Ethanolamine kinase, putative

Overview
NameEthanolamine kinase, putative
Smed IDSMED30011713
Length (bp)1176
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ethanolamine kinase, putative (SMED30011713) t-SNE clustered cells

Violin plots show distribution of expression levels for Ethanolamine kinase, putative (SMED30011713) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ethanolamine kinase, putative (SMED30011713) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ethanolamine kinase, putative (SMED30011713) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011713

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30011713SMESG000039272.1 dd_Smed_v4_8711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011713SMESG000039272.1 dd_Smed_v4_8711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30011713SMESG000039272.1 dd_Smed_v4_8711_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Match: ETNK2 (ethanolamine kinase 2 [Source:HGNC Symbol;Acc:HGNC:25575])

HSP 1 Score: 215.312 bits (547), Expect = 9.038e-66
Identity = 124/350 (35.43%), Postives = 197/350 (56.29%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             I ++ ++        I+++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + + +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII +  K  + FID+EYA YN+ AFDIGNHFNEFAG+ ++DY LYP    Q +W+  YL+ +                 V  +EV R Y  VNKF+LASH  W +W++ Q Q S I+FD+L YA+IR+ +Y K K +   L
Sbjct:   55 GISVDPDDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEE---DMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPK-PILWHKMHNYFTLVKNEINPSLS-----ADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQ-------------KGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFDFLRYAVIRFNQYFKVKPQASAL 382          
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Match: ETNK1 (ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC:24649])

HSP 1 Score: 213.386 bits (542), Expect = 3.604e-65
Identity = 120/335 (35.82%), Postives = 193/335 (57.61%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             ++ +RP W+   + ++ F  G++N L G Y   V     D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  K + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LS+ P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  + V EKEV+  +  VN+F+LASH  W +W++ Q + S IEFD+L YAI+R+ +Y K K +   L
Sbjct:   36 LLQHLRPHWDPQEVTLQLFTDGITNKLIGCY---VGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQSQWLRAYLEAY--------KEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAIVRFNQYFKMKPEVTAL 359          
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Match: ETNK1 (ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC:24649])

HSP 1 Score: 213.386 bits (542), Expect = 3.630e-64
Identity = 120/335 (35.82%), Postives = 193/335 (57.61%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             ++ +RP W+   + ++ F  G++N L G Y   V     D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  K + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LS+ P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  + V EKEV+  +  VN+F+LASH  W +W++ Q + S IEFD+L YAI+R+ +Y K K +   L
Sbjct:  125 LLQHLRPHWDPQEVTLQLFTDGITNKLIGCY---VGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQSQWLRAYLEAY--------KEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAIVRFNQYFKMKPEVTAL 448          
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Match: ETNK2 (ethanolamine kinase 2 [Source:HGNC Symbol;Acc:HGNC:25575])

HSP 1 Score: 174.481 bits (441), Expect = 5.010e-50
Identity = 105/308 (34.09%), Postives = 167/308 (54.22%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLAS 1007
             I ++ ++        I+++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +       L+ +  N    ++ P+   + +E+  L++HL++    V FCHNDL+  NII +  K  + FID+EYA YN+ AFDIGNHFNEFAG+ ++DY LYP    Q +W+  YL+ +                 V  +EV R Y  VNKF+L  
Sbjct:   55 GISVDPDDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEE---DMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPK-PILWHKMHNYFT-----LVKNEINPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQ-------------KGMAVTPREVQRLYVQVNKFALGP 340          
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Match: ETNK1 (ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC:24649])

HSP 1 Score: 172.555 bits (436), Expect = 9.376e-50
Identity = 101/295 (34.24%), Postives = 166/295 (56.27%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHL 1013
             ++ +RP W+   + ++ F  G++N L G Y   V     D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  K + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LS+ P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  + V EKEV+  +  VN+F+L  +L
Sbjct:   36 LLQHLRPHWDPQEVTLQLFTDGITNKLIGCY---VGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQSQWLRAYLEAY--------KEFKGFGTEVTEKEVEILFIQVNQFALGENL 319          
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Match: ckc-1 (Choline Kinase C [Source:UniProtKB/TrEMBL;Acc:Q22820])

HSP 1 Score: 134.035 bits (336), Expect = 1.125e-35
Identity = 101/343 (29.45%), Postives = 169/343 (49.27%), Query Frame = 3
Query:  120 EKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLE-DIDYS--LYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLT 1130
            E   +  + K+RP W +  +  + F  G++N +F           T+ V+ R++G     ++DR+ E+     L++Y  AA ++GKF+NG    ++ G  L  + + D      I     +LH+    +    +  +F K++ F   L  +     +   +   FP  +++  EI  +EK +      + FCHNDL+V+NI+ +  K  I FID+EYA  N+  +DI NHF E+AG+E   DYS  L  DE    KW             +N +    N     +  +   +K +  F  A+HL W +W++ Q QNS I+FDYL YA  R+++YQK   K+++
Sbjct:   22 ENSAREILTKLRPEWKSPEITFEYFSVGITNKIFSAGFG------TEHVIFRVFGHNTNKVIDRENEVIAWKQLAEYGFAAPLYGKFNNGLICGFLEGKSLAIEQMRDSKFNMNIAKRIAQLHS---SVPTNGKTPVFEKMRTFLQQLNPSFEKESQQNFFHENFP--TDLGAEISKIEKMIVMLKEPIVFCHNDLLVHNIVYDSEKKSIEFIDYEYAFPNYALYDIANHFCEYAGVEGSPDYSKCLTKDE----KWA-----------FINDYLRFSNGKEHSDTRIATMFKNLLLFEAAAHLFWAVWALVQAQNSTIDFDYLTYAHARYQQYQKRLHKYIS 338          
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Match: ckc-1 (Choline Kinase C [Source:UniProtKB/TrEMBL;Acc:Q22820])

HSP 1 Score: 118.627 bits (296), Expect = 3.559e-30
Identity = 94/324 (29.01%), Postives = 156/324 (48.15%), Query Frame = 3
Query:  120 EKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLE-DIDYS--LYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYL 1073
            E   +  + K+RP W +  +  + F  G++N +F           T+ V+ R++G     ++DR+ E+     L++Y  AA ++GKF+NG    ++ G  L  + + D      I     +LH+    +    +  +F K++ F   L  +     +   +   FP  +++  EI  +EK +      + FCHNDL+V+NI+ +  K  I FID+EYA  N+  +DI NHF E+AG+E   DYS  L  DE    KW             +N +    N     +  +   +K +  F  A+HL W +W++ Q QNS I+FDYL
Sbjct:   22 ENSAREILTKLRPEWKSPEITFEYFSVGITNKIFSAGFG------TEHVIFRVFGHNTNKVIDRENEVIAWKQLAEYGFAAPLYGKFNNGLICGFLEGKSLAIEQMRDSKFNMNIAKRIAQLHS---SVPTNGKTPVFEKMRTFLQQLNPSFEKESQQNFFHENFP--TDLGAEISKIEKMIVMLKEPIVFCHNDLLVHNIVYDSEKKSIEFIDYEYAFPNYALYDIANHFCEYAGVEGSPDYSKCLTKDE----KWA-----------FINDYLRFSNGKEHSDTRIATMFKNLLLFEAAAHLFWAVWALVQAQNSTIDFDYL 319          
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Match: cka-2 (Choline kinase A2 [Source:UniProtKB/Swiss-Prot;Acc:Q22942])

HSP 1 Score: 76.6406 bits (187), Expect = 3.940e-15
Identity = 87/352 (24.72%), Postives = 143/352 (40.62%), Query Frame = 3
Query:  177 LKIKKFYGGVSNLLFGVYLDEVYT---DTTDMVLIRIYGEILLDRDIEMENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-----CLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCH---------------------------XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDE-KEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKE 1118
            L+I +  GG+SN+LF   L EVY    +  + VL+R+Y     +  +  E++    LS+  L  K++G F  G   +YI    L   ++S  H    I     K+H   L++   KEP      L   +K+    +       +  E  +S      ++ +E+E L  H++     VTFCH                             L  +    N    R+  IDFEYA YN+ AFD  NHF E+     IDY +     ++ +        ++    +N     GN+   +  K+ +   +    F   SH  W +W + Q + S + F + +Y   R   Y K+K+
Sbjct:   55 LRISRIKGGMSNMLFLCRLSEVYPPIRNEPNKVLLRVYFNPETESHLVAESVIFTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLAHMSTKIAKRVAKVH--QLEVPIWKEPDYLCEALQRWLKQLTGTVDAEHRFDLPEECGVSSV-NCLDLARELEFLRAHISLSKSPVTFCHNDLQEGNILLPKASSGNIRMPSLSDETQALGNSLSAFNPADPRLVLIDFEYASYNYRAFDFANHFIEWT----IDYDIDEAPFYKIQTENFPENDQMLEFFLNYLREQGNTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSPVGFGFADYGRDRLSLYFKHKQ 399          
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Match: cka-2 (Choline kinase A2 [Source:UniProtKB/Swiss-Prot;Acc:Q22942])

HSP 1 Score: 76.2554 bits (186), Expect = 5.165e-15
Identity = 87/352 (24.72%), Postives = 143/352 (40.62%), Query Frame = 3
Query:  177 LKIKKFYGGVSNLLFGVYLDEVYT---DTTDMVLIRIYGEILLDRDIEMENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-----CLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCH---------------------------XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDE-KEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKE 1118
            L+I +  GG+SN+LF   L EVY    +  + VL+R+Y     +  +  E++    LS+  L  K++G F  G   +YI    L   ++S  H    I     K+H   L++   KEP      L   +K+    +       +  E  +S      ++ +E+E L  H++     VTFCH                             L  +    N    R+  IDFEYA YN+ AFD  NHF E+     IDY +     ++ +        ++    +N     GN+   +  K+ +   +    F   SH  W +W + Q + S + F + +Y   R   Y K+K+
Sbjct:   76 LRISRIKGGMSNMLFLCRLSEVYPPIRNEPNKVLLRVYFNPETESHLVAESVIFTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLAHMSTKIAKRVAKVH--QLEVPIWKEPDYLCEALQRWLKQLTGTVDAEHRFDLPEECGVSSV-NCLDLARELEFLRAHISLSKSPVTFCHNDLQEGNILLPKASSGNIRMPSLSDETQALGNSLSAFNPADPRLVLIDFEYASYNYRAFDFANHFIEWT----IDYDIDEAPFYKIQTENFPENDQMLEFFLNYLREQGNTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSPVGFGFADYGRDRLSLYFKHKQ 420          
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Match: cka-1 (Choline Kinase A [Source:UniProtKB/TrEMBL;Acc:A0A061AIW1])

HSP 1 Score: 73.1738 bits (178), Expect = 6.672e-14
Identity = 95/367 (25.89%), Postives = 154/367 (41.96%), Query Frame = 3
Query:  180 KIKKFYGGVSNLLFGVYLDEVYTDT---TDMVLIRIYGEILLDRDI-EMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFP-RKSEVFK-----EIECLEKHLN------KPTH-LVTFCHX------------------XXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFA----GLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVD--------EKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEY---QKNKEKFLT 1130
            +I+   GG+SNLLF V L    T      +  L+R++ +  +D+ + E      LS+ +L  K+ G F  G   Q+I    L   ++S     +LI     ++HT  LD    KEP      +++              E YL++    KS++F+      +  LE+ LN      + +H  V F HN                    V+       N + +  IDFEY  YN+  FD+GNHF E+       E   Y ++       K  +++ E  L+  V    +C G++ H          EK++++  +    F   S++ W  WS+   + S I FDY  Y   R   Y   +KN EK+L+
Sbjct:   87 RIRAITGGMSNLLFLVELPAHLTPIQMEPEKALLRVHCQSDIDQLLSESVVFTLLSERNLGPKMLGVFPGGRFEQFIPSRALQCLEISKPGLSKLIAPIVARVHT--LDAPIPKEPQTLQTARQWLERFKKTPAGERPIEMYLTQAKVPKSDIFQYPSTITVAQLERELNFVEFFLQHSHSPVVFSHNDLQEGNFLLIDGYKLADDGTVLTPDGKPTNDDPLSLIDFEYCSYNYRGFDLGNHFCEYGYDYNEAEAPYYKIHQHYFEVEKERKVFCEAYLD-EVYKMRAC-GDNPHFPSDLVTGDREKDLNKIIEESILFMPVSNIFWVCWSLINAEESSIAFDYGAYGRDRLALYFHQKKNLEKYLS 449          
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Match: eas (gene:FBgn0000536 transcript:FBtr0074214)

