Neural cell adhesion molecule 1

Overview
NameNeural cell adhesion molecule 1
Smed IDSMED30011708
Length (bp)1483
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neural cell adhesion molecule 1 (SMED30011708) t-SNE clustered cells

Violin plots show distribution of expression levels for Neural cell adhesion molecule 1 (SMED30011708) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neural cell adhesion molecule 1 (SMED30011708) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neural cell adhesion molecule 1 (SMED30011708) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011708SMESG000003089.1 SMESG000077686.1 Contig51278newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011708SMESG000003089.1 SMESG000077686.1 Contig51278uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011708SMESG000077686.1 dd_Smed_v4_3768_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 78.5666 bits (192), Expect = 1.452e-14
Identity = 81/317 (25.55%), Postives = 128/317 (40.38%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            V ++++VPP       A+   +  V +    V+ CT   +P   +I W K     +    +P   G        Y+I      +S  +EIL  +  +AG Y C    +A   +A    TL + + P I     +  V     I L C A G P+P + W++ G N N       VL S  + +S+   +DAG Y C A+N  G+   K  L+V   PV  I+P+       +   + L+C     P P   DI W           GR  ++++    Q       +  A +   D   Y+C A N  G+ S+S   
Sbjct: 3889 VDLTVQVPPS-----IADEPTDFLVTKHAPAVITCTASGVPFP-SIHWTK-----NGIRLLPRGDG--------YRI-----LSSGAIEILATQLNHAGRYTCVARNAAG--SAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFITWQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV--ISPHLKEYVIAVDKPITLSCEADGLPPP---DITWHKD--------GRAIVESIR---QRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKL 4163          

HSP 2 Score: 70.8626 bits (172), Expect = 4.173e-12
Identity = 60/243 (24.69%), Postives = 101/243 (41.56%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMV----QLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            + I+  + +   +Y C     A V N      L +F  P +  +    ++    G   +++CI +G PAP + W R G    +  +  V  +   + L +   +D+G Y C A NE G   + F L V   P I    NG+  ++ +  +V    +LTC+    P P  + +K      QT        ++TL   +     +LRI  AQ++D     Y+C A++  G        R    PN
Sbjct: 3398 IRIVRAQVSDVAVYTCVASNRAGVDNK--HYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHI----NGSEEHEEISVIVNNPLELTCIASGIPAPKMTWMKDGRPLPQT------DQVQTLGGGE-----VLRISTAQVEDTG--RYTCLASSPAGDDDKEYLVRVHVPPN 3621          

HSP 3 Score: 70.4774 bits (171), Expect = 5.092e-12
Identity = 86/323 (26.63%), Postives = 129/323 (39.94%), Query Frame = 2
Query:   71 ITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNA-KAERTLMIFDVPQITYTE------FKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +T  V +++ VPPK        G  ++ V+ G  + + C     P    I W K    G ST  V     +++ D +              L I     + AGIY C    + N+    + E TL + + P +   E      F+ +V + + I   C A G P P + W    G     +  G+ +  +   L  + VT  D G Y C A NE G+ ERK+ L V   PVI       N   +L  +  L C V+  P P    I W     Q   +    TI+T+ +       IL+++ A  +D     YSC A N  GT
Sbjct: 1159 VTQAVKLNVHVPPK-----IQRGPKHLKVQVGQRVDIPCNAQGTPLP-VITWSK----GGSTMLVDGEHHVSNPDGT--------------LSIDQATPSDAGIYTC---VATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERV-ANQRIEFPCPAKGTPKPTIKWLH-NGRELTGREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPI---IMWYKDNVQVTESS---TIQTVNNGK-----ILKLFRATPEDAG--RYSCKAINIAGT 1439          

HSP 4 Score: 69.3218 bits (168), Expect = 1.296e-11
Identity = 83/321 (25.86%), Postives = 127/321 (39.56%), Query Frame = 2
Query:  149 MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI--TYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM----VQLTCVVKADPVPSSSDIKWASSKQ-------QTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            + V RG ++ LEC V  +P    + W K  +        P+ K      L    I          L++  +  +  G Y C  +  A + + K +  L +   P I   +   +N  V     ++L+C A+GIP P + W + G   ++  +  ++     + L Q T +DAG Y C   N  G E + F LSV   P I     G N  + +       V LTC V  +PVP   +I W    Q         I +GGRF               L+I   Q+       Y+C A++  G  S S  F  + F +P I G
Sbjct: 2302 IIVTRGKSISLECEVQGIPPP-TVTWMKDGH--------PLIKAKGVEILDEGHI----------LQLKNIHVSDTGRYVCVAVNVAGMTDKKYD--LSVHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIV----GENTLEDVKVKEKQSVTLTCEVTGNPVP---EITWHKDGQPLQEDEAHHIISGGRF---------------LQITNVQVPHTG--RYTCLASSPAGHKSRS--FSLNVFVSPTIAG 2575          

HSP 5 Score: 65.855 bits (159), Expect = 1.517e-10
Identity = 76/316 (24.05%), Postives = 121/316 (38.29%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFA---NGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-ITPNGNNAYQ--MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            V +++ V P+ F  Q     +  + + V  G  + L C V ++P    I W K     ++    P +   T       KI + +  +S             G+Y C     A  V    +  L +   P+I       KV  G+ + + C A G P P++ W + G    +     V      +++ Q T  DAG+Y C A N  G++E +  L V   P +  + P  N  +Q  +    ++  C  K  P P+   IKW  + ++   TG    I  L   D     I  + P      D   Y C A N  GT
Sbjct: 1064 VQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPP-IITWAK-----ETQLISPFSPRHTFLPSGSMKITETRTSDS-------------GMYLCVATNIAGNVTQAVK--LNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPT---IKWLHNGRE--LTGREPGISILE--DGTLLVIASVTP-----YDNGEYICVAVNEAGT 1346          

HSP 6 Score: 65.4698 bits (158), Expect = 2.124e-10
Identity = 63/232 (27.16%), Postives = 94/232 (40.52%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVL--YSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            AGIY C    SA     K   TL   + P++   + +  V  G    + C  +GIP P V W +  G+  +  +T +++      + + +    DAG Y C A NE G    K  L V   PV    P   +    +G  V L C V+  P P+   IKW       I +   F++ +++        IL ++ +     D  TY C A N  G   S  T   +    PLI
Sbjct:  676 AGIYGCLASNSAGT--DKQNSTLRYIEAPKLMVVQSELLVALGDITVMECKTSGIPPPQVKWFK--GDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEP--ADVSMEIGSNVTLPCYVQGYPEPT---IKWRRLDNMPIFS-RPFSVSSISQLRTGALFILNLWAS-----DKGTYICEAENQFGKIQSETTVTVTGLVAPLI 892          

HSP 7 Score: 64.6994 bits (156), Expect = 2.972e-10
Identity = 75/310 (24.19%), Postives = 117/310 (37.74%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            + + +  PP     + A   +N  V   N + LEC     P     ++K       ST+   +N+G                     ++I + + + AGIY C  + SA     +   +L +   P I+ +     V     + L C A GIPAP + W + G   +   N   VL   ++  L+     D G Y C A N  G ++R   L V   P   I     N   ++   V+L C   A P P+   + W           G   +K    +  E   +L+I  AQ+ D     Y+C ATN  G
Sbjct: 1911 IQLHVHEPPS---LEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQI-------------------IDIESAQISDAGIYKCVAINSAGAT--ELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPP--NIMGEEQNVSVLISQAVELLCQSDAIPPPT---LTWLKD--------GHPLLKKPGLSISENRSVLKIEDAQVQDTG--RYTCEATNVAG 2181          

