2326 bits (147), Expect = 2.853e-11
Identity = 27/76 (35.53%), Postives = 49/76 (64.47%), Query Frame = 3
Query:   87 NTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            N   ++VG L   ++  D++++F ++G++   D+K      FAF++++D RDA+DA+K  DG D+ G R+ VE+ R
Sbjct:    5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGYRLRVEFPR 80          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Match: SF2 (gene:FBgn0283477 transcript:FBtr0304727)

HSP 1 Score: 61.2326 bits (147), Expect = 2.853e-11
Identity = 27/76 (35.53%), Postives = 49/76 (64.47%), Query Frame = 3
Query:   87 NTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            N   ++VG L   ++  D++++F ++G++   D+K      FAF++++D RDA+DA+K  DG D+ G R+ VE+ R
Sbjct:    5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGYRLRVEFPR 80          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0082804)

HSP 1 Score: 50.447 bits (119), Expect = 6.892e-8
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDA 332
            ++VG L   V+  D+E  F  YGR     +K G    + F++++D RDA+DA+   +G++ +G R+VVE  R + R +
Sbjct:    6 VYVGGLPYGVRERDLERFFKGYGRTRDILIKNG----YGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGS 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0300588)

HSP 1 Score: 50.447 bits (119), Expect = 6.892e-8
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDA 332
            ++VG L   V+  D+E  F  YGR     +K G    + F++++D RDA+DA+   +G++ +G R+VVE  R + R +
Sbjct:    6 VYVGGLPYGVRERDLERFFKGYGRTRDILIKNG----YGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGS 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0300586)

HSP 1 Score: 49.6766 bits (117), Expect = 8.663e-8
Identity = 27/79 (34.18%), Postives = 46/79 (58.23%), Query Frame = 3
Query:   96 HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDA 332
             ++VG L   V+  D+E  F  YGR     +K G    + F++++D RDA+DA+   +G++ +G R+VVE  R + R +
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNG----YGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGS 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 65.855 bits (159), Expect = 5.938e-14
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGS 338
            ++VG+L+ R +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G+D  G R++VE T   RRD G+
Sbjct:    4 VYVGKLSYRAREKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKDLCGKRVIVEHTIGQRRDGGN 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 66.6254 bits (161), Expect = 8.639e-13
Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 3
Query:   96 HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGS 338
             ++VG+L+ R +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G+D  G R++VE T   RRD G+
Sbjct:    3 RVYVGKLSYRAREKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKDLCGKRVIVEHTIGQRRDGGN 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Match: srsf5b (serine and arginine rich splicing factor 5b [Source:ZFIN;Acc:ZDB-GENE-040718-354])

HSP 1 Score: 60.8474 bits (146), Expect = 1.553e-11
Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:    6 IFIGRLNPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Match: srsf5b (serine and arginine rich splicing factor 5b [Source:ZFIN;Acc:ZDB-GENE-040718-354])

HSP 1 Score: 62.3882 bits (150), Expect = 1.819e-11
Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:    6 IFIGRLNPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Match: srsf5b (serine and arginine rich splicing factor 5b [Source:ZFIN;Acc:ZDB-GENE-040718-354])

HSP 1 Score: 60.077 bits (144), Expect = 2.271e-11
Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:   13 IFIGRLNPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 80          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 66.2402 bits (160), Expect = 2.307e-12
Identity = 32/83 (38.55%), Postives = 52/83 (62.65%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            MP    +++GRL+ R +  DVE  F  +G++   D+K G    + F++++D RDAEDA+   +GR+  G R++VE  R+ RRD
Sbjct:    6 MP---RVYIGRLSHRARERDVERFFKGFGKIVEVDLKNG----YGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARAPRRD 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 66.2402 bits (160), Expect = 2.317e-12
Identity = 32/83 (38.55%), Postives = 52/83 (62.65%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            MP    +++GRL+ R +  DVE  F  +G++   D+K G    + F++++D RDAEDA+   +GR+  G R++VE  R+ RRD
Sbjct:    6 MP---RVYIGRLSHRARERDVERFFKGFGKIVEVDLKNG----YGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARAPRRD 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Match: srsf6 (serine/arginine-rich splicing factor 6 [Source:NCBI gene;Acc:407954])