HSP 1 Score: 190.274 bits (482), Expect = 2.118e-55
Identity = 121/393 (30.79%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  123 KDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEV-------------------------------------YTD------------TTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV----SLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +  K  ++ IRPTW+ + ++ K F  G++N L G +  E+                                     +TD            + ++VL+RIYG   ++L+DR  E +N   L  Y LA  ++  F NG  Y+Y+ GT L+   +     + L+     ++H          + K  P ++ K + F + +P+   D+ K+++    F     + +E   L ++L      + F HNDL++ N+I   + N ++FID+EYADYNF AFDIGNHF E  G++++DYS YP   FQ +W+R+YLE+ L              S++   EV+  Y  VN+F+LASH+ W +WS+ Q ++S I+FDY+ YA +R+ EY   K +FL+L
Sbjct:  108 QGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYL------------QRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSL 488          
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Match: eas (gene:FBgn0000536 transcript:FBtr0308619)

HSP 1 Score: 190.274 bits (482), Expect = 2.118e-55
Identity = 121/393 (30.79%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  123 KDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEV-------------------------------------YTD------------TTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV----SLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +  K  ++ IRPTW+ + ++ K F  G++N L G +  E+                                     +TD            + ++VL+RIYG   ++L+DR  E +N   L  Y LA  ++  F NG  Y+Y+ GT L+   +     + L+     ++H          + K  P ++ K + F + +P+   D+ K+++    F     + +E   L ++L      + F HNDL++ N+I   + N ++FID+EYADYNF AFDIGNHF E  G++++DYS YP   FQ +W+R+YLE+ L              S++   EV+  Y  VN+F+LASH+ W +WS+ Q ++S I+FDY+ YA +R+ EY   K +FL+L
Sbjct:  108 QGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYL------------QRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSL 488          
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Match: eas (gene:FBgn0000536 transcript:FBtr0343519)

HSP 1 Score: 190.274 bits (482), Expect = 2.118e-55
Identity = 121/393 (30.79%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  123 KDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEV-------------------------------------YTD------------TTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV----SLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +  K  ++ IRPTW+ + ++ K F  G++N L G +  E+                                     +TD            + ++VL+RIYG   ++L+DR  E +N   L  Y LA  ++  F NG  Y+Y+ GT L+   +     + L+     ++H          + K  P ++ K + F + +P+   D+ K+++    F     + +E   L ++L      + F HNDL++ N+I   + N ++FID+EYADYNF AFDIGNHF E  G++++DYS YP   FQ +W+R+YLE+ L              S++   EV+  Y  VN+F+LASH+ W +WS+ Q ++S I+FDY+ YA +R+ EY   K +FL+L
Sbjct:  108 QGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYL------------QRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSL 488          
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Match: eas (gene:FBgn0000536 transcript:FBtr0074211)

HSP 1 Score: 190.274 bits (482), Expect = 2.118e-55
Identity = 121/393 (30.79%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  123 KDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEV-------------------------------------YTD------------TTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV----SLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +  K  ++ IRPTW+ + ++ K F  G++N L G +  E+                                     +TD            + ++VL+RIYG   ++L+DR  E +N   L  Y LA  ++  F NG  Y+Y+ GT L+   +     + L+     ++H          + K  P ++ K + F + +P+   D+ K+++    F     + +E   L ++L      + F HNDL++ N+I   + N ++FID+EYADYNF AFDIGNHF E  G++++DYS YP   FQ +W+R+YLE+ L              S++   EV+  Y  VN+F+LASH+ W +WS+ Q ++S I+FDY+ YA +R+ EY   K +FL+L
Sbjct:  108 QGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYL------------QRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSL 488          
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Match: eas (gene:FBgn0000536 transcript:FBtr0074212)

HSP 1 Score: 190.274 bits (482), Expect = 2.118e-55
Identity = 121/393 (30.79%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  123 KDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEV-------------------------------------YTD------------TTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV----SLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +  K  ++ IRPTW+ + ++ K F  G++N L G +  E+                                     +TD            + ++VL+RIYG   ++L+DR  E +N   L  Y LA  ++  F NG  Y+Y+ GT L+   +     + L+     ++H          + K  P ++ K + F + +P+   D+ K+++    F     + +E   L ++L      + F HNDL++ N+I   + N ++FID+EYADYNF AFDIGNHF E  G++++DYS YP   FQ +W+R+YLE+ L              S++   EV+  Y  VN+F+LASH+ W +WS+ Q ++S I+FDY+ YA +R+ EY   K +FL+L
Sbjct:  108 QGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYL------------QRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSL 488          
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Match: etnk1 (ethanolamine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030328-21])

HSP 1 Score: 207.608 bits (527), Expect = 2.916e-63
Identity = 116/350 (33.14%), Postives = 196/350 (56.00%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++ ++  ++       I+ +RP W  + +K+K F  G++N L G Y   V     ++VL+R+YG   E+ +DR+ E+++   L  +  A +++  F+NG  Y+++ G  L  + +     ++ I  +  K H +        +  L+ K+ +F + +P +  D   +++  +E P  + +  E+  L+++L+K    V  CHNDL+  NII N  +  + FID+EYA YN+ AFDIGNHFNEFAGL ++DY+LYPD   Q +W+R YLE                 S V   EV+  Y  VN+F+LASH  W +W++ Q Q S I+FD+L YA++R+ +Y K K + ++L
Sbjct:   18 DVTVDEHDYRAGALKLIKTLRPHWKPSEVKMKTFTDGITNKLIGCY---VGGSMQEVVLVRVYGNKTELFVDRENEVKSFRVLQAHRCAPRLYCTFNNGLCYEFLQGVALEPEHIRSPAIFRHIARQMAKYHAIHAHNGWVPQSGLWLKMSKFFSLVPSHFEDPEMDQRLNNEVPSAACLRDEMIWLQQNLSKLGSPVVLCHNDLLCKNIIYNQKEGNVKFIDYEYAGYNYQAFDIGNHFNEFAGLNEVDYTLYPDRELQMQWLRAYLEAY--------KEYKSQGSQVSNTEVELLYVQVNRFALASHFFWGLWALIQAQYSTIDFDFLGYAVLRFNQYFKMKPEVMSL 356          
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Match: etnk2 (ethanolamine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-135])

HSP 1 Score: 205.297 bits (521), Expect = 1.994e-62
Identity = 118/357 (33.05%), Postives = 199/357 (55.74%), Query Frame = 3
Query:   75 TFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEK-RLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            T  +F  I ++  N  +     I+++RP W+ N ++ K F  G +N L G Y+++      D+VL+R+YG   E+++DRD E+++   L     A +++  F NG  Y+++ G  L  +D+ D    +LI  E  ++H +        +P L+ K++++ + +     +   N +   E P +  + +E+  +++HL++    V  CHNDL+  NII N  +  + FID+EY+ YN+ AFDIGNHFNEFAG+ + DY+LYP    Q  W++ YL+  +L +              V E+E++  Y  VNKF+LASH  W  W++ Q + S IEFD+L YA++R+ +Y K K   + L
Sbjct:   13 TIRKF-QIFVDEHNVTEGAMKLIKELRPGWDPNLIRTKLFTDGTTNKLVGCYVEDC---VEDVVLVRVYGNKTELIVDRDNELKSFQVLHANGCAPRLYCTFQNGICYEFMQGRALDTQDVRDPVLLRLIAREMARIHAIHAHNGCIPKPNLWIKMRKYFSLVATEFTEQASNIRIQQEVPSQEVLEQEMMWMKEHLSQLGSPVVLCHNDLLCKNIIHNAKEGHVRFIDYEYSSYNYQAFDIGNHFNEFAGMSEPDYNLYPSREMQLDWLQTYLQAYKLFTK---------KGEDVSERELETLYVQVNKFALASHFFWGFWALIQAKYSTIEFDFLGYAVLRFNQYFKTKPAVMAL 356          
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Match: etnk2 (ethanolamine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-135])

HSP 1 Score: 205.682 bits (522), Expect = 2.436e-62
Identity = 118/357 (33.05%), Postives = 199/357 (55.74%), Query Frame = 3
Query:   75 TFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEK-RLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            T  +F  I ++  N  +     I+++RP W+ N ++ K F  G +N L G Y+++      D+VL+R+YG   E+++DRD E+++   L     A +++  F NG  Y+++ G  L  +D+ D    +LI  E  ++H +        +P L+ K++++ + +     +   N +   E P +  + +E+  +++HL++    V  CHNDL+  NII N  +  + FID+EY+ YN+ AFDIGNHFNEFAG+ + DY+LYP    Q  W++ YL+  +L +              V E+E++  Y  VNKF+LASH  W  W++ Q + S IEFD+L YA++R+ +Y K K   + L
Sbjct:   24 TIRKF-QIFVDEHNVTEGAMKLIKELRPGWDPNLIRTKLFTDGTTNKLVGCYVEDC---VEDVVLVRVYGNKTELIVDRDNELKSFQVLHANGCAPRLYCTFQNGICYEFMQGRALDTQDVRDPVLLRLIAREMARIHAIHAHNGCIPKPNLWIKMRKYFSLVATEFTEQASNIRIQQEVPSQEVLEQEMMWMKEHLSQLGSPVVLCHNDLLCKNIIHNAKEGHVRFIDYEYSSYNYQAFDIGNHFNEFAGMSEPDYNLYPSREMQLDWLQTYLQAYKLFTK---------KGEDVSERELETLYVQVNKFALASHFFWGFWALIQAKYSTIEFDFLGYAVLRFNQYFKTKPAVMAL 367          
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Match: chkb (choline kinase beta [Source:ZFIN;Acc:ZDB-GENE-030131-2928])

HSP 1 Score: 113.235 bits (282), Expect = 3.341e-27
Identity = 105/342 (30.70%), Postives = 158/342 (46.20%), Query Frame = 3
Query:  180 KIKKFYGGVSNLLFGVYL-DEVYTDTTD--MVLIRIYGEILLDRD---IEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKS-------EVFKEIECLEKHLNKPTHLVTFCHXXXXX----XXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSL----------YPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKM-VNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKE 1118
            +IK   GG+SNLL+   L D+V     +   VL+RIYG IL   D   +E    A L++ +L  +++G F  G   QY+    L  + LS       I ++  + H   +++   KEP  LF  I        D  +D +K  K++ E   K        ++  E+E L   L      V FCHND+             + +++  IDFEY+ YN+  FD GNHF E+  + D  Y            YP+   Q  +IR YL ++            G  S  D+  ++    +  N+F+LASH LW +WSI Q + S IEF Y++YA  R+  Y K K+
Sbjct:  131 QIKIVSGGLSNLLYMCSLPDDVKPAGVEPRRVLLRIYGAILQGVDSLVLESVMFAILAERELGPRLYGIFPEGRLEQYLPSNRLRTEQLSYSQISAEIASKMARFH--GMEMPFNKEPKWLFGTI--------DRYMDQVKTLKFVREAHIKKFNKLMKYDLPAELESLRSLLAATPSPVVFCHNDVQEGNILMLDGRENSADKLMLIDFEYSSYNYRGFDFGNHFCEW--IYDYTYDQWPFYKAKVENYPNREQQLHFIRHYLSEK------------GGVSPADQARIEEDMIIEANRFALASHFLWGLWSIIQAKLSKIEFGYMDYAQHRFDTYFKQKK 448          
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Match: chka (choline kinase alpha [Source:ZFIN;Acc:ZDB-GENE-050208-149])