HSP 8 Score: 64.3142 bits (155), Expect = 3.916e-10
Identity = 62/228 (27.19%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSG-KDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  +L I   + +  G+Y C  M +    + K E  + +   P I  +    +V    K + L CIANGIP P + W +     N  +    +  S +V  +++   +DAG Y C A N  G  ++   L V   P +       N   ++   VQL C    +PVP    I W   K   + +G   T  T  +  Q    I+ I  AQ+ D     Y C A N+ G
Sbjct: 1786 NGRKLVIAQAQVSNTGLYRC--MAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPV---ITWY--KDNRLLSGS--TSMTFLNRGQ----IIDIESAQISDAG--IYKCVAINSAG 1998          

HSP 9 Score: 64.3142 bits (155), Expect = 4.984e-10
Identity = 52/195 (26.67%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  278 GLTSYDLSRYKIGQG-------KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVP-QITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS----NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            GL   D++ +K G+        +  +S  L+I  V+   AG Y C    +ANV  + +  T +   VP +I  TE    V+      L C+A+GIP P + W++     N++    +  Y+     ++ L  V  +D+G Y C A N  G +    +L+V   P  T  P   +  +  G  ++L+C     P+P
Sbjct: 4104 GLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQPGDAGHYTC---MAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKK----DNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNK--GEQLRLSCKATGIPLP 4289          

HSP 10 Score: 62.3882 bits (150), Expect = 1.540e-9
Identity = 60/241 (24.90%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM-VQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +LEI++ +E   G Y C     A     K E  +++   P I   +  +   V     + L C   G P P ++W + G   +      ++L   ++ ++Q    + GLY C A N  G  +++F ++V   P  TI  +G +   ++    V L C+    P PS   I W    Q   T  G   I       Q +  +L+I    L+D     Y+C ATNA G     +     + P+
Sbjct: 1696 KLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLV--PPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPP--TIKSSGLSERVVVKYKPVALQCIANGIPNPS---ITWLKDDQPVNTAQGNLKI-------QSSGRVLQIAKTLLEDAG--RYTCVATNAAGETQQHIQLHVHEPPS 1920          

HSP 11 Score: 62.003 bits (149), Expect = 2.367e-9
Identity = 73/323 (22.60%), Postives = 119/323 (36.84%), Query Frame = 2
Query:   89 ISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV--VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            +++ VPP         G  ++ +    + VLEC    +P    I W+K             +  + + + +RY I +        L I +   T  G Y C    +A     + +  L +   P I        V      TL+C A GIP P + WR+ G   N+ +N     +L S  + +   +  D   Y C   N  G ++R   L+V   P I   P      +    ++  TC     P PS   I W  +  + +  G  + I +  +        + I   QL+      Y+C A NA G+    VT    + P
Sbjct: 3707 LTVNVPPN-----IKGGPQSLVILLNKSTVLECIAEGVPTP-RITWRK-------------DGAVLAGNHARYSILENG-----FLHIQSAHVTDTGRYLCMATNAAGTDRRRID--LQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVI--TCTASGVPFPS---IHWTKNGIRLLPRGDGYRILSSGA--------IEILATQLNHAG--RYTCVARNAAGSAHRHVTLHVHEPP 3988          

HSP 12 Score: 60.8474 bits (146), Expect = 4.710e-9
Identity = 66/247 (26.72%), Postives = 106/247 (42.91%), Query Frame = 2
Query:  344 LEILTVEETY---AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV-----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKA-DPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            L +L ++ET    AG Y C  +  A     K   TL +   P          ++ G ++TL C   G P P + WRR+  N  I      V     L +  + +  +   D G Y C AEN++G  + +  ++V+   AP+I I+P+  N  +  G  + L C + A +P+P    IK ++   Q        T+++  S        L I   QL   DG  Y+C A+N  GT + + +      P
Sbjct:  754 LGLLKIQETQDLDAGDYTCVAINEAGRATGKI--TLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRL-DNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVANVIE--GQQLTLPCTLLAGNPIPERRWIKNSAMLLQN----PYITVRSDGS--------LHIERVQLQ--DGGEYTCVASNVAGTNNKTTSVVVHVLP 981          

HSP 13 Score: 59.6918 bits (143), Expect = 1.056e-8
Identity = 60/250 (24.00%), Postives = 101/250 (40.40%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            L++       AG Y+C+ +  A    ++    + +   P I  T F N+V     +D+ L C   G P P + W + G     G+ N+ + + G VL+     L      D G Y C   N  G + +   L++   P I       +   ++  +++L C  +  P+P+   I W    Q  +++     I      D+  +  L I  AQ+   D  TY+C   N  GT   S  F    +  P+I G
Sbjct: 1416 LKLFRATPEDAGRYSCKAINIAGT--SQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLH-----LKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPA---ITWYKDGQPIMSSSQALYI------DKGQY--LHIPRAQVS--DSATYTCHVANVAGTAEKS--FHVDVYVPPMIEG 1643          

HSP 14 Score: 59.3066 bits (142), Expect = 1.724e-8
Identity = 80/255 (31.37%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERT----LMIFDVPQITYTEFKNKV--DSGKDITLSCIANGIPAPIVLWRRIGGNSNII-KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-------ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            LE + +E++  G Y C     AN  NA  E T    L +  +P  T+TE    V  + G+ + LSC A GIP P + W     N+NII  +   V   +++ + +V+ +D+G Y C AEN  G  +    + V   PV         I P G NA         L C VK DP P+   I+W + K   I    R  I+ L +        L IY    +D     Y+C ATN  G    S++  + Q P P+IT
Sbjct: 4226 LENVVLEDS--GFYTC----VAN--NAAGEDTHTVSLTVHVLP--TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTF---NNNIIPAHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAI--------LNCEVKGDPTPT---IQW-NRKGVDIEISHR--IRQLGNGS------LAIYGTVNEDAG--DYTCVATNEAGVVERSMSL-TLQSP-PIIT 4443          

HSP 15 Score: 56.9954 bits (136), Expect = 7.547e-8
Identity = 58/228 (25.44%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-----VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            L I   E +  G Y C  +  A   +      L ++  P I   E +  V++    +TL+C A GIP P + W +   N   I+N+      ++   +++ +++  + D+G Y C A N  G  ++ + LS+   P +      ++   +LG  V+L C     P P    I+W     + I +G    I+  A+        L IY A   D     Y+C ATN  G
Sbjct: 3115 LHIKKAEVSDTGQYVCRAINVAGRDDKNFH--LNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPPPTIAWLK---NHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPL---IQWLKDG-KPIASGETERIRVSANGS-----TLNIYGALTSDTG--KYTCVATNPAG 3326          

HSP 16 Score: 56.6102 bits (135), Expect = 1.064e-7
Identity = 61/253 (24.11%), Postives = 109/253 (43.08%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN----KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN--QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            P    L+I+  + +  G Y C  +  A    +K + +L ++  P I   + ++     V  G  ++L C +N +P P++ W + G    I ++T V + ++   + + +    D G Y C A N  G +++ F L+V   P I   P      + +   V LTC     P P+   I W  + ++ I       ++ L+   +     L+I  +Q  D     Y+C A+N  G  +    F S Q P P + G
Sbjct: 3015 PGGRTLQIIRAKVSDGGEYTCIAINQAG--ESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNG--RMITESTHVEILADGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIE-GPEREVIVETISNPVTLTCDATGIPPPT---IAWLKNHKR-IENSDSLEVRILSGGSK-----LQIARSQHSDSG--NYTCIASNMEGK-AQKYYFLSIQVP-PSVAG 3249          

HSP 17 Score: 56.225 bits (134), Expect = 1.400e-7
Identity = 58/247 (23.48%), Postives = 94/247 (38.06%), Query Frame = 2
Query:  338 IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            +R+    VE+T  G Y C  + S+   +   E  + +   P I  T+    +     + +TL C ++ +P P++ W R G          ++     + ++     D   Y C A N  G   R+F L+V+  P I   P   +   +L     L C+ +  P P    I W            R++I       +  F  L I  A + D     Y C ATNA GT    +  +    P  +  GP
Sbjct: 3584 LRISTAQVEDT--GRYTC--LASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGP--QSLVILLNKSTVLECIAEGVPTPR---ITWRKDGAVLAGNHARYSIL------ENGF--LHIQSAHVTDTG--RYLCMATNAAGTDRRRIDLQ-VHVPPSIAPGP 3810          