HSP 1 Score: 65.0846 bits (157), Expect = 5.402e-12
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            MP    +++GRL   V+  D++  FG YG++   D+K G    + F++++D RDA+DA+   +G+D  G R++VE  R  RRD   Y  GS
Sbjct:    1 MP---RVYIGRLGYHVREKDIQRFFGGYGKLLEVDLKNG----YGFVEFEDSRDADDAVYELNGKDLCGERVIVEHARGPRRDRDGYGYGS 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Match: srsf5 (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:448003])

HSP 1 Score: 57.7658 bits (138), Expect = 2.878e-10
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDA+DA+   DG++    R+ +E  R
Sbjct:    6 VFIGRLNPAAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDADDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Match: srsf5 (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:448003])

HSP 1 Score: 57.3806 bits (137), Expect = 3.188e-10
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 3
Query:   96 HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
             +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDA+DA+   DG++    R+ +E  R
Sbjct:    5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDADDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Match: Srsf6 (serine/arginine-rich splicing factor 6 [Source:MGI Symbol;Acc:MGI:1915246])

HSP 1 Score: 63.929 bits (154), Expect = 7.564e-13
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   + ++  G R++VE  R  RRD   Y  GS
Sbjct:    4 VYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNG----YGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGS 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Match: Srsf6 (serine/arginine-rich splicing factor 6 [Source:MGI Symbol;Acc:MGI:1915246])

HSP 1 Score: 63.929 bits (154), Expect = 7.564e-13
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   + ++  G R++VE  R  RRD   Y  GS
Sbjct:    4 VYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNG----YGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGS 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Match: Srsf4 (serine/arginine-rich splicing factor 4 [Source:MGI Symbol;Acc:MGI:1890577])

HSP 1 Score: 65.4698 bits (158), Expect = 3.186e-12
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRG 350
            MP    +++GRL+ + +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+   +G+D  G R++VE  R  RRD GSY  G
Sbjct:    1 MPR---VYIGRLSYQARERDVERFFKGYGKILEVDLKNG----YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRD-GSYGSG 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Match: Srsf6 (serine/arginine-rich splicing factor 6 [Source:MGI Symbol;Acc:MGI:1915246])

HSP 1 Score: 60.4622 bits (145), Expect = 1.243e-10
Identity = 27/77 (35.06%), Postives = 48/77 (62.34%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            +++GRL+  V+  D++  F  YGR+   D+K G    + F++++D RDA+DA+   + ++  G R++VE  R  RRD
Sbjct:    4 VYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNG----YGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRD 76          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Match: Hnrnpc (heterogeneous nuclear ribonucleoprotein C [Source:MGI Symbol;Acc:MGI:107795])