HSP 1 Score: 103.99 bits (258), Expect = 2.915e-24
Identity = 100/335 (29.85%), Postives = 160/335 (47.76%), Query Frame = 3
Query:  180 KIKKFYGGVSNLLFGVYLDEVYTDTTDM---VLIRIYGEILLDRD---IEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXX-----XXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSS--HVDEKEVDRWYK----MVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKF 1124
            +I    GG+SN LF   L E+     D    VL+R+YGEIL   D   +E    A L++ +L  K++G F  G   Q++    L   +LS       I  +  + H + +  +  KEP  LF  ++++ + +   L  +   E +L  F R     + +E++ L+  L      V FCHNDL   N        N ++ R+  IDFEY+ YN+  FDIGN F E+    D  Y  +P   F     + Y  K    ++ + +    ++   H+ E++  +  +     VN+F+LASH  W +WS+ Q + S IEF Y+ YA+ R+  Y + K K 
Sbjct:   74 QISIIRGGLSNKLFLCALPEMQASLGDEPRNVLLRLYGEILQGADAMVLESVMFAILAERELGPKLYGIFPQGRLEQFVPSRKLTTDELSVPGINAEIAEKIARFHGMRMPFN--KEPKWLFGTMEKYMDQV---LQLTFTREPHLRNFSRILSYNLPQEMDNLKCLLESTPSPVVFCHNDLQEGNILLLNGRENTDRQRLMLIDFEYSSYNYRGFDIGNFFCEWT--YDYTYDKFP---FFTNNTKNYPTKAQQMHIFHSYLLESDAGFKHLSEEDQMKLKEDMLVEVNRFALASHFFWGLWSMIQAKISTIEFGYMEYAMARFDAYFELKRKL 398          
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Match: chkb (choline kinase beta [Source:NCBI gene;Acc:100145186])

HSP 1 Score: 110.538 bits (275), Expect = 4.079e-26
Identity = 100/364 (27.47%), Postives = 171/364 (46.98%), Query Frame = 3
Query:   96 IKINAENFEKDVKVFIEKIRPTW---NTNSLKIKKFYGGVSNLLFGVYL-DEVYTDTTD--MVLIRIYGEILLDRDIEMEN---MAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXX-----XXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFA--------GLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEK 1121
            + +N E   +   +  E +R  W     +  ++    GG+SNLL+   L D V T +T+   VL+R+YG IL   +  ++     A L++  L  +++G F  G   +YI    L   +LS       I  +  + H + +  + KK   LF  ++E+ + +        ++ +  ++  +   + +E++ L+  L      V FCHND+        +   +   +R+  IDFEY+ YN+  FDIGNHF E+A               + YP  V Q ++ R YL + ++  +  G        H  E+ +      VN+F+LASH  W +WSI Q + S IEF YL+YA+ R+  Y + K +
Sbjct:  100 LGVNTELQTRAFTLCREYLRGVWREIQPHQFRVSVVSGGLSNLLYKCSLTDSVKTQSTEPRQVLLRLYGAILQGVNSLVQESVMFAILAERSLGPRLYGVFPQGRLEEYIPSRRLLTSELSCPDVSSEIAEKLARFHKMEMPFN-KKPVWLFRTMEEYMSQISSLSFTQKEDVEKFNQL-KSLSLEEEMQKLKLLLLSTASPVVFCHNDVQEGNILLLSSRSSSPSDRLMLIDFEYSSYNYRGFDIGNHFCEWAYNYQHNEWPFYKAQLNDYPSRVQQLRFFRSYLLE-MSPGLSEGER------HAQEEAM---LLEVNRFALASHFFWGLWSILQAKMSTIEFGYLDYALSRFNAYFEQKRR 451          
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Match: chka (choline kinase alpha [Source:NCBI gene;Acc:496957])

HSP 1 Score: 93.5893 bits (231), Expect = 2.145e-20
Identity = 92/347 (26.51%), Postives = 161/347 (46.40%), Query Frame = 3
Query:  198 GGVSNLLFGVYLDE---VYTDTTDMVLIRIYGEILL-------DRDIEMENM--------------AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCN-----GNSSHVDEKEVDRWYKM-VNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKF 1124
            GG+SN+L+   L E     ++    VL+R+YG IL        +++ + +N               A L++  L  K++G F  G   ++I    L   +LS       I  +  + H +++  +  KEP  LF  ++++   L   L      E +  +  +    ++ KE+  L   L   +  V FCH      ++++ +   N  K ++  IDFEY+ YN+  FDIGNHF E+  + D  +  +P   F +     Y  +R   + VN +         N S+ ++ +++    + +N+F+LASH  W +WSI Q + S IEF Y+ YA+ R+  Y + K K 
Sbjct:   83 GGLSNMLYLCSLPEDEKSLSNEPRSVLLRLYGAILQMSCNKGENQETQRQNFFQGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEEFIPSRKLETSELSLPDLSAEIAEKMARFHGMNMPFN--KEPKWLFGTMEKY---LQQVLKIKFTRESHTRKLNKILAYDLSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW--MYDYTFEKFP---FFKATFSKYPTRRQQIHFVNSYLTEFLPGFENISNEEQSKLENELLIEINRFALASHFFWGLWSIVQAKLSSIEFGYMEYAMARFDAYFQQKRKL 419          
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Match: chka (choline kinase alpha [Source:NCBI gene;Acc:496957])

HSP 1 Score: 85.1149 bits (209), Expect = 1.299e-17
Identity = 87/321 (27.10%), Postives = 152/321 (47.35%), Query Frame = 3
Query:  198 GGVSNLLFGVYLDE---VYTDTTDMVLIRIYGEILLDRDIE----------MENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCN-----GNSSHVDEKEVDRWYKM-VNKFSLASHLLWCIWSIWQYQNSVIEFDYL 1073
            GG+SN+L+   L E     ++    VL+R+YG IL   + +          ME++  A L++  L  K++G F  G   ++I    L   +LS       I  +  + H +++  +  KEP  LF  ++++   L   L      E +  +  +    ++ KE+  L   L   +  V FCH      ++++ +   N  K ++  IDFEY+ YN+  FDIGNHF E+  + D  +  +P   F +     Y  +R   + VN +         N S+ ++ +++    + +N+F+LASH  W +WSI Q + S IEF Y+
Sbjct:   83 GGLSNMLYLCSLPEDEKSLSNEPRSVLLRLYGAILQVGETKDAYRGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEEFIPSRKLETSELSLPDLSAEIAEKMARFHGMNMPFN--KEPKWLFGTMEKY---LQQVLKIKFTRESHTRKLNKILAYDLSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW--MYDYTFEKFP---FFKATFSKYPTRRQQIHFVNSYLTEFLPGFENISNEEQSKLENELLIEINRFALASHFFWGLWSIVQAKLSSIEFGYM 393          
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Match: chka (choline kinase alpha [Source:NCBI gene;Acc:496957])

HSP 1 Score: 85.5001 bits (210), Expect = 1.363e-17
Identity = 90/347 (25.94%), Postives = 158/347 (45.53%), Query Frame = 3
Query:  183 IKKFYGGVSNLLFGVYLDE---VYTDTTDMVLIRIYGEILL-------DRDIEMENM--------------AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCN-----GNSSHVDEKEVDRWYKM-VNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQK 1109
            I    GG+SN+L+   L E     ++    VL+R+YG IL        +++ + +N               A L++  L  K++G F  G   ++I    L   +LS       I  +  + H +++  +  KEP  LF  ++++   L   L      E +  +  +    ++ KE+  L   L   +  V FCH      ++++ +   N  K ++  IDFEY+ YN+  FDIGNHF E+  + D  +  +P   F +     Y  +R   + VN +         N S+ ++ +++    + +N+F+LASH  W +WSI Q + S IEF Y+  A+ +  E  K
Sbjct:   78 ISVIRGGLSNMLYLCSLPEDEKSLSNEPRSVLLRLYGAILQMSCNKGENQETQRQNFFQGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEEFIPSRKLETSELSLPDLSAEIAEKMARFHGMNMPFN--KEPKWLFGTMEKY---LQQVLKIKFTRESHTRKLNKILAYDLSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW--MYDYTFEKFP---FFKATFSKYPTRRQQIHFVNSYLTEFLPGFENISNEEQSKLENELLIEINRFALASHFFWGLWSIVQAKLSSIEFGYMPMAVPKILEIGK 414          
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Match: chka (choline kinase alpha [Source:NCBI gene;Acc:496957])

HSP 1 Score: 85.1149 bits (209), Expect = 1.500e-17
Identity = 87/321 (27.10%), Postives = 152/321 (47.35%), Query Frame = 3
Query:  198 GGVSNLLFGVYLDE---VYTDTTDMVLIRIYGEILLDRDIE----------MENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPC-LFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCN-----GNSSHVDEKEVDRWYKM-VNKFSLASHLLWCIWSIWQYQNSVIEFDYL 1073
            GG+SN+L+   L E     ++    VL+R+YG IL   + +          ME++  A L++  L  K++G F  G   ++I    L   +LS       I  +  + H +++  +  KEP  LF  ++++   L   L      E +  +  +    ++ KE+  L   L   +  V FCH      ++++ +   N  K ++  IDFEY+ YN+  FDIGNHF E+  + D  +  +P   F +     Y  +R   + VN +         N S+ ++ +++    + +N+F+LASH  W +WSI Q + S IEF Y+
Sbjct:   83 GGLSNMLYLCSLPEDEKSLSNEPRSVLLRLYGAILQVGETKDAYRGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEEFIPSRKLETSELSLPDLSAEIAEKMARFHGMNMPFN--KEPKWLFGTMEKY---LQQVLKIKFTRESHTRKLNKILAYDLSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW--MYDYTFEKFP---FFKATFSKYPTRRQQIHFVNSYLTEFLPGFENISNEEQSKLENELLIEINRFALASHFFWGLWSIVQAKLSSIEFGYM 393          
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Match: Etnk2 (ethanolamine kinase 2 [Source:MGI Symbol;Acc:MGI:2443760])

HSP 1 Score: 219.935 bits (559), Expect = 1.273e-67
Identity = 126/350 (36.00%), Postives = 198/350 (56.57%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++ +  ++        I ++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + D +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII + +K R+ FID+EYA YN+ AFDIGNHFNEFAG+  +DYS YP    Q +W+R YLE +               +    +EV+R Y  VNKF+LASH  W +W++ Q Q S I FD+L YA+IR+ +Y K K +   L
Sbjct:   54 SVTVEQDDILPGALRLIRELRPHWKPEQVRTKRFKDGITNKLLACYVEE---DMRDCVLVRVYGERTELLVDRENEVRNFQLLRAHGCAPKLYCTFQNGLCYEYVQGVALGPEHIREPQLFRLIALEMAKIHTIHANGSLPK-PTLWHKMHRYFTLVKDEISPSLS-----ADVPKVEVLEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGRVCFIDYEYAGYNYQAFDIGNHFNEFAGVNVVDYSRYPARETQVQWLRYYLEAQ-------------KGTAASPREVERLYAQVNKFALASHFFWALWALIQNQYSTISFDFLRYAVIRFNQYFKVKPQVSAL 381          
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Match: Etnk1 (ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1922570])

HSP 1 Score: 210.69 bits (535), Expect = 2.288e-64
Identity = 118/335 (35.22%), Postives = 192/335 (57.31%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             +  +RP W+   + ++ F  G++N L   Y+ +      D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  + + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LSE P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  S V EKEV+  +  VN+F+LASH  W +W++ Q + S IEFD+L YA++R+ +Y K K +   L
Sbjct:   36 LLRHLRPHWDPREVTLQLFTDGITNKLIACYVGDT---MEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPQHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADENINKRFLSEIPSPQLLQEEMTWMKELLSSLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQGQWLRSYLEAY--------KEYKGFGSDVTEKEVETLFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAVVRFNQYFKMKPEVTAL 359          
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Match: Etnk2 (ethanolamine kinase 2 [Source:MGI Symbol;Acc:MGI:2443760])