HSP 18 Score: 55.8398 bits (133), Expect = 2.006e-7
Identity = 45/187 (24.06%), Postives = 75/187 (40.11%), Query Frame = 2
Query:  491 VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            V +G+++TL C    +P PI+ W +     +        L S  + +++    D+G+Y C A N  G+  +   L+V   P I   P   +    +G  V + C  +  P+P    I W+      +  G         S    T  I +  P+     D   Y+C ATN  GT  + +T    + P
Sbjct: 1091 VLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPK--HLKVQVGQRVDIPCNAQGTPLPV---ITWSKGGSTMLVDGEHH-----VSNPDGTLSIDQATPS-----DAGIYTCVATNIAGTDETEITLHVQEPP 1262          

HSP 19 Score: 55.4546 bits (132), Expect = 2.382e-7
Identity = 51/191 (26.70%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  338 IRLEILTVEETYAGIYACEVMYSANVVNAKAERT--LMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGN--SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQML---GCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGG 883
            +++E   V++T  G Y CE    A  V  K E+   + I+  P I  ++   +  V  G  I+L C ++GIP P ++W++ G    ++ +    ++    Q+ +S     DA LY+C A N  G+ ++++ L V   P  TIT +G++  +++   G  + L C V+  P P+   + W       I   G
Sbjct: 2159 LKIEDAQVQDT--GRYTCE----ATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRP--TITNSGSHPTEIIVTRGKSISLECEVQGIPPPT---VTWMKDGHPLIKAKG 2338          

HSP 20 Score: 54.6842 bits (130), Expect = 4.851e-7
Identity = 60/230 (26.09%), Postives = 94/230 (40.87%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGN--NAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
             L I  V +  +G Y C    S   V  KA   + + + P        N ++  G +  L+C   G P P + W R G +   S+ I+  G    +  + +     +DAG Y C A NE G  ER  +L++   P+IT+ P     NA    G  + L C    +P P+   I W S +  +I+   R  + +  S          +Y A     D   + C A N +G+
Sbjct: 4312 ELVIERVSKEDSGTYVCTAENSVGFV--KAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLG----NGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEPVETVINA----GGKIILNCQATGEPQPT---ITW-SRQGHSISWDDRVNVLSNNS----------LYIADAQKEDTSEFECVARNLMGS 4517          

HSP 21 Score: 51.9878 bits (123), Expect = 3.085e-6
Identity = 59/236 (25.00%), Postives = 96/236 (40.68%), Query Frame = 2
Query:  401 YSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGK----------DITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ---VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWAS-----SKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            Y+    NA  E    I    Q+   E  +  D+GK           + L C A G P P++ W +   ++ ++  +  + + N+   + +      DAG+Y C A N  G+ E  ++L V  AP  +I+ + N    ++   V+L C  +  P PS + +K  S     S    + +GGR               IL +  AQ+ D     Y+C A NA G     +  R    PN
Sbjct: 1896 YTCVATNAAGETQQHI----QLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYK---DNRLLSGSTSMTFLNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHVAP--SISGSNNMVAVVVNNPVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVLSGGR---------------ILALTSAQISDTG--RYTCVAVNAAGEKQRDIDLRVYVPPN 2105          

HSP 22 Score: 51.9878 bits (123), Expect = 3.192e-6
Identity = 63/266 (23.68%), Postives = 105/266 (39.47%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMI--FDVPQIT---YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQ 862
            D+ ++I +PP     +  N T ++ V   + + LEC    +P     ++K       S+ A+ I+KG       +Y            L I   + + +  Y C V   ANV    AE++  +  +  P I     T    +V     +TL C A G P+PI+ W + G       N  +     ++ +      D G Y C A +  G +E K+ + V   P I      +    M+  +++L C V   P P+   I W    Q
Sbjct: 1537 DIKLTIYIPPS---IKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKG-------QY------------LHIPRAQVSDSATYTCHV---ANVA-GTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGKKLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPT---IMWLKDGQ 1773          

HSP 23 Score: 51.6026 bits (122), Expect = 3.630e-6
Identity = 62/272 (22.79%), Postives = 103/272 (37.87%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV--------PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP----------VITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW-------ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            P    L+IL  +E  AG Y+C     A  +    E  + I  +        P ++  E K KV++   +TL C A  IP+  + W + G       +  +    + + + +    D G Y C A N  G +E  F +++   P          ++    NG     ++   + L C   A P P+   + W        SS +  I  GGR               +L+I  A+++D     Y+C A N    G  S+ +       P+I G
Sbjct: 2626 PGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNN--TLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPT---LTWYKDGHPLTSSDKVLILPGGR---------------VLQIPRAKVEDAG--RYTCVAVNE--AGEDSLQYDVRVLVPPIIKG 2873          

HSP 24 Score: 51.2174 bits (121), Expect = 5.290e-6
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 2
Query:  515 LSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ--VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            L C   G P+PI++W +   N  + +++ +   +N   + L + T +DAG Y+C A N  G+ ++ F + V   P I  T   N    +L   V L C VK  P P   DI W
Sbjct: 1380 LFCEVEGTPSPIIMWYK--DNVQVTESSTIQTVNNGKILKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFP---DIHW 1487          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 77.411 bits (189), Expect = 1.640e-14
Identity = 79/306 (25.82%), Postives = 128/306 (41.83%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTIN-MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVP---QITYTEFKNKVDSGKDITLSCIANGIPAPIVLW--RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTI-------TTGGRFTIKTLASTDQETFCILRIYPAQLD 961
            V +S+ VPP    +Q   G  + + V+ G+  VL C    +P+   + W K               G       R +  +G Q    RLEI   + +  G+Y+C+V   +NV         +   VP   +   TE  ++V +G  + L+C  +G+PAP V W   R+   S+ +   GVV    ++ LS++    AG Y C AEN      + F ++V  AP I  +      + + G  V+L C     P P  + +K  S   Q +         GG   +K L ++D   +  +   PA  D
Sbjct:   62 VQLSVLVPPA--FRQAPRGPQDAVLVRVGDKAVLSCETDALPEP-TVTWYK--------------DGQPLVLAQRTQALRGGQ----RLEIQEAQVSDKGLYSCKV---SNVAGEAVRTFTLTVQVPPTFENPKTETVSQV-AGSPLVLTCDVSGVPAPTVTWLKDRMPVESSAVH--GVVSRGGRLQLSRLQPAQAGTYTCVAENTQAEARKDFVVAVLVAPRIRSSGVAREHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLRFYLDGGSLVLKGLRASDAGAYTCVAHNPAGED 340          

HSP 2 Score: 63.929 bits (154), Expect = 3.134e-10
Identity = 55/234 (23.50%), Postives = 93/234 (39.74%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-----GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIK-----WASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATN 1000
            P +  L++     + +G+Y CE + +A       + +++   VP       +   D+     G    LSC  + +P P V W + G    + + T  +    ++ + +    D GLY+C   N  G   R F L+V   P     P      Q+ G  + LTC V   P P+ + +K      +S+    ++ GGR  +              R+ PAQ       TY+C A N
Sbjct:   29 PGTHTLQLGRARLSDSGMYTCEALNAAGRDQKLVQLSVL---VPPAFRQAPRGPQDAVLVRVGDKAVLSCETDALPEPTVTWYKDGQPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTFE-NPKTETVSQVAGSPLVLTCDVSGVPAPTVTWLKDRMPVESSAVHGVVSRGGRLQLS-------------RLQPAQAG-----TYTCVAEN 240          