HSP 1 Score: 54.299 bits (129), Expect = 7.472e-10
Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 3
Query:   99 LFVGRLNKRV-KVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMG 287
            +F+G LN  V K SDVE IF +YG++  C V  G    FAF+ Y ++R+A  A+  EDGR   G
Sbjct:   18 VFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKG----FAFVQYVNERNARAAVAGEDGRMIAG 77          
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Match: sp|Q9NEW6|RSP3_CAEEL (Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans OX=6239 GN=rsp-3 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.613e-13
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   81 MPNTG----HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            MP  G     ++VG L   V+  +VE+IF +YGR+   D+K G   AFAF++++D RDAEDA++  DG +F G RI VE+T
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFT 81          
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Match: sp|Q9FYB7|RSZ32_ARATH (Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana OX=3702 GN=RS2Z32 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.781e-12
Identity = 39/85 (45.88%), Postives = 55/85 (64.71%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            L+VGRL+ R +  D+E +F +YGR+   D+K      +AF+++ D RDA+DA    DGRDF G+RI VE +R + R  GS D GS
Sbjct:   13 LYVGRLSSRTRTRDLERLFSRYGRVRDVDMK----RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASRGAPR--GSRDNGS 91          
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Match: sp|Q8VYA5|RSZ33_ARATH (Serine/arginine-rich splicing factor RS2Z33 OS=Arabidopsis thaliana OX=3702 GN=RS2Z33 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.645e-12
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYD 344
            L+VGRL+ R +  D+E +F +YGR+   D+K      +AF+++ D RDA+DA    DGRDF G+RI VE++R + R +  +D
Sbjct:   13 LYVGRLSSRTRTRDLERLFSRYGRVRDVDMK----RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSRGAPRGSRDFD 90          
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Match: sp|Q8VE97|SRSF4_MOUSE (Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.611e-11
Identity = 34/84 (40.48%), Postives = 53/84 (63.10%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRG 350
            +++GRL+ + +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+   +G+D  G R++VE  R  RRD GSY  G
Sbjct:    4 VYIGRLSYQARERDVERFFKGYGKILEVDLKNG----YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRD-GSYGSG 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Match: sp|Q08170|SRSF4_HUMAN (Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.974e-11
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRG 350
            MP    +++GRL+ + +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+   +G+D  G R++VE  R  RRD GSY  G
Sbjct:    1 MP---RVYIGRLSYQARERDVERFFKGYGKILEVDLKNG----YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRD-GSYGSG 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Match: A0A210PFW5 (Serine/arginine-rich splicing factor RS2Z32 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18436 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.544e-25
Identity = 48/87 (55.17%), Postives = 68/87 (78.16%), Query Frame = 3
Query:   93 GHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGS 353
            G LFVGRL+K  +V D+E++F  YGR+ RC+VKYG +MA+AF+D++D+RDAEDA+K E+GR+  G+ IVVEW + +RR  G+  RG 
Sbjct:    6 GQLFVGRLSKSTRVRDLEDVFEAYGRLARCEVKYGAEMAYAFVDFEDRRDAEDAIKYENGREISGSGIVVEWAKGNRR-GGTVSRGQ 91          
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Match: A0A210Q3A0 (Serine/arginine-rich splicing factor RS2Z32 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18832 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.199e-25
Identity = 49/84 (58.33%), Postives = 65/84 (77.38%), Query Frame = 3
Query:   75 LSMPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRR 326
            +S  N G LFVGRLNKR  V D+E++F  YGRM RC+VKYG +MA+AF+D++DKRDAEDA+K E+GRD  G+ I+VE  + + R
Sbjct:    1 MSRRNEGQLFVGRLNKRTTVRDLEDVFEPYGRMTRCEVKYGAEMAYAFVDFEDKRDAEDAIKYENGRDVAGSSIIVELAKGASR 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Match: A0A2R2MIR6 (probable splicing factor, arginine/serine-rich 6 OS=Lingula unguis OX=7574 GN=LOC106173121 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.152e-24
Identity = 47/90 (52.22%), Postives = 66/90 (73.33%), Query Frame = 3
Query:   75 LSMPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYD 344
            +S    G LFVGRL++  +  D+EEIF  YGRM RC++KYG +MA+AF+DY+D+RDAEDA+K E+GR+  G+ I+VEW + + R    YD
Sbjct:    1 MSRRAEGMLFVGRLSRSTRTRDLEEIFEPYGRMLRCEIKYGAEMAYAFVDYEDRRDAEDAVKYENGREVCGSSIIVEWAKGNPRRPLGYD 90          
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Match: R7UQC3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222188 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.653e-23
Identity = 44/84 (52.38%), Postives = 64/84 (76.19%), Query Frame = 3
Query:   75 LSMPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRR 326
            +S  + G LF+GRL+K  +  D+E+ F +YGR+ RCDVKYG +MA+AF+D++D RDAEDALK E+GR++ G  +VVEW + + R
Sbjct:    1 MSRRSQGSLFIGRLDKHTRTRDLEDRFEKYGRILRCDVKYGAEMAYAFLDFEDHRDAEDALKEENGREYQGVSMVVEWAKGAPR 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Match: B7QA59 (Alternative splicing factor SRp20/9G8, putative OS=Ixodes scapularis OX=6945 GN=8038186 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.459e-23
Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            M   G LF+GRL    +  DVE++F +YGR+ RCDVKYG  MA+AF+DY+D RDAEDA+K E+GR+  G  +VVEW R
Sbjct:    1 MSGRGQLFIGRLPLECRERDVEQVFERYGRLLRCDVKYGTGMAYAFVDYEDHRDAEDAVKYENGREIRGQSVVVEWAR 78          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 67.781 bits (164), Expect = 8.173e-15
Identity = 32/80 (40.00%), Postives = 54/80 (67.50%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGS 338
            +++G+L+ RVK  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G++  G R++VE T+  RRD G+
Sbjct:    4 IYIGKLSYRVKEKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKNLCGERVLVEHTKGPRRDGGN 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 68.9366 bits (167), Expect = 6.201e-14
Identity = 34/86 (39.53%), Postives = 56/86 (65.12%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGSN 356
            +++G+L+ RVK  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G++  G R++VE T+  RRD G+    SN
Sbjct:    4 IYIGKLSYRVKEKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKNLCGERVLVEHTKGPRRDGGNNSGRSN 85          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 68.9366 bits (167), Expect = 9.582e-14
Identity = 32/79 (40.51%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAG 335
            +++G+L+ RVK  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G++  G R++VE T+  RRD G
Sbjct:    4 IYIGKLSYRVKEKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKNLCGERVLVEHTKGPRRDGG 78          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 60.4622 bits (145), Expect = 1.574e-11
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:   96 HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
             +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:    5 RIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 62.003 bits (149), Expect = 2.005e-11
Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRLN   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:    6 IFIGRLNPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010377.1 (pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene:ENSPMAG00000009397.1 transcript:ENSPMAT00000010377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.008e-11
Identity = 28/77 (36.36%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRD 329
            +++G L+ R +  D+E  F  YG++    +K+G    F F+++DD RDA DA+    GR+  G R+V+E  R  +RD
Sbjct:    4 IYLGNLSYRARDKDIERFFKGYGKIVEISIKHG----FGFVEFDDTRDANDAVCELSGRELCGERVVIEHARGPKRD 76          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Match: SRSF5 (serine and arginine rich splicing factor 5 [Source:HGNC Symbol;Acc:HGNC:10787])