HSP 1 Score: 195.282 bits (495), Expect = 2.204e-59
Identity = 114/295 (38.64%), Postives = 172/295 (58.31%), Query Frame = 3
Query:  258 DMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + D +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII + +K R+ FID+EYA YN+ AFDIGNHFNEFAG+  +DYS YP    Q +W+R YLE +               +    +EV+R Y  VNKF+LASH  W +W++ Q Q S I FD+L YA+IR+ +Y K K +   L
Sbjct:    3 DCVLVRVYGERTELLVDRENEVRNFQLLRAHGCAPKLYCTFQNGLCYEYVQGVALGPEHIREPQLFRLIALEMAKIHTIHANGSLPK-PTLWHKMHRYFTLVKDEISPSLS-----ADVPKVEVLEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGRVCFIDYEYAGYNYQAFDIGNHFNEFAGVNVVDYSRYPARETQVQWLRYYLEAQ-------------KGTAASPREVERLYAQVNKFALASHFFWALWALIQNQYSTISFDFLRYAVIRFNQYFKVKPQVSAL 278          
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Match: Etnk1 (ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1922570])

HSP 1 Score: 168.318 bits (425), Expect = 2.112e-48
Identity = 99/291 (34.02%), Postives = 163/291 (56.01%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSL 1001
             +  +RP W+   + ++ F  G++N L   Y+ +      D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  + + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LSE P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  S V EKEV+  +  VN+F+L
Sbjct:   36 LLRHLRPHWDPREVTLQLFTDGITNKLIACYVGDT---MEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPQHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADENINKRFLSEIPSPQLLQEEMTWMKELLSSLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQGQWLRSYLEAY--------KEYKGFGSDVTEKEVETLFIQVNQFAL 315          
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Match: Etnk1 (ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1922570])

HSP 1 Score: 169.088 bits (427), Expect = 2.550e-48
Identity = 99/299 (33.11%), Postives = 166/299 (55.52%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCI 1025
             +  +RP W+   + ++ F  G++N L   Y+ +      D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  + + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LSE P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  S V EKEV+  +  VN+F+L    ++ +
Sbjct:   36 LLRHLRPHWDPREVTLQLFTDGITNKLIACYVGDT---MEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPQHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADENINKRFLSEIPSPQLLQEEMTWMKELLSSLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQGQWLRSYLEAY--------KEYKGFGSDVTEKEVETLFIQVNQFALPPSQVYPV 323          
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Match: sp|A7MCT6|EKI2_MOUSE (Ethanolamine kinase 2 OS=Mus musculus OX=10090 GN=Etnk2 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 8.907e-67
Identity = 126/350 (36.00%), Postives = 198/350 (56.57%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++ +  ++        I ++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + D +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII + +K R+ FID+EYA YN+ AFDIGNHFNEFAG+  +DYS YP    Q +W+R YLE +               +    +EV+R Y  VNKF+LASH  W +W++ Q Q S I FD+L YA+IR+ +Y K K +   L
Sbjct:   54 SVTVEQDDILPGALRLIRELRPHWKPEQVRTKRFKDGITNKLLACYVEE---DMRDCVLVRVYGERTELLVDRENEVRNFQLLRAHGCAPKLYCTFQNGLCYEYVQGVALGPEHIREPQLFRLIALEMAKIHTIHANGSLPK-PTLWHKMHRYFTLVKDEISPSLS-----ADVPKVEVLEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGRVCFIDYEYAGYNYQAFDIGNHFNEFAGVNVVDYSRYPARETQVQWLRYYLEAQ-------------KGTAASPREVERLYAQVNKFALASHFFWALWALIQNQYSTISFDFLRYAVIRFNQYFKVKPQVSAL 381          
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Match: sp|D3ZRW8|EKI2_RAT (Ethanolamine kinase 2 OS=Rattus norvegicus OX=10116 GN=Etnk2 PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 3.319e-66
Identity = 125/349 (35.82%), Postives = 197/349 (56.45%), Query Frame = 3
Query:   96 IKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            I ++ ++        I ++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + D +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII + +K  + FID+EYA YN+ AFDIGNHFNEFAG+ ++DY  YP    Q +W+R YLE +               +    +EV+R Y  VNKF+LASH  W +W++ Q Q S I FD+L YA+IR+ +Y K K +   L
Sbjct:   55 IAVDQDDILPGALRLIRELRPHWKPEQVRTKRFKDGITNKLLACYVEE---DMRDCVLVRVYGEWTELLVDRENEIRNFQLLRAHGCAPKLYCTFQNGLCYEYMQGVALGPEHIREPQLFRLIALEMAKIHTIHANGSLPK-PTLWHKMHRYFTLVKDEISPSLS-----ADVPKVEVLEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCRYPAREIQLQWLRYYLEAQ-------------KGTAASPREVERLYAQVNKFALASHFFWALWALIQNQYSTINFDFLRYAVIRFNQYFKVKPQVSAL 381          
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Match: sp|Q9NVF9|EKI2_HUMAN (Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=ETNK2 PE=1 SV=3)

HSP 1 Score: 215.312 bits (547), Expect = 4.340e-65
Identity = 124/350 (35.43%), Postives = 197/350 (56.29%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             I ++ ++        I+++RP W    ++ K+F  G++N L   Y++E   D  D VL+R+YGE   +L+DR+ E+ N   L  +  A K++  F NG  Y+Y+ G  L  + + +   ++LI  E  K+HT+  + S  K P L+HK+  +   + + +  S+      ++ P+   + +E+  L++HL++    V FCHNDL+  NII +  K  + FID+EYA YN+ AFDIGNHFNEFAG+ ++DY LYP    Q +W+  YL+ +                 V  +EV R Y  VNKF+LASH  W +W++ Q Q S I+FD+L YA+IR+ +Y K K +   L
Sbjct:   55 GISVDPDDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEE---DMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPK-PILWHKMHNYFTLVKNEINPSLS-----ADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQ-------------KGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFDFLRYAVIRFNQYFKVKPQASAL 382          
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Match: sp|Q9D4V0|EKI1_MOUSE (Ethanolamine kinase 1 OS=Mus musculus OX=10090 GN=Etnk1 PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 1.600e-63
Identity = 118/335 (35.22%), Postives = 192/335 (57.31%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             +  +RP W+   + ++ F  G++N L   Y+ +      D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  + + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LSE P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  S V EKEV+  +  VN+F+LASH  W +W++ Q + S IEFD+L YA++R+ +Y K K +   L
Sbjct:   36 LLRHLRPHWDPREVTLQLFTDGITNKLIACYVGDT---MEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPQHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADENINKRFLSEIPSPQLLQEEMTWMKELLSSLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQGQWLRSYLEAY--------KEYKGFGSDVTEKEVETLFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAVVRFNQYFKMKPEVTAL 359          
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Match: sp|Q9HBU6|EKI1_HUMAN (Ethanolamine kinase 1 OS=Homo sapiens OX=9606 GN=ETNK1 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.743e-63
Identity = 120/335 (35.82%), Postives = 193/335 (57.61%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             ++ +RP W+   + ++ F  G++N L G Y   V     D+VL+RIYG   E+L+DRD E+++   L  +  A +++  F+NG  Y++I G  L  K + +   ++LI  +  K+H +        +  L+ K+ ++ + +P    D   N+++LS+ P    + +E+  +++ L+     V  CHNDL+  NII N  +  + FID+EY+ YN+ A+DIGNHFNEFAG+ D+DYSLYPD   Q +W+R YLE              G  + V EKEV+  +  VN+F+LASH  W +W++ Q + S IEFD+L YAI+R+ +Y K K +   L
Sbjct:  125 LLQHLRPHWDPQEVTLQLFTDGITNKLIGCY---VGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLYPDRELQSQWLRAYLEAY--------KEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKYSTIEFDFLGYAIVRFNQYFKMKPEVTAL 448          
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Match: A0A443S8E6 (Ethanolamine kinase 1-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_08070 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.774e-73
Identity = 137/351 (39.03%), Postives = 209/351 (59.54%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGE---ILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLE--KRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLT 1130
            N+ +  E    D       +RP W    + +K F  G++N L G Y+D   T+  DM+LIR+YGE   + +DR++E+ N+  +S   L+  +   F NG  Y Y  G +L +  +SD   ++LI      +H +++  +  KEPCLF  ++++   +PD+  D     K +   P K ++ +E++ LE HL+     V FCHNDL++ NI+ N  K+ + FIDFEYAD+N+ AFDIGNHF EFAG+E  +  LYPD+ FQ +WIR YL    +L SN     + NG++ H  E++++R Y+ VNKFSLA+HLLW IW++ Q ++S I FD+L YA+ R  EY   K++ L 
Sbjct:   23 NVTVGVETLHSDAVEIARHVRPHWTCCPVSVKVFTDGITNRLLGCYID---TEPDDMILIRVYGENTHLFIDRNLEIRNLKFMSSAGLSPPLLCTFQNGICYGYTPGDVLDQNLVSDPKVFRLITKNLAFMHCINVSENVNKEPCLFKVLRKYLKLIPDSYADCSDEIKRI--LPNKQQLTEEVQLLESHLSSMGSPVVFCHNDLLLKNIVRNKRKD-VTFIDFEYADFNYQAFDIGNHFCEFAGVEKYNPQLYPDKSFQIEWIRSYLTYWNKLRSN--KPMNMNGDAEHSIEEQIERLYQQVNKFSLAAHLLWGIWALIQAKHSKIRFDFLGYAVDRINEYFTRKQQILV 365          
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Match: A0A067QIM2 (Ethanolamine kinase OS=Zootermopsis nevadensis OX=136037 GN=L798_02584 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 6.167e-70
Identity = 129/331 (38.97%), Postives = 196/331 (59.21%), Query Frame = 3
Query:  150 IRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            IRPTW    +  K F  G++N L G + +E      D+VL+R+YG   ++L+DR+ E  N+  L     A +++  F NG +Y+Y+ G +L+     D   + L+      +H VS   +  KEP ++ KI++F + +P    D  K  +++   P KS++  E   L+  L+     + FCHNDL++ NII +  KN + FID+EY++YN+ AFDIGNHF EFAG+ D+DY+ YP + FQR+W+R+YLE   + +  +       S  V E  +   Y  VNKFSLASH LW IW++ Q ++S I+FD+L YA IR KEY   K++FL+L
Sbjct:   28 IRPTWAKEKVNFKVFTDGITNKLLGCFHEEY---PEDVVLVRVYGHKTDLLIDRNAETRNIQLLHNAGYAPRLYATFCNGLAYEYVPGVILNTTSCRDADVFPLVARMMALMHKVSNGDAVSKEPSVWLKIQQFLDIMPHRFQDPEKQARFVDLIPPKSKLEAEYAKLKAELSSVGSPIVFCHNDLLLANIIYHTKKNTVTFIDYEYSNYNYQAFDIGNHFAEFAGVTDVDYAAYPSQEFQRQWLRVYLET-FHGSTTDTSLGEDASDAVTEHSISCLYVQVNKFSLASHFLWAIWALIQAEHSTIDFDFLGYADIRLKEYFAKKDRFLSL 354          
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Match: A0A1S3J7T7 (ethanolamine kinase 1 OS=Lingula unguis OX=7574 GN=LOC106170843 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 9.762e-69
Identity = 133/359 (37.05%), Postives = 218/359 (60.72%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV--SLDLSRKK-----EPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYL--EKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++KI+ +N  +     ++ ++P+W +  +KIK F  G++N L G+YL E   + +D VL+RIYG   E+ +DR  E++NM  L     A +V+  F+NG  Y ++ G + ++  + DE   +LI  E  ++H++  +  ++ KK     E  +F KI+ +   +PD+L ++ ++E+Y  E  ++ E+  E+  L+  L      V FCHND++  N++ + +++++ FID+EYADYN+ AFDIG+HF EFAG++D+DYSLYPD+  Q KW+R YL  EK L          N  +S V +K+V+  Y  VNKF+L +H  W +W+I Q + S IEFD++ YA  R+ EY   K +FL L
Sbjct:   12 DMKIDDKNVSEGALALLQTVKPSWKSEDVKIKVFTDGITNKLVGLYLPE---NPSDTVLVRIYGQNTELFIDRKKELQNMVLLHSAGCAPEVYCSFNNGLCYAFVPGIVGNRDLVRDEKVRKLIAKEMSRIHSIQNAGSINDKKIKISPEAMVFKKIRSWLELVPDHLDNTEQDERYQREIKKRHELEAELSELQGPLEALNSPVVFCHNDILCANLVYDASQDKVVFIDYEYADYNYQAFDIGDHFCEFAGVDDVDYSLYPDKDLQLKWLRTYLECEKELK---------NLPASDVTDKDVEILYVQVNKFALLAHFFWGVWAILQARFSNIEFDFVQYAAQRFGEYFNRKHEFLAL 358          
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Match: A0A1S3IQU0 (ethanolamine kinase 1-like OS=Lingula unguis OX=7574 GN=LOC106166526 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.110e-68
Identity = 132/359 (36.77%), Postives = 218/359 (60.72%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTV--SLDLSRKK-----EPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYL--EKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++KI+ +N  +     ++ ++P+W +  +KIK F  G++N L G+YL +   + +D VL+RIYG   E+ +DR  E++NM  L     A +V+  F+NG  Y ++ G + ++  + DE   +LI  E  ++H++  +  ++ KK     E  +F KI+ +   +PD+L ++ ++E+Y  E  ++ E+  E+  L+  L      V FCHND++  N++ + +++++ FID+EYADYN+ AFDIG+HF EFAG++D+DYSLYPD+  Q KW+R YL  EK L          N  +S V +K+V+  Y  VNKF+L +H  W +W+I Q + S IEFD++ YA  R+ EY   K +FL L
Sbjct:   12 DMKIDDKNVSEGAMALLQTVKPSWKSEDVKIKVFTDGITNKLVGLYLPD---NPSDTVLVRIYGQNTELFIDRKKELQNMVLLHSAGCAPEVYCSFNNGLCYAFVPGVVGNRDLVRDEKVRKLIAKEMSRIHSIQNAGSINDKKIKISPEAMVFKKIRSWLELVPDHLDNTEQDERYQREIKKRHELEAELSELQGPLEALNSPVVFCHNDILCANLVYDASQDKVVFIDYEYADYNYQAFDIGDHFCEFAGVDDVDYSLYPDKDLQLKWLRTYLECEKELK---------NLPASDVTDKDVEILYVQVNKFALLAHFFWGVWAILQARFSNIEFDFVQYAAQRFGEYFNRKNEFLAL 358          
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Match: B3RKE5 (Uncharacterized protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_51652 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 5.984e-67
Identity = 121/350 (34.57%), Postives = 202/350 (57.71%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            ++ ++  N E+     I ++RP W   ++ IK F  G++N + G  L      +  M+LIR+YG   E+ +DR  E++NM  L     A  ++  F+NG  Y ++ G  L  + +SD   YQL   E  K+H +S  + +  +P LF  +++F + +P +  D IKN+K+ ++ P KS + +E++ L+  L K    + +CHNDL+  NI+ N     + FID+EY  +N+  +DI +HF EFAG++++DY+ YP + FQ +W+ +YL++R            G    + + ++ + Y  VN+F+LASH LW IWS+ Q +NS+I+FD+L Y I R+ EY   K  FL+L
Sbjct:   12 DLTVDINNVEESGLKIIHQVRPQWKDENILIKPFTAGITNKIIGYNLQS--NTSYQMLLIRVYGQSTELFIDRQKEIDNMLLLHNAGCAPPLYAIFNNGLCYGFVVGQPLQWQQMSDAAVYQLTAKEVAKIHNIS-TIDQDIQPVLFDTLEKFLSLVPQSFDDPIKNQKFKTQCPNKSALIEEVKMLQDVLLKHDAPIVYCHNDLLCQNIVYNKQNESVTFIDYEYGGFNYAPYDIADHFCEFAGVDEVDYNRYPQKEFQLQWLSIYLQER--------AKLAGKDETITQSQIHQLYVQVNQFALASHYLWGIWSLIQAKNSLIDFDFLQYGITRFNEYYSKKALFLSL 350          
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Match: etnk2 (ethanolamine kinase 1 [Source:NCBI gene;Acc:103041362])