HSP 3 Score: 57.3806 bits (137), Expect = 3.347e-8
Identity = 72/329 (21.88%), Postives = 124/329 (37.69%), Query Frame = 2
Query:   86 SISIEVPPKEFLKQFANGTINMYVK-RGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEF--KNKVDSGKDITLSCIANGIPAPIVLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAY-QMLGCMVQLTCVVKADPVPSSSDIKWASS------KQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            +++++VPP      F N       +  G+ +VL C V  +P    + W K     +S+A      G+ S                 RL++  ++   AG Y C  +       A+ +  + +   P+I  +    ++ V  G+++ L C A+G P P V W + G     ++  +    L    + L  +   DAG Y C A N  G + R   ++V   P I    +G+       G +V + C V+  P      + W          Q+T+  G   T              LRI   QL D     ++C A +  G    + T +
Sbjct:  158 TLTVQVPPT-----FENPKTETVSQVAGSPLVLTCDVSGVPAP-TVTWLKDRMPVESSAV----HGVVS--------------RGGRLQLSRLQPAQAGTYTC--VAENTQAEARKDFVVAVLVAPRIRSSGVAREHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLRFYLDGGSLVLKGLRASDAGAYTCVAHNPAGEDARLHTVNVLVPPTIKQGADGSGTLVSRPGELVTMVCPVRGSP---PIHVSWLKDGLPLPLSQRTLLHGSGHT--------------LRISKVQLADAG--IFTCVAASPAGVADRNFTLQ 441          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 77.0258 bits (188), Expect = 3.287e-14
Identity = 83/298 (27.85%), Postives = 125/298 (41.95%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    P    I W +    GD T  +P++         R  I       S  L I  V +  +G YAC    + + V+A A   +++  +PQ T T     V  G+ +   C A G P P++ W + GG+   +    +VL S  + +S V   D G Y C A N  GS++    L+V     PV    P+       +G  VQL C  + +P P+   I W     Q +T  G+F I     + +    I  + PA     D   Y C A N +G+ S S+  
Sbjct:  346 NTEVLVGESVTLECSATGHPPP-RISWTR----GDRTP-LPVDP--------RVNITP-----SGGLYIQNVVQGDSGEYACSATNNIDSVHATA--FIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTK-GGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVE--VGANVQLPCSSQGEPEPA---ITWNKDGVQ-VTESGKFHI-----SPEGFLTINDVGPA-----DAGRYECVARNTIGSASVSMVL 605          

HSP 2 Score: 56.225 bits (134), Expect = 1.097e-7
Identity = 63/227 (27.75%), Postives = 87/227 (38.33%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ---ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV-VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            L I   +ET  GIY C     A  V  + E TL  F  P            +V  G+ +TL C A G P P + W R G  + +  +  V +  S  + +  V   D+G YAC A N   S      + V   P  T+TP      +  G  V   C  K +P P    I W     Q ++   R  + +  +        LRI    L D     Y C A N +G+
Sbjct:  298 LMIQNTQETDQGIYQCMAKNVAGEVKTQ-EVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRISWTR-GDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDSVHATAFIIVQALPQFTVTPQDRVVIE--GQTVDFQCEAKGNPPPV---IAWTKGGSQ-LSVDRRHLVLSSGT--------LRISGVALHDQG--QYECQAVNIIGS 506          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 76.2554 bits (186), Expect = 6.394e-14
Identity = 83/298 (27.85%), Postives = 125/298 (41.95%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    P    I W +    GD T  +P++         R  I       S  L I  V +  +G YAC    + + V+A A   +++  +PQ T T     V  G+ +   C A G P P++ W + GG+   +    +VL S  + +S V   D G Y C A N  GS++    L+V     PV    P+       +G  VQL C  + +P P+   I W     Q +T  G+F I     + +    I  + PA     D   Y C A N +G+ S S+  
Sbjct:  350 NTEVLVGESVTLECSATGHPPP-RISWTR----GDRTP-LPVD--------PRVNITP-----SGGLYIQNVVQGDSGEYACSATNNIDSVHATA--FIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTK-GGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVE--VGANVQLPCSSQGEPEPA---ITWNKDGVQ-VTESGKFHI-----SPEGFLTINDVGPA-----DAGRYECVARNTIGSASVSMVL 609          

HSP 2 Score: 56.225 bits (134), Expect = 1.302e-7
Identity = 63/227 (27.75%), Postives = 87/227 (38.33%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ---ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV-VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            L I   +ET  GIY C     A  V  + E TL  F  P            +V  G+ +TL C A G P P + W R G  + +  +  V +  S  + +  V   D+G YAC A N   S      + V   P  T+TP      +  G  V   C  K +P P    I W     Q ++   R  + +  +        LRI    L D     Y C A N +G+
Sbjct:  302 LMIQNTQETDQGIYQCMAKNVAGEVKTQ-EVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRISWTR-GDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDSVHATAFIIVQALPQFTVTPQDRVVIE--GQTVDFQCEAKGNPPPV---IAWTKGGSQ-LSVDRRHLVLSSGT--------LRISGVALHDQG--QYECQAVNIIGS 510          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 75.485 bits (184), Expect = 8.411e-14
Identity = 77/272 (28.31%), Postives = 130/272 (47.79%), Query Frame = 2
Query:  272 NKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETY-AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ-VTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQ-FPNPLITG 1069
            N  +T Y  +  K GQ  +  S  +   TV+ TY +   +CEV  +    N    RT+ ++  P++T       VD G D   SC   G P+  ++W + G        +GVVL + + +TL  V  +DAG Y C A     G+ ER+  L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ ST++     L I      D   + Y+C+A N+ G+ +  +  +  +  P  +I G
Sbjct:  276 NPAVTQYRWA--KRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLS--RTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRG--------SGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETI-STEEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 527          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 82.4185 bits (202), Expect = 3.873e-16
Identity = 64/248 (25.81%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYT--EFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ--VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            RL+I  +++T  G Y C+ + +A    A     +++   P+I     +   ++ + + +TL C+A G P P + W  + G +      G+ + S+   + ++ V+  D G+Y CYAEN  GS+   + + V  APVI+   NG     + G +  + C+V+  P P  S ++   ++ +T   G R+       TD     I+     +   LD   Y CSATN  G+   + T      P  + + P
Sbjct: 3914 RLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLV--PPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWT-LNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVIS---NGGTKQVIEGELAVIECLVEGYPAPQVSWLR-NGNRVETGVQGVRYV------TDGRMLTII-----EARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP 4143          

HSP 2 Score: 70.8626 bits (172), Expect = 1.741e-12
Identity = 77/325 (23.69%), Postives = 127/325 (39.08%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMP----QQGNIFWKK--YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITT--GGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVT 1030
            D S+ +  PP EF     +GT     + G+ + L C +        Q  ++ W K      GD T  V I     S D  +  I Q    N             AG+Y C  +  A   + + +  ++   V  I+  + + +V   +   + C   G P P + W + G      +N  +V     + + +     AG ++C AEN+ G +E +  L V   PV+++    +N  + LG  + L C    +P P    +KWA        +  G R ++K             R+    L   D   Y+C A NA GT  +SV+
Sbjct: 3658 DFSLDVLSPP-EF---DIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDI-----SDDGRKLTISQASLEN-------------AGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSV--KSDNPIKALGETITLFCNASGNPYPQ---LKWAKGGSLIFDSPDGARISLKG-----------ARLDIPHLKKTDVGDYTCQALNAAGTSEASVS 3944          