HSP 1 Score: 60.4622 bits (145), Expect = 1.692e-11
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSR 323
            +F+ RL   V+  DVE+ F  YG++   D+K G    F F+++DD RDA+DA+ + +GR+    R+ VE  R+ R
Sbjct:    7 VFIARLGPHVRTKDVEKFFKGYGKIRDIDIKAG----FGFVEFDDCRDADDAVSDLNGRELNNERMTVEHARAPR 77          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Match: srsf3a (serine and arginine rich splicing factor 3a [Source:ZFIN;Acc:ZDB-GENE-030616-631])

HSP 1 Score: 53.1434 bits (126), Expect = 2.672e-9
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 3
Query:   54 SIPISIQLSMPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGS 338
            S PI++  + P    ++VG L      +++E  F  YG +    V       FAF++++D RDA DA++  DGR   G+R+ VE +    R+ G 
Sbjct:    2 SPPIAMSANCPLDCKVYVGNLGNNGNKAELERSFSYYGPLRSVWVARA-PPGFAFVEFEDPRDAGDAVRELDGRTLCGSRVRVEHSSGRSRNRGP 95          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Match: srsf7a (serine and arginine rich splicing factor 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1798])

HSP 1 Score: 51.6026 bits (122), Expect = 1.036e-8
Identity = 28/67 (41.79%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  105 VGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVE 305
            VG L  R    ++ + FG YG +    V   N  A AF++Y+D RDAEDA++  DGR   G+R+ VE
Sbjct:    1 VGNLGTRAAKGELWQAFGYYGALRNVWVAR-NPPAVAFVEYEDTRDAEDAVRGLDGRLLCGSRVSVE 66          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Match: srsf7a (serine and arginine rich splicing factor 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1798])