HSP 1 Score: 216.853 bits (551), Expect = 1.162e-66
Identity = 120/353 (33.99%), Postives = 199/353 (56.37%), Query Frame = 3
Query:   84 RFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +FP I ++  N        I+++RP W+ +++K K F  G +N L G Y+D+      D+VL+R+YG   E+++DRD E+++   L     A +++  F+NG  Y+++ G  L  +D+ D    +LI  E  ++H +        +P L+ K++++ + +     D   N +   E P K  + +E+  +++HL++    V  CHNDL+  NII N  +  + FID+EY+ YN+ AFDIGNHFNEFAG+ ++DY+LYP    Q  W++ YL             C+     V ++E++  Y  VNKFSLASH  W  W++ Q + S I+FD+L YA++R+ +Y K K   + L
Sbjct:   38 KFP-IYVDEHNVTDGAMKLIKELRPGWDIDTVKTKLFTDGTTNKLVGCYVDD---SPEDVVLVRVYGNKTELIVDRDNELKSFQVLHANGCAPRLYCTFNNGICYEFMQGDALGTQDVRDPVLLRLIAAEMARIHAIHAHNGCIPKPNLWIKMRKYFSLVATEFTDRASNARIRQEVPSKEVLEQEMTWMKEHLSQLGSPVVLCHNDLLCKNIIYNEKEGHVRFIDYEYSSYNYQAFDIGNHFNEFAGMSELDYNLYPSREMQLDWLQTYLRAY--------KLCSKKGEEVSQREIETLYVQVNKFSLASHFFWGFWALIQAKYSTIDFDFLGYAVLRFNQYFKTKPMVMAL 378          
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Match: etnk1 (ethanolamine kinase 1 [Source:NCBI gene;Acc:103032767])

HSP 1 Score: 214.157 bits (544), Expect = 8.603e-66
Identity = 121/350 (34.57%), Postives = 193/350 (55.14%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            N+ ++  ++       IE++RP W    +K+K F  G++N L G Y+ E      D+VL+RIYG   E+ +DR+ E+++   L  +  A +++  F+NG  Y+++ G  L  + +     ++LI  +  K H +        +  L+ K+ +F + +P    D   NE+  SE P  S + +E+  L ++L++    V  CHNDL+  NII       + FID+EYA YN+ A+DIGNHFNEFAGL ++DYSLYP+   Q +W+R YLE                 + V   EV+  Y  VN+F+LASH  W +W++ Q Q S I+FD+L YA++R+ +Y K K +   L
Sbjct:   19 NVSVDDHDYRPGALRLIEELRPHWKPAEVKMKSFTDGITNKLIGCYVGEA---LQDVVLVRIYGNKTELFVDRENEVKSFRVLQAHRCAPRLYCTFNNGLCYEFLQGMALEPEHIRSPALFRLIARQLAKYHAIHAHNGWVPKSDLWLKMAKFFSLVPTYFQDPEMNERLSSEVPSASCLREELVWLRQNLSELGSPVVLCHNDLLCKNIIYRQAGGNVKFIDYEYAGYNYQAYDIGNHFNEFAGLNEVDYSLYPERRLQLQWLRAYLEAY--------KEYKNQGADVSSDEVEVLYVQVNRFALASHFFWGMWALIQAQYSTIDFDFLGYAVLRFNQYFKMKPEVTAL 357          
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Match: etnk1 (ethanolamine kinase 1 [Source:NCBI gene;Acc:103032767])

HSP 1 Score: 213.772 bits (543), Expect = 1.025e-65
Identity = 121/350 (34.57%), Postives = 193/350 (55.14%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            N+ ++  ++       IE++RP W    +K+K F  G++N L G Y+ E      D+VL+RIYG   E+ +DR+ E+++   L  +  A +++  F+NG  Y+++ G  L  + +     ++LI  +  K H +        +  L+ K+ +F + +P    D   NE+  SE P  S + +E+  L ++L++    V  CHNDL+  NII       + FID+EYA YN+ A+DIGNHFNEFAGL ++DYSLYP+   Q +W+R YLE                 + V   EV+  Y  VN+F+LASH  W +W++ Q Q S I+FD+L YA++R+ +Y K K +   L
Sbjct:   18 NVSVDDHDYRPGALRLIEELRPHWKPAEVKMKSFTDGITNKLIGCYVGEA---LQDVVLVRIYGNKTELFVDRENEVKSFRVLQAHRCAPRLYCTFNNGLCYEFLQGMALEPEHIRSPALFRLIARQLAKYHAIHAHNGWVPKSDLWLKMAKFFSLVPTYFQDPEMNERLSSEVPSASCLREELVWLRQNLSELGSPVVLCHNDLLCKNIIYRQAGGNVKFIDYEYAGYNYQAYDIGNHFNEFAGLNEVDYSLYPERRLQLQWLRAYLEAY--------KEYKNQGADVSSDEVEVLYVQVNRFALASHFFWGMWALIQAQYSTIDFDFLGYAVLRFNQYFKMKPEVTAL 356          
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Match: ENSAMXT00000004848.2 (ethanolamine kinase 2-like [Source:NCBI gene;Acc:103040620])

HSP 1 Score: 206.838 bits (525), Expect = 5.134e-63
Identity = 127/354 (35.88%), Postives = 188/354 (53.11%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKN------EKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEY-QKNKEKF 1124
            +I ++  N    +      +RP W    +++K F  G++N L G Y+  V      +VL+R+YG   E+ +DR  EME    L  +    +++  F NG  Y+++ GT+L    L+    Y+LI  E  KLH++    S   +P L+ K+  +       LL+S         ++  ++ P    + KEIE L +HL      V  CHNDL+  NII N  +  + FID+EYAD+N+ AFDIGNHFNE+AG+ ++DYSLYP +  Q  W+  YL+           SC+G  + V E+EV   Y  V KFSLASH  W  WS+ Q   S I+FD++ YA  R+  Y +K KE F
Sbjct:   16 DICLDENNPGSGITELFRTLRPQWKAEDIQMKVFTEGITNQLLGCYVGSV--GEAGVVLVRVYGKMTELFVDRKREMEMFRLLHAHGCGPRLYCSFQNGICYEFLKGTVLDDPLLTQPAVYRLIAAEMGKLHSIKPQSSSSPQPVLWSKLTNYMQ-----LLNSCAGHETSPWQRPSAKLPSLDTLLKEIEDLRRHLTAVDCPVVLCHNDLLTKNIIYNSAEGVVKFIDYEYADFNYQAFDIGNHFNEYAGVNNVDYSLYPSQELQWDWLTEYLQSL--------RSCSGVDAAVTEREVQELYIKVCKFSLASHFCWGAWSLLQATYSTIDFDFVRYADARFSYYFEKKKEYF 354          
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Match: ENSAMXT00000037056.1 (ethanolamine kinase 2-like [Source:NCBI gene;Acc:103040620])