HSP 3 Score: 65.4698 bits (158), Expect = 6.839e-11
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVD-SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            N  RL IL V E   G Y+C V   A   +   + T++   VP   I   + KNK       +TLSC A G P P + W + G   +I     ++    L  NQ+ ++++   DAG Y C A+N  GS E+   ++V   P I      ++        V ++C V A P    + I W  + +       +F +KT A+         ++Y  +L + D   Y+C ATN  GT      F+ S    P    P
Sbjct: 2247 NDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL---VPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARP---PAKITWLKAGKP--LQSDKF-VKTSANGQ-------KLYLFKLRETDSSKYTCIATNEAGTDKRD--FKVSMLVAPSFDEP 2482          

HSP 4 Score: 60.077 bits (144), Expect = 3.464e-9
Identity = 66/316 (20.89%), Postives = 123/316 (38.92%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            D  + +  PP      F      +  + G+ M+L C   +     +++W  +           +  G+ +   S+Y        N   L +  ++    G Y C  +  A +   K    L++ + P     +    +  GK +TL C A G P P +L+ + G   N  ++  V +  + + +     +  G Y C AEN+ G  E+   + V   P   ++    N     G  + L C     P+  +S +    S+Q      G+  ++  +S+D+    I++  P   D     +YSC A N  G G+ +V
Sbjct: 2752 DFLVRVTAPP-----HFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDES--------VQNGVIT---SKYAA------NEKTLNVTNIQLDDEGFYYCTAVNEAGIT--KKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN--ESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPP--KLSKEWINVEVQAGDPLTLEC-----PIEDTSGVHITWSRQ--FGKDGQLDMRAQSSSDKSKLYIMQATPEDAD-----SYSCIAVNDAG-GAEAV 3026          

HSP 5 Score: 60.077 bits (144), Expect = 3.840e-9
Identity = 62/243 (25.51%), Postives = 98/243 (40.33%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            L I  V E + G + C    +A   N     TL +   P I     +       DI L C A  +P P+ LW   G   +S +I +T  +     + L  V  ++ G++ C   N  G +   + L+V   P +I+  P   +  +  G  +++ C  +A  VP      W  +         +F++  L +        LRIY A  +D+    Y+C  TN  GT S   T    Q P P+I
Sbjct: 1143 LTIPNVNEAHRGTFTCHAQNAAG--NDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHT--IREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVK--GFTIEIPC--RATGVPEVIRT-WNKNGIDLKMDEKKFSVDNLGT--------LRIYEADKNDIG--NYNCVVTNEAGT-SQMTTHVDVQEP-PII 1364          

HSP 6 Score: 57.3806 bits (137), Expect = 2.351e-8
Identity = 61/226 (26.99%), Postives = 88/226 (38.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV----VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            ++IL+   +  G Y+C     A   NA  +  L +   P+I        V  G  +TL C A+G+P P + W +   ++ ++ NTGV          V  S ++   AG+Y C AEN   S E    L V   P   + P   N        V L+C     P P    I W       I    ++ I  L +    T  I  + P    D DG  Y C A +  G
Sbjct: 4282 IKILSTRLSDQGEYSCTAANKAG--NATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPP--EVVPERMNVSTNPRQTVFLSCNATGIPEPV---ISWMRDSNIAIQNNEKYQI--LGT----TLAIRNVLP----DDDGF-YHCIAKSDAG 4486          

HSP 7 Score: 56.225 bits (134), Expect = 6.093e-8
Identity = 58/227 (25.55%), Postives = 93/227 (40.97%), Query Frame = 2
Query:  149 MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYAC--EVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVV 808
            M V RG+ +  EC          I W K              K L   D    KI +G+      L I+  ++  AG Y+C  E M   +V  A     L +  VP I  +    +V+  + +TL C+A GIP P + W++  GN   + +       L    + ++    +D G + C A N +G + +   L V+   +PV+   P      +  G  + L+CVV
Sbjct:  711 MMVGRGDRVSFECKTIRGKPHPKIRWFKN------------GKDLIKPD-DYIKINEGQ------LHIMGAKDEDAGAYSCVGENMAGKDVQVAN----LSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQK--GNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE--GQDLTLSCVV 910          

HSP 8 Score: 53.9138 bits (128), Expect = 2.708e-7
Identity = 48/169 (28.40%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            +S  ++I  V  +  G+Y C   Y+ NV  A ++  +   DV Q  +       +V  G+   + C+  G PAP V W R G      ++    V     +T+ +    D+G+Y C A NE GS ++ + L V  +P +IT TP         G    L C V+  P P
Sbjct: 4005 DSTFIQINNVSLSDKGVYTC---YAENV--AGSDNLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSS--GSKFSLPCAVRGYPDP 4166          

HSP 9 Score: 53.5286 bits (127), Expect = 4.085e-7
Identity = 72/314 (22.93%), Postives = 116/314 (36.94%), Query Frame = 2
Query:  116 FLKQFANGTINMYVKR--GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT------YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            + K + + TI+   K   G  ++L+C V   P    + WK+    GD   AVP +        SR+ I      N+  L+I +V    AG Y+C  +  A   N        +   P         Y   +N       IT+ C     P P + W R      +     +    + +T+++    D G Y C A NE G+ +    L +   P I  +    N   ++   + L C +   P P   D+ W  +      T  R  +    + + ETF I  +        D   Y+C+ATN  G  S   + 
Sbjct: 3387 YTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTP-TVTWKR----GDD--AVPND--------SRHTI-----VNNYDLKINSVTTEDAGQYSCIAVNEAG--NLTTHYAAEVIGKPTFVRKGGNLYEVIENDT-----ITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQP---DVIWTKNGMDINMTDSRVIL----AQNNETFGIENVQVT-----DQGRYTCTATNRGGKASHDFSL 3661          

HSP 10 Score: 53.1434 bits (126), Expect = 4.413e-7
Identity = 42/163 (25.77%), Postives = 70/163 (42.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            L +   +++Y+G+Y C+   SA   + + + T+ I + P I+   + F   VD     T+ C   G P P++ W       +     GVV     +T+  V     G + C+A+N  G++ R   L+V   P  TI         +    + L C  KA P P
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAG--DNEQKTTIRIMNTPMISPGQSSFNMVVDDL--FTIPCDVYGDPKPVITWLL----DDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTP--TINAENQEKIALQNDDIVLECPAKALPPP 1208          

HSP 11 Score: 53.1434 bits (126), Expect = 4.725e-7
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMI---FDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS--NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVI 739
            N  +L +  + ET +  Y C     A       + ++++   FD P I     +  V+SG   TL C A G P+P + W + G  + I  N   V +    Q+ +S+    D G Y C A N  GS++ +  L V   PVI
Sbjct: 2437 NGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVR---RITVNSGNPSTLHCPAKGSPSPTITWLKDG--NAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVI 2572          

HSP 12 Score: 52.7582 bits (125), Expect = 6.713e-7
Identity = 64/270 (23.70%), Postives = 108/270 (40.00%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD-SGKDITLSC---IANGIPAPI--VLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQ 865
            D+ + I VPPK          + +  +    + LEC +  +PQ  ++ W K          + IN  +T    SR  + Q    N+    I  V+ T  G Y C          A  + +L +   P+      +  +   G  ITL+C   +A  I   +  V W +     + ++  N  +     ++T+SQ + ++AGLY C A N  G    +F + +   PVI I+ N       +     + C V   P PS   IKW  + ++
Sbjct: 3564 DLILKILVPPKIDKSNIIGNPLAIVAR---TIYLECPISGIPQP-DVIWTK--------NGMDIN--MTD---SRVILAQ----NNETFGIENVQVTDQGRYTCTATNRGG--KASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKWLKNGKE 3807          

HSP 13 Score: 52.373 bits (124), Expect = 8.460e-7
Identity = 49/209 (23.44%), Postives = 81/209 (38.76%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ--DAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS----SSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPA 952
            L I        G Y+C  + S     A A+  + +F  P     E    +  G+   + C  +G P P + W + G   N+     ++L     TL  +  Q  D GLY C A N +G  E+ F ++V   P I  T +      + G  + L C V  +P P+      D    +  + TI       I ++ + D   +  + +  A
Sbjct: 3264 LHIRNATRADEGKYSC--IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNM---DNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETID-QTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEA 3466          