HSP 1 Score: 51.6026 bits (122), Expect = 1.398e-8
Identity = 28/67 (41.79%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  105 VGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVE 305
            VG L  R    ++ + FG YG +    V   N  A AF++Y+D RDAEDA++  DGR   G+R+ VE
Sbjct:    1 VGNLGTRAAKGELWQAFGYYGALRNVWVAR-NPPAVAFVEYEDTRDAEDAVRGLDGRLLCGSRVSVE 66          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Match: EDO49132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY6])

HSP 1 Score: 81.2629 bits (199), Expect = 1.910e-19
Identity = 38/77 (49.35%), Postives = 54/77 (70.13%), Query Frame = 3
Query:   96 HLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRR 326
             LFVGRL+K  K+ D+E +F  YG++ RCD+K     A+ FI+Y+D RDAE+A++ E+ R   G+RIVVE+ RS  R
Sbjct:    7 QLFVGRLSKETKLRDLENVFYLYGKLLRCDLK----TAYGFIEYEDPRDAEEAMRRENNRKLFGSRIVVEYVRSGER 79          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Match: EDO39290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ5])

HSP 1 Score: 67.3958 bits (163), Expect = 3.415e-14
Identity = 34/83 (40.96%), Postives = 55/83 (66.27%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDR 347
            +F+GRL + V+ SDVE+    YG++    +K G    + F+++DD RDAEDA+ + +GRD +G R+VVE+++  R + G  DR
Sbjct:    4 IFLGRLPRDVRESDVEKFLRGYGKIRDISLKRG----YGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGRRSEGGGRDR 82          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Match: EDO44646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI6])

HSP 1 Score: 63.1586 bits (152), Expect = 2.242e-12
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 3
Query:   87 NTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVK--YGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            N   ++VG L + V+  D+ +IF +YG +   D+K   G    FAF++++D RDAEDA+K  DG +F G RI VE+ R
Sbjct:    7 NDCRVYVGNLPQDVREKDLHDIFYKYGHIADVDLKNRRGAGPPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVEFPR 84          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Match: EDO32443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV28])

HSP 1 Score: 52.373 bits (124), Expect = 8.857e-9
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRR 326
            M  +  ++ GRL +  +  D+E+    YGR+    +K G    + F+++DD RDA+D + + +GR+ +G R+VVE +R+  R
Sbjct:    1 MSRSTRVYFGRLPRDCRERDLEKFVRGYGRVREISMKLG----YGFVEFDDYRDADDCVYDLNGRNLLGERVVVEHSRNPSR 78          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Match: EDO30175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1I7])

HSP 1 Score: 49.6766 bits (117), Expect = 1.848e-8
Identity = 27/74 (36.49%), Postives = 44/74 (59.46%), Query Frame = 3
Query:   90 TGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWT 311
            T  L+VG L +    S++E  F ++GR+ +  V   N   FAF++Y+D RDAE+A++  DG +     I VE++
Sbjct:    2 TTKLYVGNLGRNADSSELERAFEKFGRLSKVWVA-RNPPGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 74          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Match: ENSORLT00000041317.1 (pep primary_assembly:ASM223467v1:11:19753162:19757146:1 gene:ENSORLG00000028783.1 transcript:ENSORLT00000041317.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.696e-11
Identity = 27/72 (37.50%), Postives = 48/72 (66.67%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +++GRL+ R +  DVE  F  YG++   D+K G    + F+++DD RDA+DA+ + +G++  G R++VE T+
Sbjct:    4 VYIGRLSYRAREKDVERFFKGYGKILEVDLKNG----YGFVEFDDPRDADDAVYDLNGKELCGERVIVEHTK 71          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Match: srsf5b (serine/arginine-rich splicing factor 5-like [Source:NCBI gene;Acc:105357348])