HSP 1 Score: 201.83 bits (512), Expect = 1.788e-61
Identity = 118/330 (35.76%), Postives = 175/330 (53.03%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYL 1073
            +I ++  N    +      +RP W    +++K F  G++N L G Y+  V      +VL+R+YG   E+ +DR  EME    L  +    +++  F NG  Y+++ GT+L    L+    Y+LI  E  KLH++    S   +P L+ K+  +   L     D+       ++ P    + KEIE L +HL      V  CHNDL+  NII N  +  + FID+EYAD+N+ AFDIGNHFNE+AG+ ++DYSLYP +  Q  W+  YL+           SC+G  + V E+EV   Y  V KFSLASH  W  WS+ Q   S I+FD++
Sbjct:   12 DICLDENNPGSGITELFRTLRPQWKAEDIQMKVFTEGITNQLLGCYVGSV--GEAGVVLVRVYGKMTELFVDRKREMEMFRLLHAHGCGPRLYCSFQNGICYEFLKGTVLDDPLLTQPAVYRLIAAEMGKLHSIKPQSSSSPQPVLWSKLTNYMQLLNSCAGDTDPKRVPSAKLPSLDTLLKEIEDLRRHLTAVDCPVVLCHNDLLTKNIIYNSAEGVVKFIDYEYADFNYQAFDIGNHFNEYAGVNNVDYSLYPSQELQWDWLTEYLQSL--------RSCSGVDAAVTEREVQELYIKVCKFSLASHFCWGAWSLLQATYSTIDFDFV 331          
BLAST of Ethanolamine kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007137.1 (pep scaffold:Pmarinus_7.0:GL477065:64987:73899:-1 gene:ENSPMAG00000006411.1 transcript:ENSPMAT00000007137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 3.287e-27
Identity = 103/354 (29.10%), Postives = 161/354 (45.48%), Query Frame = 3
Query:  159 TWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDM---VLIRIYGEILLDRDIEMEN---MAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-CLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFK---------EIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFC-AFDIGNHFNEFAGLEDIDYS------------LYPDEVFQRKWIRLYLEKRLNSNVVNG-HSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNK 1115
            T   N  +I    GG+SN L+   L E   ++ D    VL+RIYG IL  +D  ++     A L++  L  K++G F  G   +YI    L   +L+       I  +  + H + +  +  KEP  LF  +K +        ++ +   ++  E   ++  FK         E++ L   L      V FCH      ++++    +  N++++  IDFEY  YN+   FDIGNHF E++     DY+             YP    Q  ++R YL +    N +NG  S   N + V E         VN+F+LASH  W +WSI Q   S I+F YL+YA+ R++ Y K K
Sbjct:   61 TLQENEFQISIISGGLSNFLYLCALPEGKQNSRDEPRNVLLRIYGRILQGQDALVQESVMFAILAERMLGPKLYGVFPQGRLEEYIPSRRLRTAELALPQVSAEIATKLARFHEMKMPFN--KEPKWLFSTMKSY--------MEQVMQLEFAKE--PQARKFKHLMSFNLPHEMKVLGNLLAATPSPVVFCHNDCQEGNILLLEDEVKANEDKLMIIDFEYCSYNYSRGFDIGNHFCEWS----YDYTHDVWPFFTANLDKYPSREQQLHFLRHYLAETQAGNHMNGCSSAPENHAIVVE---------VNRFALASHFFWGLWSILQAHMSTIQFGYLDYALARFEAYFKQK 389          
BLAST of Ethanolamine kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010390.1 (pep scaffold:Pmarinus_7.0:GL482471:567843:581088:1 gene:ENSPMAG00000009408.1 transcript:ENSPMAT00000010390.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 3.719e-21
Identity = 84/290 (28.97%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  324 AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-CLFHKIKEFAN-CLPDNLLDSIKNEKY--LSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHX------XXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSL------------YPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFL 1127
            A L++  L  K++G F  G   QYI    L  ++L        I  +    H + +  +  KEP  LF  +  + +  +  N    ++  K+  L  F     + +E++ L+  L +    V FCHN           N   +    R+  IDFEY+ YN+  FDIGNHF E+      DYS             YP    Q  +IR YL            +  G+   +D  + +     VN+F+LASH  W +W+I Q + S IEF YL YA+ R++ Y   K+KF+
Sbjct:   14 AILAERALGPKLYGIFPQGRLEQYIPSRKLATEELWVPELSAQIATKMGHFHLMQMPFN--KEPRWLFDTMTRYLDQVMTLNFSREVQIRKFNKLLAF----NLVQEMDSLKALLAETLSPVVFCHNDCQEGNTTCQLNEEDSTASARLMIIDFEYSSYNYRGFDIGNHFCEWM----FDYSQPSWPFFKTNVENYPSREQQLLFIRQYL------------AACGDDDDIDLNKEEAMLVEVNRFALASHFFWGLWAIIQAKISTIEFGYLEYALARFETYFAQKKKFV 281          
BLAST of Ethanolamine kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007596.1 (pep scaffold:Pmarinus_7.0:GL485298:271:18761:-1 gene:ENSPMAG00000006853.1 transcript:ENSPMAT00000007596.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 6.460e-12
Identity = 67/244 (27.46%), Postives = 105/244 (43.03%), Query Frame = 3
Query:  183 IKKFYGGVSNLLFGVYLDEVYTDTTDM------VLIRIYGEILLD--------------------RDIEMENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-CLFHKIKEFAN-CLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCH----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEF 812
            I    GG+SNLL+   L    +D   M      VL+R+YG IL                      R + +E++  A L++  L   ++G F  G   ++I    L   DL D     LI  +  + H++ + L+  KEP  L+  I+ + N  +  +  +S K  KY        ++  E++ L   LN     V FCH       ++     +    ++  IDFEY  YN+  FDIGNHF E+
Sbjct:   29 ISVVTGGLSNLLYTCMLR---SDVPSMGGEPRQVLLRMYGAILQPIKSSQIPHVPCAVNVWVQDPRSLVLESVMFATLAERKLGPALYGVFPEGRLEEFIPSKRLSCMDLKDPELSALIACKMAQFHSMKVPLN--KEPKWLYDSIERYLNQVMKLDFSESSKMIKYDDLL--ACDLPNELQRLRDILNATPSPVVFCHNDCQEGNILLLDESSEKSKKLMLIDFEYCSYNYRGFDIGNHFCEW 265          
BLAST of Ethanolamine kinase, putative vs. Ensembl Yeast
Match: EKI1 (Ethanolamine kinase; primarily responsible for phosphatidylethanolamine synthesis via the CDP-ethanolamine pathway; exhibits some choline kinase activity, thus contributing to phosphatidylcholine synthesis via the CDP-choline pathway; EKI1 has a paralog, CKI1, that arose from the whole genome duplication [Source:SGD;Acc:S000002554])

HSP 1 Score: 61.2326 bits (147), Expect = 8.789e-11
Identity = 86/347 (24.78%), Postives = 160/347 (46.11%), Query Frame = 3
Query:  165 NTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEIL---LDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLH-KKDLSDEHSYQLIINEFVKLHTVSLDLSRKK---EPCLF------------HK--------IKEFANCLPDN-LLDSIKNEK--YLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXX------XXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDID----YSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQY----QNSVIEFDYL 1073
            N N L + +  G ++N+++ ++   +       +L+RI+G+ +   +DR+ E++ +A LS YDL  K+ G F+NG   +YI G+    + D  D  +   I  +  +LH  ++ L+ K+   +P  +            HK        I E   C   N  L S KN K    ++    S++ +E +  +  +N    +V FCHNDL        +    +++   +  IDFEYA  N   FD+ NH NE+  ++D +    +  + D+  + + I ++ +  +N         N N   +  +EV   Y ++ ++   + L WC+W++ Q     Q  +IE + L
Sbjct:  131 NKNLLTLTQIKGALTNVIYKIHYPNLPP-----LLMRIFGDSIDSVIDREYELKVIARLSFYDLGPKLEGFFENGRFEKYIEGSRTSTQADFIDRDTSIKIAKKLKELH-CTVPLTHKEITDQPSCWTTFDQWIKLIDSHKEWVSNNVNISENLRCSSWNFFLKSFKNYKRWLYNDSAFTSKLLREDD-KDSMINSGLKMV-FCHNDLQHGNLLFKSKGKDDISVGDLTIIDFEYAGPNPVVFDLSNHLNEW--MQDYNDVQSFKSHIDKYPKEEDILVFAQSYIN-------HMNENHVKIASQEVRILYNLIIEWRPCTQLFWCLWALLQSGRLPQRPLIEGEKL 460          
BLAST of Ethanolamine kinase, putative vs. Ensembl Nematostella
Match: ETNK (Probable ethanolamine kinase [Source:UniProtKB/Swiss-Prot;Acc:A7SK27])

HSP 1 Score: 174.866 bits (442), Expect = 2.364e-51
Identity = 115/348 (33.05%), Postives = 191/348 (54.89%), Query Frame = 3
Query:   99 KINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +++ ++    +K  I++I+P  +  +L+  +F  G+SN L G           +++L RIYG   E+ +DR  E+   + L+    A  V+  F+NG  Y ++ G+++  K + D H   LI      LH + L      +P  +  I  F + +PD   D+ K  ++      K+ + +E++ L+  L+K    + F HNDL+  NII N +K+ +  IDFEYA+ N  A+DI NHF E+AG++++DYSLYP +  Q K++  YL++ +    + G      SS    +E+++ Y  VN+F+LA+H  W +W + Q   S I+FD+L YAI R  EY   KEKFL+L
Sbjct:    9 RLDPDDPNTSIKAVIKEIKPELDPENLEFFEFTEGISNKLVGC--RPTGGSDQEILLFRIYGNKTELFIDRKKEIATYSILNPLGYAPPVYATFENGFCYGFMVGSVMCPKTVCDPHISSLIAKHVADLHAIKLQ-EENPQPSWYKAILHFFSIIPDKFPDAAKENRFKEVLASKAYLLEEVKLLKSKLDKLESAIVFAHNDLLCKNIIYNKDKDSVCTIDFEYANPNPIAYDIANHFCEYAGVDEVDYSLYPQKDHQVKFLESYLKRAME---LQGEKDVNPSS----REIEKLYVHVNQFALAAHFFWGVWGLVQAHYSEIDFDFLEYAITRLNEYYLRKEKFLSL 346          
BLAST of Ethanolamine kinase, putative vs. Ensembl Nematostella
Match: EDO43238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ78])

HSP 1 Score: 85.5001 bits (210), Expect = 1.493e-18
Identity = 95/350 (27.14%), Postives = 152/350 (43.43%), Query Frame = 3
Query:  171 NSLKIKKFYGGVSNLLFGVYLDEVYTDTTD---MVLIRIYGEILLD-----RDIEMENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKK----EPCLFHKIKEFANCLPD--NLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXX--------XXXXRIHFIDFEYADYNFCAFDIGNHFNEFA---GLEDIDYSLYPDEVF-----QRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKF 1124
            N    K   GG+SN +F   L E + +       VL RIYG ++         +  EN+  A L++  +A K++  F  G   +++    L   ++    +   I  +  + H +SL L +      E C   +   +A   P+  N L S+    +LS             C           + FCH D+   NI+            +  + FID+EY  YN+  FD+ NHFNE+      E+  Y LY  E+F     Q  +IR YL ++ N      HS +  S   +++ +D     V +F+L S+  W +WS+ Q + S IEF YL YA  R+  Y++ K+K 
Sbjct:   20 NEFGFKVLTGGLSNEIFICNLPEHFAENKQEVRKVLFRIYGRLVGKLISNIHSLVAENVVFALLAEKKIAPKLYAIFPEGRLEEFLQAKSLTVAEIRSAENSVKIARKLREFHGLSLPLGKNPKWFWERC--ERYNAYAYTTPNKYNKLWSLLCTSHLSAC---------FICYRNIAESKAGPILFCHQDIQEGNILSVPRDVDNEGQQQYDLLFIDYEYCGYNYRGFDLANHFNEWMWDYKHEEAPYYLYNPELFPSLEQQLLFIRTYLGEQTNC-----HSQDKISPK-EQELLDE----VQRFALVSNFFWGMWSVVQAKMSNIEFGYLEYAFTRFDSYRRQKKKL 348          
BLAST of Ethanolamine kinase, putative vs. Ensembl Nematostella
Match: EDO28968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Z3])