HSP 14 Score: 50.8322 bits (120), Expect = 2.733e-6
Identity = 47/213 (22.07%), Postives = 79/213 (37.09%), Query Frame = 2
Query:  437 TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSK----QQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            T+   D   +      + V  G+   + C+ +G P PI+ W    R I  NS        V   N + + +     +G+Y C A N  G  E+K  + + + P+  I+P  ++   ++  +  + C V  DP P    I W        +  +   G  TI  +    + TF                  +C A NA G  + +VT      P
Sbjct:  994 TISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF----TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPM--ISPGQSSFNMVVDDLFTIPCDVYGDPKPV---ITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTF------------------TCHAQNAAGNDTRTVTLTVHTTP 1179          

HSP 15 Score: 50.8322 bits (120), Expect = 2.780e-6
Identity = 44/163 (26.99%), Postives = 61/163 (37.42%), Query Frame = 2
Query:  374 AGIYACEVM-----YSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            AG Y C V+     YS        E    IF V  ++       V  G+   L C         + W R G       NT     +  + +  VT  DAG+Y C A N  G   RK  L +   P + +TP   + Y  +   V L+C    DP P   ++ W
Sbjct:  494 AGEYECRVISNNGNYSVKTRVETRESPPEIFGVRNVS-------VPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTP--QDVYFNMREGVNLSCEAMGDPKP---EVHW 644          

HSP 16 Score: 49.6766 bits (117), Expect = 5.465e-6
Identity = 71/318 (22.33%), Postives = 127/318 (39.94%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSS 1024
            D+ + + +PPK      +   IN+ V+ G+ + LEC + +     +I W +  +  D    +   +  +S D S+  I Q            T E+  A  Y+C  +  A    A+A   + +   P+I    F   ++ +   + + C   GIP P + W   G    I++  GV      ++L    +     G Y C AEN+ G  E+   + +S  P + +        +  G    + C V  +P P    + W       +  G  +T   L  + + ++  LR    +    DG TY+C ATN  G   ++
Sbjct: 2934 DMMVEVLLPPK-----LSKEWINVEVQAGDPLTLECPIEDT-SGVHITWSRQ-FGKDGQLDM---RAQSSSDKSKLYIMQA-----------TPED--ADSYSCIAVNDAG--GAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG--KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVE--GRQTTIRCEVFGNPEPV---VNW-------LKDGEPYTSDLLQFSTKLSYLHLR----ETTLADGGTYTCIATNKAGESQTT 3208          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 82.4185 bits (202), Expect = 3.908e-16
Identity = 64/248 (25.81%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYT--EFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ--VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            RL+I  +++T  G Y C+ + +A    A     +++   P+I     +   ++ + + +TL C+A G P P + W  + G +      G+ + S+   + ++ V+  D G+Y CYAEN  GS+   + + V  APVI+   NG     + G +  + C+V+  P P  S ++   ++ +T   G R+       TD     I+     +   LD   Y CSATN  G+   + T      P  + + P
Sbjct: 3952 RLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLV--PPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWT-LNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVIS---NGGTKQVIEGELAVIECLVEGYPAPQVSWLR-NGNRVETGVQGVRYV------TDGRMLTII-----EARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP 4181          

HSP 2 Score: 65.855 bits (159), Expect = 6.221e-11
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVD-SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            N  RL IL V E   G Y+C V   A   +   + T++   VP   I   + KNK       +TLSC A G P P + W + G   +I     ++    L  NQ+ ++++   DAG Y C A+N  GS E+   ++V   P I      ++        V ++C V A P    + I W  + +       +F +KT A+         ++Y  +L + D   Y+C ATN  GT      F+ S    P    P
Sbjct: 2247 NDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL---VPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARP---PAKITWLKAGKP--LQSDKF-VKTSANGQ-------KLYLFKLRETDSSKYTCIATNEAGTDKRD--FKVSMLVAPSFDEP 2482          

HSP 3 Score: 63.1586 bits (152), Expect = 3.932e-10
Identity = 48/194 (24.74%), Postives = 81/194 (41.75%), Query Frame = 2
Query:  455 VPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITT--GGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVT 1030
            V  I+  + + +V   +   + C   G P P + W + G      +N  +V     + + +     AG ++C AEN+ G +E +  L V   PV+++    +N  + LG  + L C    +P P    +KWA        +  G R ++K             R+    L   D   Y+C A NA GT  +SV+
Sbjct: 3805 VIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSV--KSDNPIKALGETITLFCNASGNPYPQ---LKWAKGGSLIFDSPDGARISLKG-----------ARLDIPHLKKTDVGDYTCQALNAAGTSEASVS 3982          

HSP 4 Score: 60.077 bits (144), Expect = 3.319e-9
Identity = 66/316 (20.89%), Postives = 123/316 (38.92%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            D  + +  PP      F      +  + G+ M+L C   +     +++W  +           +  G+ +   S+Y        N   L +  ++    G Y C  +  A +   K    L++ + P     +    +  GK +TL C A G P P +L+ + G   N  ++  V +  + + +     +  G Y C AEN+ G  E+   + V   P   ++    N     G  + L C     P+  +S +    S+Q      G+  ++  +S+D+    I++  P   D     +YSC A N  G G+ +V
Sbjct: 2752 DFLVRVTAPP-----HFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDES--------VQNGVIT---SKYAA------NEKTLNVTNIQLDDEGFYYCTAVNEAGIT--KKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN--ESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPP--KLSKEWINVEVQAGDPLTLEC-----PIEDTSGVHITWSRQ--FGKDGQLDMRAQSSSDKSKLYIMQATPEDAD-----SYSCIAVNDAG-GAEAV 3026          

HSP 5 Score: 60.077 bits (144), Expect = 3.907e-9
Identity = 62/243 (25.51%), Postives = 98/243 (40.33%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            L I  V E + G + C    +A   N     TL +   P I     +       DI L C A  +P P+ LW   G   +S +I +T  +     + L  V  ++ G++ C   N  G +   + L+V   P +I+  P   +  +  G  +++ C  +A  VP      W  +         +F++  L +        LRIY A  +D+    Y+C  TN  GT S   T    Q P P+I
Sbjct: 1143 LTIPNVNEAHRGTFTCHAQNAAG--NDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHT--IREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVK--GFTIEIPC--RATGVPEVIRT-WNKNGIDLKMDEKKFSVDNLGT--------LRIYEADKNDIG--NYNCVVTNEAGT-SQMTTHVDVQEP-PII 1364          

HSP 6 Score: 57.3806 bits (137), Expect = 2.413e-8
Identity = 61/226 (26.99%), Postives = 88/226 (38.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV----VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            ++IL+   +  G Y+C     A   NA  +  L +   P+I        V  G  +TL C A+G+P P + W +   ++ ++ NTGV          V  S ++   AG+Y C AEN   S E    L V   P   + P   N        V L+C     P P    I W       I    ++ I  L +    T  I  + P    D DG  Y C A +  G
Sbjct: 4320 IKILSTRLSDQGEYSCTAANKAG--NATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPP--EVVPERMNVSTNPRQTVFLSCNATGIPEPV---ISWMRDSNIAIQNNEKYQI--LGT----TLAIRNVLP----DDDGF-YHCIAKSDAG 4524          

HSP 7 Score: 56.225 bits (134), Expect = 5.939e-8
Identity = 58/227 (25.55%), Postives = 93/227 (40.97%), Query Frame = 2
Query:  149 MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYAC--EVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVV 808
            M V RG+ +  EC          I W K              K L   D    KI +G+      L I+  ++  AG Y+C  E M   +V  A     L +  VP I  +    +V+  + +TL C+A GIP P + W++  GN   + +       L    + ++    +D G + C A N +G + +   L V+   +PV+   P      +  G  + L+CVV
Sbjct:  711 MMVGRGDRVSFECKTIRGKPHPKIRWFKN------------GKDLIKPD-DYIKINEGQ------LHIMGAKDEDAGAYSCVGENMAGKDVQVAN----LSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQK--GNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE--GQDLTLSCVV 910          