HSP 1 Score: 60.8474 bits (146), Expect = 7.675e-11
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR 314
            +F+GRL+   +  DVE  F  YGR+   D+K G    F F+++DD RDAEDA+   DG++    R+ +E  R
Sbjct:    6 IFIGRLSPSAREKDVERFFKGYGRIRDIDLKRG----FGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 59.6918 bits (143), Expect = 1.255e-10
Identity = 27/73 (36.99%), Postives = 47/73 (64.38%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRS 317
            +F+GRL+ + +  DVE+ F  YGR+   ++K G    F F+++DD RDA+DA+   +G++ +  R+ +E  RS
Sbjct:    6 VFIGRLSPQARERDVEKFFKGYGRIREINLKNG----FGFVEFDDHRDADDAVYELNGKELLSERVTIEHARS 74          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 58.9214 bits (141), Expect = 3.132e-10
Identity = 27/73 (36.99%), Postives = 47/73 (64.38%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRS 317
            +F+GRL+ + +  DVE+ F  YGR+   ++K G    F F+++DD RDA+DA+   +G++ +  R+ +E  RS
Sbjct:    6 VFIGRLSPQARERDVEKFFKGYGRIREINLKNG----FGFVEFDDHRDADDAVYELNGKELLSERVTIEHARS 74          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 58.9214 bits (141), Expect = 3.132e-10
Identity = 27/73 (36.99%), Postives = 47/73 (64.38%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRS 317
            +F+GRL+ + +  DVE+ F  YGR+   ++K G    F F+++DD RDA+DA+   +G++ +  R+ +E  RS
Sbjct:    6 VFIGRLSPQARERDVEKFFKGYGRIREINLKNG----FGFVEFDDHRDADDAVYELNGKELLSERVTIEHARS 74          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Match: SMESG000041210.1 (SMESG000041210.1)

HSP 1 Score: 191.045 bits (484), Expect = 1.197e-62
Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGSN 356
            MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGSN
Sbjct:    1 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGSN 92          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Match: SMESG000077573.1 (SMESG000077573.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.677e-12
Identity = 29/81 (35.80%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   99 LFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSY 341
            L+VG L   ++  D++++F ++G++   D+K      FAFI++DD RDAEDA+   +G ++ G R+ VE+ R +  +AG++
Sbjct:   12 LYVGNLPPDIRHRDLDDLFYKFGKIVDIDIKDRKKPPFAFIEFDDPRDAEDAVTGRNGYNYDGYRLRVEFPRGNNENAGNF 92          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Match: SMESG000045501.1 (SMESG000045501.1)

HSP 1 Score: 64.3142 bits (155), Expect = 4.124e-12
Identity = 32/80 (40.00%), Postives = 51/80 (63.75%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTRSS 320
            MP    L+VG L +R++  D+++ F +YGR+   D+K G    + F++ DD+RDAEDA+ + DG   +G R+ VE  RS+
Sbjct:    1 MP---RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNG----YGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSN 73          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Match: SMESG000013050.1 (SMESG000013050.1)