HSP 1 Score: 70.4774 bits (171), Expect = 1.628e-13
Identity = 82/328 (25.00%), Postives = 141/328 (42.99%), Query Frame = 3
Query:  171 NSLKIKKFYGGVSNLLFGVYLDEVYTDTTD---MVLIRIYGEILLD-----RDIEMENM--AALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKK----EPCLFHKIKEFANCLPDNLLDSI---KNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXR---IHFIDFEYADYNFCAFDIGNHFNEFA---GLEDIDYSLYPDEVF-----QRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDY 1070
            N    K   GG+SN +F   L E + +       VL RIYG ++         +  EN+  A L++  +A K++  F  G   +++    L   ++    +   I  +  + H +SL L +      E C   +   +    P+  ++ I       Y+S    K+   +  +  +     P +   F   D     + ++    +   + FID+EY  YN+  FD+ NHFNE+      E+  Y LY  E+F     Q  +IR YL ++      N HS +  S   +++ +D     V +F+L S+  W +WS+ Q + S IEF Y
Sbjct:   40 NEFGFKVLTGGLSNEIFICNLPEHFAENKQEVRQVLFRIYGRLVGKLISNIHSLVAENVVFALLAEKKIAPKLYAIFPEGRLEEFLQAKSLTVAEIRSAENSVKIARKLREFHGLSLPLGKNPKWFWERC--ERYNAYTYTTPNKYINEILLLVASCYISILLSKNPSDRCFQQFKSRTTVPCNHSLFSVRDKPEPYLHVDNEGQQQYDLLFIDYEYCGYNYRGFDLANHFNEWMWDYKHEEAPYYLYNPELFPSLEQQLLFIRTYLGEQ-----TNCHSPDKISPK-EQELLDE----VQRFALVSNFFWGMWSVVQAKMSNIEFGY 355          
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Match: etnk2 (ethanolamine kinase 2 [Source:NCBI gene;Acc:101173857])

HSP 1 Score: 207.994 bits (528), Expect = 1.708e-63
Identity = 115/335 (34.33%), Postives = 188/335 (56.12%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             I+++RP W++ S+K K F  G +N L G Y+DE      D+VL+R+YG   E+++DRD E+++   L     A +++  F NG  Y+++ G  L  +D+ D    +LI  E  ++H +        +P L+  ++++ + L     +   N +     P K+ + +E+  +++HL+     V  CHNDL+  NII N  +  + FID+EY+ YN+ AFDIGNHFNEFAG+ ++DY LYP    Q  W++ YL        +        S  V  +E++  Y  VNKF+LASH  W  W++ Q + S I+FD+L YA++R+ +Y K K + + L
Sbjct:   33 LIKELRPAWDSGSVKTKFFTDGTTNKLVGCYVDE---SPEDVVLVRVYGNKTELIVDRDNELKSFQVLHANHCAPRLYCSFQNGICYEFMQGDALGPQDVRDPTLLRLIAREMARIHAIHAHNGCIPKPSLWMTMRKYFSLLATEFTEQASNSRIQQRVPSKAVLEEEMVWMKEHLSTLGSPVVLCHNDLLCKNIIYNSKEGHVRFIDYEYSSYNYQAFDIGNHFNEFAGMAELDYGLYPSREMQMVWLKEYL--------MAYKLFTKKSEEVSPRELETLYVQVNKFALASHFFWGFWALIQAKYSSIDFDFLGYAVLRFDQYFKTKPELMAL 356          
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Match: etnk1 (ethanolamine kinase 1 [Source:NCBI gene;Acc:101174551])

HSP 1 Score: 201.06 bits (510), Expect = 4.057e-60
Identity = 117/335 (34.93%), Postives = 187/335 (55.82%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
             ++++RP+W  + +KIK F  G++N L G Y+  V     D+VL+RIYG   E+L+DR+ E+++   L  +  A +++  F+NG  Y+++ G  L  + +  +  ++LI  +  K H +        +  ++ K+ ++   +     +  +N +  S+ P    + KE+  L++ L      V  CHNDL+  NI+ N  +  + FID+EYA YN+ AFDIGNHFNEFAGL ++DYS YPD   Q  W+R YLE              G  S V + EV+  Y  VNKF+LASH  W +W++ Q + S I FD+L YA++R+ +Y K K +   L
Sbjct:   90 LLKELRPSWKPSEVKIKIFTDGITNKLLGCYVGSV---LQDVVLVRIYGNKTELLVDRENEVKSFRVLHAHRCAPQLYCTFNNGLCYEFLQGAALEPQHIRHQPLFRLIARQLAKYHAIHAHNGWVPQSDMWVKMGKYLALISKYRRELDQNHRLSSDVPSLQCLRKELVWLQQSLTVLGSPVVLCHNDLLCKNIVYNQREGSVKFIDYEYAGYNYQAFDIGNHFNEFAGLNEVDYSYYPDRPVQLLWLRSYLEAY--------KQLKGQGSDVTDAEVETLYVQVNKFALASHFFWGLWALIQAEFSTINFDFLGYAVLRFNQYFKMKPEAAAL 413          
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000001541.2 (ethanolamine kinase 1 [Source:NCBI gene;Acc:101175315])

HSP 1 Score: 194.512 bits (493), Expect = 3.533e-58
Identity = 118/352 (33.52%), Postives = 190/352 (53.98%), Query Frame = 3
Query:   93 NIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNL--LDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            +I I+     + +   + K+RP W    +++K F  G++N L G ++  +    +  VL+RI G   ++ + RD E++ +     +    +++  F NG  Y++I G++L    L     Y+LI  E  ++H++    +   EP ++ K+  F   +  +     + K+     + P    +  E+E L+++L++    V  CHNDL+  NII N  +N + FID+EYADYN+ AFDIGNHFNEFAG+ D+DYSLYP    QR W+  YLE   ++         G    V E +V + Y  V KFSLAS+  W +W+I Q + S I+FD+  YA++R   Y + KE FL L
Sbjct:   16 DIHIDEHEPRRGILELLSKLRPHWKAADIQMKAFTEGITNQLIGCFVGSL--QESGCVLVRINGRMTDLYVSRDREVKMLQVFHAHGCGPEIYCTFQNGICYKFIPGSVLEDHLLQQPSIYRLIAAEMGRIHSIQPKHNLPVEPLIWTKMSHFLTLMQSSTKSCPTPKSSAAALDMPGHEVLSAEMESLKRNLSQTGSPVVLCHNDLLTKNIIYNSKENMVKFIDYEYADYNYQAFDIGNHFNEFAGVTDVDYSLYPSMELQRDWLTAYLESYKHN--------TGRDGTVTEADVTQLYIQVCKFSLASNFFWGLWAILQSRFSSIDFDFQRYALMRLNYYFEKKEDFLGL 357          
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Match: etnk1 (ethanolamine kinase 1 [Source:NCBI gene;Acc:101174551])

HSP 1 Score: 189.889 bits (481), Expect = 1.571e-55
Identity = 112/331 (33.84%), Postives = 184/331 (55.59%), Query Frame = 3
Query:  138 FIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYG---EILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYA-IIRWKEYQKNKE 1118
             ++++RP+W  + +KIK F  G++N L G Y+  V     D+VL+RIYG   E+L+DR+ E+++   L  +  A +++  F+NG  Y+++ G  L  + +  +  ++LI  +  K H +        +  ++ K+ ++   +     +  +N +  S+ P    + KE+  L++ L      V  CHNDL+  NI+ N  +  + FID+EYA YN+ AFDIGNHFNEFAGL ++DYS YPD   Q  W+R YLE              G  S V + EV+  Y  VNKF+LASH  W +W++ Q + S I FD+L Y  ++  ++Y  +++
Sbjct:   90 LLKELRPSWKPSEVKIKIFTDGITNKLLGCYVGSV---LQDVVLVRIYGNKTELLVDRENEVKSFRVLHAHRCAPQLYCTFNNGLCYEFLQGAALEPQHIRHQPLFRLIARQLAKYHAIHAHNGWVPQSDMWVKMGKYLALISKYRRELDQNHRLSSDVPSLQCLRKELVWLQQSLTVLGSPVVLCHNDLLCKNIVYNQREGSVKFIDYEYAGYNYQAFDIGNHFNEFAGLNEVDYSYYPDRPVQLLWLRSYLEAY--------KQLKGQGSDVTDAEVETLYVQVNKFALASHFFWGLWALIQAEFSTINFDFLGYVWVLTAEQYTPSRK 409          
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Match: chka (choline kinase alpha [Source:NCBI gene;Acc:101161031])

HSP 1 Score: 107.842 bits (268), Expect = 1.207e-25
Identity = 98/338 (28.99%), Postives = 160/338 (47.34%), Query Frame = 3
Query:  180 KIKKFYGGVSNLLFGVYLDEVYTDTTD---MVLIRIYGEILLDRD---IEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEP-CLFHKIKEFANCLPDNLLDSIKNEKYLSEFPR--KSEVFKEIECLEKHLNKPTHLVTFCH-----XXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFA---GLED-----IDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNG--NSSHVDEKEV-DRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKE 1118
            +I    GG+SN LF   L +      D    VL+R+YG IL   +   +E    A L++ +L  K++G F  G   QY+    L   +LS+      +  +  + H + +  +  KEP  LF  ++++   L   +  +   E +L  F R     + +E+E L+  L      V FCH      ++++     + +K ++  IDFEY+ YN+  FDIGNHF E+      E+      D   YP +  Q  +I  YL +          S  G  N S  D+ ++ +  +  VN+F++ASH  W +WS+ Q + S IEF YL YA  R++ Y + K+
Sbjct:   75 QITVIRGGLSNKLFLCSLPDSLDSVGDEPRSVLLRLYGAILQGAEAMVLESVMFAILAERELGPKLYGIFPQGRLEQYVPSRKLDTWELSEPSISAEVAEKMARFHAMRMPFN--KEPKWLFGTMEKY---LSQVMRLNFTRETHLRRFNRLLALNLPQEMEMLKSLLESTNSPVVFCHNDCQEGNILLLKGRQSSDKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSCEEHPFFRADAQKYPSKTQQLHFIESYLRE----------SDGGFDNLSSADQMKLKEELFVEVNRFAMASHFFWGLWSLIQARLSTIEFGYLEYAKARFEAYFQQKK 397          
BLAST of Ethanolamine kinase, putative vs. Planmine SMEST
Match: SMESG000039272.1 (SMESG000039272.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 353/354 (99.72%), Postives = 353/354 (99.72%), Query Frame = 3
Query:   72 MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDRWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 1133
            MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHNDLVVNNIILNLNKNRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVD WYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL
Sbjct:    1 MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHNDLVVNNIILNLNKNRIHFIDFEYADYNFCAFDIGNHFNEFAGLEDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDCWYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEKFLTL 354          
BLAST of Ethanolamine kinase, putative vs. Planmine SMEST
Match: SMESG000039287.1 (SMESG000039287.1)

HSP 1 Score: 238.039 bits (606), Expect = 8.013e-77
Identity = 119/206 (57.77%), Postives = 159/206 (77.18%), Query Frame = 3
Query:  201 GVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCHXXXXXXXXXXXXXXXRIHFIDFEYADYNFCAFDIGNHFNEFAG 818
            G+SNLLFGVY D+ +T+ TD++L+RIYG  LL+RDIE+E+M  LS  DLA K+WGKF+NGC+YQYIHGTML   +L +    +L+I  FVK HT  L+  R ++P LF K+KE A  +PD   +  KNEKYL +FPRKS + +EI CLE+HL++  + + FCHNDL+V+NII+N +++R+HFIDFEY+DYN+  FDIGNHFNEFAG
Sbjct:    2 GISNLLFGVYYDDNFTEKTDLILVRIYGRTLLNRDIEIEHMGMLSNLDLAPKIWGKFENGCAYQYIHGTMLTVDELREGSYNKLVIEVFVKFHTAKLNFKRPRQPFLFIKMKELAEGIPDQFENVEKNEKYLLKFPRKSTLIQEISCLEEHLSRSDYPIAFCHNDLLVHNIIINFSRDRVHFIDFEYSDYNYIGFDIGNHFNEFAG 207          
BLAST of Ethanolamine kinase, putative vs. Planmine SMEST
Match: SMESG000039275.1 (SMESG000039275.1)