HSP 8 Score: 53.9138 bits (128), Expect = 2.731e-7
Identity = 48/169 (28.40%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            +S  ++I  V  +  G+Y C   Y+ NV  A ++  +   DV Q  +       +V  G+   + C+  G PAP V W R G      ++    V     +T+ +    D+G+Y C A NE GS ++ + L V  +P +IT TP         G    L C V+  P P
Sbjct: 4043 DSTFIQINNVSLSDKGVYTC---YAENV--AGSDNLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSS--GSKFSLPCAVRGYPDP 4204          

HSP 9 Score: 53.5286 bits (127), Expect = 3.914e-7
Identity = 72/314 (22.93%), Postives = 116/314 (36.94%), Query Frame = 2
Query:  116 FLKQFANGTINMYVKR--GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT------YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            + K + + TI+   K   G  ++L+C V   P    + WK+    GD   AVP +        SR+ I      N+  L+I +V    AG Y+C  +  A   N        +   P         Y   +N       IT+ C     P P + W R      +     +    + +T+++    D G Y C A NE G+ +    L +   P I  +    N   ++   + L C +   P P   D+ W  +      T  R  +    + + ETF I  +        D   Y+C+ATN  G  S   + 
Sbjct: 3387 YTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTP-TVTWKR----GDD--AVPND--------SRHTI-----VNNYDLKINSVTTEDAGQYSCIAVNEAG--NLTTHYAAEVIGKPTFVRKGGNLYEVIENDT-----ITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQP---DVIWTKNGMDINMTDSRVIL----AQNNETFGIENVQVT-----DQGRYTCTATNRGGKASHDFSL 3661          

HSP 10 Score: 53.1434 bits (126), Expect = 4.451e-7
Identity = 42/163 (25.77%), Postives = 70/163 (42.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            L +   +++Y+G+Y C+   SA   + + + T+ I + P I+   + F   VD     T+ C   G P P++ W       +     GVV     +T+  V     G + C+A+N  G++ R   L+V   P  TI         +    + L C  KA P P
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAG--DNEQKTTIRIMNTPMISPGQSSFNMVVDDL--FTIPCDVYGDPKPVITWLL----DDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTP--TINAENQEKIALQNDDIVLECPAKALPPP 1208          

HSP 11 Score: 53.1434 bits (126), Expect = 4.767e-7
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMI---FDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS--NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVI 739
            N  +L +  + ET +  Y C     A       + ++++   FD P I     +  V+SG   TL C A G P+P + W + G  + I  N   V +    Q+ +S+    D G Y C A N  GS++ +  L V   PVI
Sbjct: 2437 NGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVR---RITVNSGNPSTLHCPAKGSPSPTITWLKDG--NAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVI 2572          

HSP 12 Score: 52.373 bits (124), Expect = 8.533e-7
Identity = 49/209 (23.44%), Postives = 81/209 (38.76%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ--DAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS----SSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPA 952
            L I        G Y+C  + S     A A+  + +F  P     E    +  G+   + C  +G P P + W + G   N+     ++L     TL  +  Q  D GLY C A N +G  E+ F ++V   P I  T +      + G  + L C V  +P P+      D    +  + TI       I ++ + D   +  + +  A
Sbjct: 3264 LHIRNATRADEGKYSC--IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNM---DNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETID-QTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEA 3466          

HSP 13 Score: 50.8322 bits (120), Expect = 2.757e-6
Identity = 47/213 (22.07%), Postives = 79/213 (37.09%), Query Frame = 2
Query:  437 TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSK----QQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            T+   D   +      + V  G+   + C+ +G P PI+ W    R I  NS        V   N + + +     +G+Y C A N  G  E+K  + + + P+  I+P  ++   ++  +  + C V  DP P    I W        +  +   G  TI  +    + TF                  +C A NA G  + +VT      P
Sbjct:  994 TISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF----TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPM--ISPGQSSFNMVVDDLFTIPCDVYGDPKPV---ITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTF------------------TCHAQNAAGNDTRTVTLTVHTTP 1179          

HSP 14 Score: 50.8322 bits (120), Expect = 2.780e-6
Identity = 44/163 (26.99%), Postives = 61/163 (37.42%), Query Frame = 2
Query:  374 AGIYACEVM-----YSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            AG Y C V+     YS        E    IF V  ++       V  G+   L C         + W R G       NT     +  + +  VT  DAG+Y C A N  G   RK  L +   P + +TP   + Y  +   V L+C    DP P   ++ W
Sbjct:  494 AGEYECRVISNNGNYSVKTRVETRESPPEIFGVRNVS-------VPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTP--QDVYFNMREGVNLSCEAMGDPKP---EVHW 644          

HSP 15 Score: 49.6766 bits (117), Expect = 5.017e-6
Identity = 71/318 (22.33%), Postives = 127/318 (39.94%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSS 1024
            D+ + + +PPK      +   IN+ V+ G+ + LEC + +     +I W +  +  D    +   +  +S D S+  I Q            T E+  A  Y+C  +  A    A+A   + +   P+I    F   ++ +   + + C   GIP P + W   G    I++  GV      ++L    +     G Y C AEN+ G  E+   + +S  P + +        +  G    + C V  +P P    + W       +  G  +T   L  + + ++  LR    +    DG TY+C ATN  G   ++
Sbjct: 2934 DMMVEVLLPPK-----LSKEWINVEVQAGDPLTLECPIEDT-SGVHITWSRQ-FGKDGQLDM---RAQSSSDKSKLYIMQA-----------TPED--ADSYSCIAVNDAG--GAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG--KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVE--GRQTTIRCEVFGNPEPV---VNW-------LKDGEPYTSDLLQFSTKLSYLHLR----ETTLADGGTYTCIATNKAGESQTT 3208          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 82.4185 bits (202), Expect = 4.045e-16
Identity = 64/248 (25.81%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYT--EFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ--VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            RL+I  +++T  G Y C+ + +A    A     +++   P+I     +   ++ + + +TL C+A G P P + W  + G +      G+ + S+   + ++ V+  D G+Y CYAEN  GS+   + + V  APVI+   NG     + G +  + C+V+  P P  S ++   ++ +T   G R+       TD     I+     +   LD   Y CSATN  G+   + T      P  + + P
Sbjct: 3914 RLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLV--PPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWT-LNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVIS---NGGTKQVIEGELAVIECLVEGYPAPQVSWLR-NGNRVETGVQGVRYV------TDGRMLTII-----EARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP 4143          

HSP 2 Score: 70.8626 bits (172), Expect = 1.681e-12
Identity = 77/325 (23.69%), Postives = 127/325 (39.08%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMP----QQGNIFWKK--YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITT--GGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVT 1030
            D S+ +  PP EF     +GT     + G+ + L C +        Q  ++ W K      GD T  V I     S D  +  I Q    N             AG+Y C  +  A   + + +  ++   V  I+  + + +V   +   + C   G P P + W + G      +N  +V     + + +     AG ++C AEN+ G +E +  L V   PV+++    +N  + LG  + L C    +P P    +KWA        +  G R ++K             R+    L   D   Y+C A NA GT  +SV+
Sbjct: 3658 DFSLDVLSPP-EF---DIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDI-----SDDGRKLTISQASLEN-------------AGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSV--KSDNPIKALGETITLFCNASGNPYPQ---LKWAKGGSLIFDSPDGARISLKG-----------ARLDIPHLKKTDVGDYTCQALNAAGTSEASVS 3944          