HSP 1 Score: 62.7734 bits (151), Expect = 6.008e-12
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR---SSRRDAGSYDRGSN 356
            M N   ++VG L       D+E++F  +G++   D+K  N   FAFI +DD+RDAEDA++  D  D  G  + VE+ R    +++D   Y R  N
Sbjct:    1 MSNERKIYVGNLPPDSTSRDIEKLFSCFGKIIDIDIKNRNGPPFAFIQFDDRRDAEDAIRERDNYDLDGFSLRVEFPREIKQNKKDYKEYSRFEN 95          
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Match: SMESG000013050.1 (SMESG000013050.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.223e-11
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query:   81 MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYDDKRDAEDALKNEDGRDFMGTRIVVEWTR---SSRRDAGSYDRGSN 356
            M N   ++VG L       D+E++F  +G++   D+K  N   FAFI +DD+RDAEDA++  D  D  G  + VE+ R    +++D   Y R  N
Sbjct:    1 MSNERKIYVGNLPPDSTSRDIEKLFSCFGKIIDIDIKNRNGPPFAFIQFDDRRDAEDAIRERDNYDLDGFSLRVEFPREIKQNKKDYKEYSRFEN 95          
The following BLAST results are available for this feature:
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF61.755e-1336.47serine and arginine rich splicing factor 6 [Source... [more]
SRSF44.110e-1240.00serine and arginine rich splicing factor 4 [Source... [more]
SRSF44.316e-1240.00serine and arginine rich splicing factor 4 [Source... [more]
SRSF61.914e-1136.14serine and arginine rich splicing factor 6 [Source... [more]
SRSF62.310e-1136.36serine and arginine rich splicing factor 6 [Source... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-32.054e-1445.68Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-32.054e-1445.68Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-32.054e-1445.68Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-32.054e-1445.68Probable splicing factor, arginine/serine-rich 3 ... [more]
rsp-32.054e-1445.68Probable splicing factor, arginine/serine-rich 3 ... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF22.853e-1135.53gene:FBgn0283477 transcript:FBtr0083272[more]
SF22.853e-1135.53gene:FBgn0283477 transcript:FBtr0304727[more]
B526.892e-834.62gene:FBgn0004587 transcript:FBtr0082804[more]
B526.892e-834.62gene:FBgn0004587 transcript:FBtr0300588[more]
B528.663e-834.18gene:FBgn0004587 transcript:FBtr0300586[more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf45.938e-1440.00serine and arginine rich splicing factor 4 [Source... [more]
srsf48.639e-1339.51serine and arginine rich splicing factor 4 [Source... [more]
srsf5b1.553e-1141.67serine and arginine rich splicing factor 5b [Sourc... [more]
srsf5b1.819e-1141.67serine and arginine rich splicing factor 5b [Sourc... [more]
srsf5b2.271e-1141.67serine and arginine rich splicing factor 5b [Sourc... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm62.307e-1238.55glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
grm62.317e-1238.55glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
srsf65.402e-1237.36serine/arginine-rich splicing factor 6 [Source:NCB... [more]
srsf52.878e-1040.28serine/arginine-rich splicing factor 5 [Source:NCB... [more]
srsf53.188e-1039.73serine/arginine-rich splicing factor 5 [Source:NCB... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srsf67.564e-1335.29serine/arginine-rich splicing factor 6 [Source:MGI... [more]
Srsf67.564e-1335.29serine/arginine-rich splicing factor 6 [Source:MGI... [more]
Srsf43.186e-1240.00serine/arginine-rich splicing factor 4 [Source:MGI... [more]
Srsf61.243e-1035.06serine/arginine-rich splicing factor 6 [Source:MGI... [more]
Hnrnpc7.472e-1045.31heterogeneous nuclear ribonucleoprotein C [Source:... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NEW6|RSP3_CAEEL2.613e-1345.68Probable splicing factor, arginine/serine-rich 3 O... [more]
sp|Q9FYB7|RSZ32_ARATH1.781e-1245.88Serine/arginine-rich splicing factor RS2Z32 OS=Ara... [more]
sp|Q8VYA5|RSZ33_ARATH2.645e-1242.68Serine/arginine-rich splicing factor RS2Z33 OS=Ara... [more]
sp|Q8VE97|SRSF4_MOUSE1.611e-1140.48Serine/arginine-rich splicing factor 4 OS=Mus musc... [more]
sp|Q08170|SRSF4_HUMAN1.974e-1140.00Serine/arginine-rich splicing factor 4 OS=Homo sap... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PFW54.544e-2555.17Serine/arginine-rich splicing factor RS2Z32 OS=Miz... [more]