HSP 1 Score: 234.187 bits (596), Expect = 1.291e-75
Identity = 114/206 (55.34%), Postives = 152/206 (73.79%), Query Frame = 3
Query:   72 MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCH 689
            MT S+F +I IN++NF +DVK  I++IRP WNTN+LKIKKF  G+SNLLFGVY D+ +T+ TD++L+RIYG  LL+RDIE+E+M  LS  DLA K+WGKF+NGC+YQYIHGTML   +L +    +LII  FVK HT  L+  R ++P LF K+KE A  +PD   +  KNEKYL +FPRKS + +EI  LE+HL++  + + FCH
Sbjct:    1 MTISKF-SININSDNFYEDVKPLIKEIRPFWNTNNLKIKKFDMGISNLLFGVYYDDNFTEKTDLILVRIYGRTLLNRDIEIEHMGMLSNLDLAPKIWGKFENGCAYQYIHGTMLTVDELREGSYNKLIIEVFVKFHTAKLNFKRPRQPFLFIKMKELAEGIPDQFENVEKNEKYLLKFPRKSTLIQEISGLEEHLSRSDYPIAFCH 205          
BLAST of Ethanolamine kinase, putative vs. Planmine SMEST
Match: SMESG000039275.1 (SMESG000039275.1)

HSP 1 Score: 234.187 bits (596), Expect = 4.222e-75
Identity = 114/206 (55.34%), Postives = 152/206 (73.79%), Query Frame = 3
Query:   72 MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLFGVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKFDNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCLFHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTHLVTFCH 689
            MT S+F +I IN++NF +DVK  I++IRP WNTN+LKIKKF  G+SNLLFGVY D+ +T+ TD++L+RIYG  LL+RDIE+E+M  LS  DLA K+WGKF+NGC+YQYIHGTML   +L +    +LII  FVK HT  L+  R ++P LF K+KE A  +PD   +  KNEKYL +FPRKS + +EI  LE+HL++  + + FCH
Sbjct:    1 MTISKF-SININSDNFYEDVKPLIKEIRPFWNTNNLKIKKFDMGISNLLFGVYYDDNFTEKTDLILVRIYGRTLLNRDIEIEHMGMLSNLDLAPKIWGKFENGCAYQYIHGTMLTVDELREGSYNKLIIEVFVKFHTAKLNFKRPRQPFLFIKMKELAEGIPDQFENVEKNEKYLLKFPRKSTLIQEISGLEEHLSRSDYPIAFCH 205          
The following BLAST results are available for this feature:
BLAST of Ethanolamine kinase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETNK29.038e-6635.43ethanolamine kinase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
ETNK13.604e-6535.82ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
ETNK13.630e-6435.82ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
ETNK25.010e-5034.09ethanolamine kinase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
ETNK19.376e-5034.24ethanolamine kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckc-11.125e-3529.45Choline Kinase C [Source:UniProtKB/TrEMBL;Acc:Q22... [more]
ckc-13.559e-3029.01Choline Kinase C [Source:UniProtKB/TrEMBL;Acc:Q22... [more]
cka-23.940e-1524.72Choline kinase A2 [Source:UniProtKB/Swiss-Prot;Ac... [more]
cka-25.165e-1524.72Choline kinase A2 [Source:UniProtKB/Swiss-Prot;Ac... [more]
cka-16.672e-1425.89Choline Kinase A [Source:UniProtKB/TrEMBL;Acc:A0A... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eas2.118e-5530.79gene:FBgn0000536 transcript:FBtr0074214[more]
eas2.118e-5530.79gene:FBgn0000536 transcript:FBtr0308619[more]
eas2.118e-5530.79gene:FBgn0000536 transcript:FBtr0343519[more]
eas2.118e-5530.79gene:FBgn0000536 transcript:FBtr0074211[more]
eas2.118e-5530.79gene:FBgn0000536 transcript:FBtr0074212[more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etnk12.916e-6333.14ethanolamine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
etnk21.994e-6233.05ethanolamine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
etnk22.436e-6233.05ethanolamine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
chkb3.341e-2730.70choline kinase beta [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
chka2.915e-2429.85choline kinase alpha [Source:ZFIN;Acc:ZDB-GENE-050... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chkb4.079e-2627.47choline kinase beta [Source:NCBI gene;Acc:10014518... [more]
chka2.145e-2026.51choline kinase alpha [Source:NCBI gene;Acc:496957][more]
chka1.299e-1727.10choline kinase alpha [Source:NCBI gene;Acc:496957][more]
chka1.363e-1725.94choline kinase alpha [Source:NCBI gene;Acc:496957][more]
chka1.500e-1727.10choline kinase alpha [Source:NCBI gene;Acc:496957][more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Etnk21.273e-6736.00ethanolamine kinase 2 [Source:MGI Symbol;Acc:MGI:2... [more]
Etnk12.288e-6435.22ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Etnk22.204e-5938.64ethanolamine kinase 2 [Source:MGI Symbol;Acc:MGI:2... [more]
Etnk12.112e-4834.02ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Etnk12.550e-4833.11ethanolamine kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7MCT6|EKI2_MOUSE8.907e-6736.00Ethanolamine kinase 2 OS=Mus musculus OX=10090 GN=... [more]
sp|D3ZRW8|EKI2_RAT3.319e-6635.82Ethanolamine kinase 2 OS=Rattus norvegicus OX=1011... [more]
sp|Q9NVF9|EKI2_HUMAN4.340e-6535.43Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=E... [more]
sp|Q9D4V0|EKI1_MOUSE1.600e-6335.22Ethanolamine kinase 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9HBU6|EKI1_HUMAN1.743e-6335.82Ethanolamine kinase 1 OS=Homo sapiens OX=9606 GN=E... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443S8E61.774e-7339.03Ethanolamine kinase 1-like protein (Fragment) OS=L... [more]
A0A067QIM26.167e-7038.97Ethanolamine kinase OS=Zootermopsis nevadensis OX=... [more]
A0A1S3J7T79.762e-6937.05ethanolamine kinase 1 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3IQU01.110e-6836.77ethanolamine kinase 1-like OS=Lingula unguis OX=75... [more]
B3RKE55.984e-6734.57Uncharacterized protein OS=Trichoplax adhaerens OX... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etnk21.162e-6633.99ethanolamine kinase 1 [Source:NCBI gene;Acc:103041... [more]
etnk18.603e-6634.57ethanolamine kinase 1 [Source:NCBI gene;Acc:103032... [more]
etnk11.025e-6534.57ethanolamine kinase 1 [Source:NCBI gene;Acc:103032... [more]
ENSAMXT00000004848.25.134e-6335.88ethanolamine kinase 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000037056.11.788e-6135.76ethanolamine kinase 2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007137.13.287e-2729.10pep scaffold:Pmarinus_7.0:GL477065:64987:73899:-1 ... [more]
ENSPMAT00000010390.13.719e-2128.97pep scaffold:Pmarinus_7.0:GL482471:567843:581088:1... [more]
ENSPMAT00000007596.16.460e-1227.46pep scaffold:Pmarinus_7.0:GL485298:271:18761:-1 ge... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
EKI18.789e-1124.78Ethanolamine kinase; primarily responsible for pho... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
ETNK2.364e-5133.05Probable ethanolamine kinase [Source:UniProtKB/Sw... [more]
EDO432381.493e-1827.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289681.628e-1325.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etnk21.708e-6334.33ethanolamine kinase 2 [Source:NCBI gene;Acc:101173... [more]
etnk14.057e-6034.93ethanolamine kinase 1 [Source:NCBI gene;Acc:101174... [more]
ENSORLT00000001541.23.533e-5833.52ethanolamine kinase 1 [Source:NCBI gene;Acc:101175... [more]
etnk11.571e-5533.84ethanolamine kinase 1 [Source:NCBI gene;Acc:101174... [more]
chka1.207e-2528.99choline kinase alpha [Source:NCBI gene;Acc:1011610... [more]
back to top
BLAST of Ethanolamine kinase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039272.10.000e+099.72SMESG000039272.1[more]
SMESG000039287.18.013e-7757.77SMESG000039287.1[more]
SMESG000039275.11.291e-7555.34SMESG000039275.1[more]
SMESG000039275.14.222e-7555.34SMESG000039275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011713 ID=SMED30011713|Name=Ethanolamine kinase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1176bp
TTTCAAAGCCATGATATTTTAATATTTTTAAATCTTTACTATTAACTTTT
GTATTTTTAAGAAGATTTAAAATGACTTTCAGTCGTTTTCCAAATATTAA
AATAAACGCTGAGAATTTTGAAAAAGATGTCAAAGTATTTATAGAAAAAA
TAAGACCAACTTGGAACACGAATTCACTAAAGATTAAAAAATTTTACGGT
GGAGTGTCGAATTTATTATTTGGAGTATATTTGGACGAAGTGTACACAGA
CACCACTGACATGGTCCTCATTCGCATCTACGGAGAAATTCTACTAGATA
GGGATATAGAAATGGAAAATATGGCTGCTTTGTCAAAATACGATTTGGCA
GCAAAAGTCTGGGGAAAATTTGATAACGGATGCTCATATCAATATATTCA
TGGAACAATGTTGCACAAAAAGGATTTGAGTGATGAGCATAGTTATCAAT
TAATTATAAACGAGTTTGTCAAATTACACACAGTCTCACTTGATCTTAGT
AGAAAGAAGGAACCGTGTCTTTTCCATAAAATTAAAGAATTTGCCAACTG
CCTTCCAGATAATTTATTAGACTCTATAAAAAATGAAAAATATTTATCCG
AATTTCCAAGAAAATCTGAAGTTTTTAAAGAAATTGAATGTCTTGAAAAG
CATTTGAACAAACCGACACATCTGGTCACATTCTGTCACAATGATCTTGT
AGTAAATAATATTATATTGAACCTCAATAAAAATAGAATTCATTTTATTG
ATTTCGAATATGCTGATTACAATTTTTGTGCTTTCGATATTGGGAACCAT
TTTAACGAATTTGCAGGATTGGAGGATATAGATTATTCTCTGTATCCTGA
CGAAGTCTTTCAAAGGAAATGGATTCGACTGTATCTTGAGAAACGTCTCA
ATTCGAATGTAGTCAACGGACATTCCTGTAACGGTAACTCTAGTCACGTA
GATGAAAAGGAAGTTGATCGTTGGTATAAAATGGTCAACAAGTTTTCTCT
GGCGTCCCATTTGCTGTGGTGCATTTGGAGCATTTGGCAATATCAGAACT
CAGTTATTGAATTTGATTATTTAAATTACGCAATAATTCGCTGGAAAGAA
TATCAGAAAAATAAAGAAAAATTTTTGACTTTGTAGAATCAATATTGTTA
TTATTTTCTTGATTACTCTTGTGCCC
back to top

protein sequence of SMED30011713-orf-1

>SMED30011713-orf-1 ID=SMED30011713-orf-1|Name=SMED30011713-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MTFSRFPNIKINAENFEKDVKVFIEKIRPTWNTNSLKIKKFYGGVSNLLF
GVYLDEVYTDTTDMVLIRIYGEILLDRDIEMENMAALSKYDLAAKVWGKF
DNGCSYQYIHGTMLHKKDLSDEHSYQLIINEFVKLHTVSLDLSRKKEPCL
FHKIKEFANCLPDNLLDSIKNEKYLSEFPRKSEVFKEIECLEKHLNKPTH
LVTFCHNDLVVNNIILNLNKNRIHFIDFEYADYNFCAFDIGNHFNEFAGL
EDIDYSLYPDEVFQRKWIRLYLEKRLNSNVVNGHSCNGNSSHVDEKEVDR
WYKMVNKFSLASHLLWCIWSIWQYQNSVIEFDYLNYAIIRWKEYQKNKEK
FLTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004305ethanolamine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0001701in utero embryonic development
GO:0001890placenta development
GO:0006629lipid metabolic process
GO:0006646phosphatidylethanolamine biosynthetic process
GO:0008654phospholipid biosynthetic process
GO:0009791post-embryonic development
GO:0016310phosphorylation
GO:0035264multicellular organism growth
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component