A0A210Q3A05.199e-2558.33Serine/arginine-rich splicing factor RS2Z32 OS=Miz... [more]
A0A2R2MIR65.152e-2452.22probable splicing factor, arginine/serine-rich 6 O... [more]
R7UQC31.653e-2352.38Uncharacterized protein OS=Capitella teleta OX=283... [more]
B7QA593.459e-2356.41Alternative splicing factor SRp20/9G8, putative OS... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf48.173e-1540.00serine and arginine rich splicing factor 4 [Source... [more]
srsf46.201e-1439.53serine and arginine rich splicing factor 4 [Source... [more]
srsf49.582e-1440.51serine and arginine rich splicing factor 4 [Source... [more]
srsf5b1.574e-1141.10serine/arginine-rich splicing factor 5 [Source:NCB... [more]
srsf5b2.005e-1141.67serine/arginine-rich splicing factor 5 [Source:NCB... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010377.11.008e-1136.36pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene... [more]
SRSF51.692e-1138.67serine and arginine rich splicing factor 5 [Source... [more]
srsf3a2.672e-931.58serine and arginine rich splicing factor 3a [Sourc... [more]
srsf7a1.036e-841.79serine and arginine rich splicing factor 7a [Sourc... [more]
srsf7a1.398e-841.79serine and arginine rich splicing factor 7a [Sourc... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491321.910e-1949.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392903.415e-1440.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446462.242e-1242.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324438.857e-932.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301751.848e-836.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041317.12.696e-1137.50pep primary_assembly:ASM223467v1:11:19753162:19757... [more]
srsf5b7.675e-1140.28serine/arginine-rich splicing factor 5-like [Sourc... [more]
srsf5a1.255e-1036.99serine and arginine rich splicing factor 5 [Source... [more]
srsf5a3.132e-1036.99serine and arginine rich splicing factor 5 [Source... [more]
srsf5a3.132e-1036.99serine and arginine rich splicing factor 5 [Source... [more]
back to top
BLAST of Splicing factor, arginine/serine-rich 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041210.11.197e-62100.00SMESG000041210.1[more]
SMESG000077573.13.677e-1235.80SMESG000077573.1[more]
SMESG000045501.14.124e-1240.00SMESG000045501.1[more]
SMESG000013050.16.008e-1235.79SMESG000013050.1[more]
SMESG000013050.11.223e-1135.79SMESG000013050.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011715 ID=SMED30011715|Name=Splicing factor, arginine/serine-rich 6|organism=Schmidtea mediterranea sexual|type=transcript|length=606bp
AGATTTTATAATAAAAATTTTGTTTAAATAATTGTATCCATTTTAATTTT
GTTTCGATTCCTATATCCATACAGTTATCAATGCCTAACACTGGACATCT
TTTTGTTGGTAGGTTAAATAAACGTGTTAAAGTTTCAGATGTTGAAGAAA
TTTTTGGTCAGTATGGAAGAATGTGCCGATGTGATGTAAAATATGGAAAT
GATATGGCTTTTGCATTTATTGACTATGATGATAAAAGAGACGCCGAGGA
TGCTTTGAAAAATGAAGATGGGAGAGATTTTATGGGAACAAGGATTGTAG
TGGAATGGACTAGATCTTCTAGAAGAGATGCTGGTAGCTATGATAGGGGT
AGTAATCGTGGAGGTTATGATAGAAGGGAACGTGATAGATATCGTGACCG
GGATAGTGGTAGGGACAAATATAGAGGAGATTCTCGCAGAAGACGATCAT
ATACAAGATCAAGAAGTCGATAAGATACATTAATGTCAATATTTGCATTT
ATGTTTTATGTTTCATAATGAAATAAATACTGTTTTTATTGTTTTATAAT
CATTATTGTAAAATTAAAAGTGTGATTATGTATTATTATAAATTTCAATA
AAGTTT
back to top

protein sequence of SMED30011715-orf-1

>SMED30011715-orf-1 ID=SMED30011715-orf-1|Name=SMED30011715-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MPNTGHLFVGRLNKRVKVSDVEEIFGQYGRMCRCDVKYGNDMAFAFIDYD
DKRDAEDALKNEDGRDFMGTRIVVEWTRSSRRDAGSYDRGSNRGGYDRRE
RDRYRDRDSGRDKYRGDSRRRRSYTRSRSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 6..75
e-value: 1.8E-14
score: 64.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 7..72
e-value: 1.0E-14
score: 54.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 5..79
score: 14.351
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..129
e-value: 2.1E-19
score: 71.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..119
NoneNo IPR availablePANTHERPTHR23147:SF131coord: 1..123
NoneNo IPR availablePANTHERPTHR23147SERINE/ARGININE RICH SPLICING FACTORcoord: 1..123
NoneNo IPR availableCDDcd00590RRM_SFcoord: 7..75
e-value: 9.30608E-15
score: 62.3225
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..108