HSP 3 Score: 65.4698 bits (158), Expect = 6.437e-11
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVD-SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            N  RL IL V E   G Y+C V   A   +   + T++   VP   I   + KNK       +TLSC A G P P + W + G   +I     ++    L  NQ+ ++++   DAG Y C A+N  GS E+   ++V   P I      ++        V ++C V A P    + I W  + +       +F +KT A+         ++Y  +L + D   Y+C ATN  GT      F+ S    P    P
Sbjct: 2247 NDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL---VPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARP---PAKITWLKAGKP--LQSDKF-VKTSANGQ-------KLYLFKLRETDSSKYTCIATNEAGTDKRD--FKVSMLVAPSFDEP 2482          

HSP 4 Score: 60.077 bits (144), Expect = 3.318e-9
Identity = 66/316 (20.89%), Postives = 123/316 (38.92%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            D  + +  PP      F      +  + G+ M+L C   +     +++W  +           +  G+ +   S+Y        N   L +  ++    G Y C  +  A +   K    L++ + P     +    +  GK +TL C A G P P +L+ + G   N  ++  V +  + + +     +  G Y C AEN+ G  E+   + V   P   ++    N     G  + L C     P+  +S +    S+Q      G+  ++  +S+D+    I++  P   D     +YSC A N  G G+ +V
Sbjct: 2752 DFLVRVTAPP-----HFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDES--------VQNGVIT---SKYAA------NEKTLNVTNIQLDDEGFYYCTAVNEAGIT--KKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN--ESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPP--KLSKEWINVEVQAGDPLTLEC-----PIEDTSGVHITWSRQ--FGKDGQLDMRAQSSSDKSKLYIMQATPEDAD-----SYSCIAVNDAG-GAEAV 3026          

HSP 5 Score: 60.077 bits (144), Expect = 3.906e-9
Identity = 62/243 (25.51%), Postives = 98/243 (40.33%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            L I  V E + G + C    +A   N     TL +   P I     +       DI L C A  +P P+ LW   G   +S +I +T  +     + L  V  ++ G++ C   N  G +   + L+V   P +I+  P   +  +  G  +++ C  +A  VP      W  +         +F++  L +        LRIY A  +D+    Y+C  TN  GT S   T    Q P P+I
Sbjct: 1143 LTIPNVNEAHRGTFTCHAQNAAG--NDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHT--IREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVK--GFTIEIPC--RATGVPEVIRT-WNKNGIDLKMDEKKFSVDNLGT--------LRIYEADKNDIG--NYNCVVTNEAGT-SQMTTHVDVQEP-PII 1364          

HSP 6 Score: 57.3806 bits (137), Expect = 2.271e-8
Identity = 61/226 (26.99%), Postives = 88/226 (38.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV----VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            ++IL+   +  G Y+C     A   NA  +  L +   P+I        V  G  +TL C A+G+P P + W +   ++ ++ NTGV          V  S ++   AG+Y C AEN   S E    L V   P   + P   N        V L+C     P P    I W       I    ++ I  L +    T  I  + P    D DG  Y C A +  G
Sbjct: 4282 IKILSTRLSDQGEYSCTAANKAG--NATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPP--EVVPERMNVSTNPRQTVFLSCNATGIPEPV---ISWMRDSNIAIQNNEKYQI--LGT----TLAIRNVLP----DDDGF-YHCIAKSDAG 4486          

HSP 7 Score: 56.225 bits (134), Expect = 5.688e-8
Identity = 58/227 (25.55%), Postives = 93/227 (40.97%), Query Frame = 2
Query:  149 MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYAC--EVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVV 808
            M V RG+ +  EC          I W K              K L   D    KI +G+      L I+  ++  AG Y+C  E M   +V  A     L +  VP I  +    +V+  + +TL C+A GIP P + W++  GN   + +       L    + ++    +D G + C A N +G + +   L V+   +PV+   P      +  G  + L+CVV
Sbjct:  711 MMVGRGDRVSFECKTIRGKPHPKIRWFKN------------GKDLIKPD-DYIKINEGQ------LHIMGAKDEDAGAYSCVGENMAGKDVQVAN----LSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQK--GNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE--GQDLTLSCVV 910          

HSP 8 Score: 53.9138 bits (128), Expect = 2.594e-7
Identity = 48/169 (28.40%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ--ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-VITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            +S  ++I  V  +  G+Y C   Y+ NV  A ++  +   DV Q  +       +V  G+   + C+  G PAP V W R G      ++    V     +T+ +    D+G+Y C A NE GS ++ + L V  +P +IT TP         G    L C V+  P P
Sbjct: 4005 DSTFIQINNVSLSDKGVYTC---YAENV--AGSDNLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSS--GSKFSLPCAVRGYPDP 4166          

HSP 9 Score: 53.5286 bits (127), Expect = 3.847e-7
Identity = 72/314 (22.93%), Postives = 116/314 (36.94%), Query Frame = 2
Query:  116 FLKQFANGTINMYVKR--GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT------YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            + K + + TI+   K   G  ++L+C V   P    + WK+    GD   AVP +        SR+ I      N+  L+I +V    AG Y+C  +  A   N        +   P         Y   +N       IT+ C     P P + W R      +     +    + +T+++    D G Y C A NE G+ +    L +   P I  +    N   ++   + L C +   P P   D+ W  +      T  R  +    + + ETF I  +        D   Y+C+ATN  G  S   + 
Sbjct: 3387 YTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTP-TVTWKR----GDD--AVPND--------SRHTI-----VNNYDLKINSVTTEDAGQYSCIAVNEAG--NLTTHYAAEVIGKPTFVRKGGNLYEVIENDT-----ITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQP---DVIWTKNGMDINMTDSRVIL----AQNNETFGIENVQVT-----DQGRYTCTATNRGGKASHDFSL 3661          

HSP 10 Score: 53.1434 bits (126), Expect = 4.374e-7
Identity = 42/163 (25.77%), Postives = 70/163 (42.94%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            L +   +++Y+G+Y C+   SA   + + + T+ I + P I+   + F   VD     T+ C   G P P++ W       +     GVV     +T+  V     G + C+A+N  G++ R   L+V   P  TI         +    + L C  KA P P
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAG--DNEQKTTIRIMNTPMISPGQSSFNMVVDDL--FTIPCDVYGDPKPVITWLL----DDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTP--TINAENQEKIALQNDDIVLECPAKALPPP 1208          

HSP 11 Score: 53.1434 bits (126), Expect = 4.806e-7
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMI---FDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS--NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVI 739
            N  +L +  + ET +  Y C     A       + ++++   FD P I     +  V+SG   TL C A G P+P + W + G  + I  N   V +    Q+ +S+    D G Y C A N  GS++ +  L V   PVI
Sbjct: 2437 NGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVR---RITVNSGNPSTLHCPAKGSPSPTITWLKDG--NAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVI 2572          

HSP 12 Score: 52.7582 bits (125), Expect = 7.127e-7
Identity = 64/270 (23.70%), Postives = 108/270 (40.00%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD-SGKDITLSC---IANGIPAPI--VLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQ 865
            D+ + I VPPK          + +  +    + LEC +  +PQ  ++ W K          + IN  +T    SR  + Q    N+    I  V+ T  G Y C          A  + +L +   P+      +  +   G  ITL+C   +A  I   +  V W +     + ++  N  +     ++T+SQ + ++AGLY C A N  G    +F + +   PVI I+ N       +     + C V   P PS   IKW  + ++
Sbjct: 3564 DLILKILVPPKIDKSNIIGNPLAIVAR---TIYLECPISGIPQP-DVIWTK--------NGMDIN--MTD---SRVILAQ----NNETFGIENVQVTDQGRYTCTATNRGG--KASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKWLKNGKE 3807          

HSP 13 Score: 52.373 bits (124), Expect = 8.244e-7
Identity = 49/209 (23.44%), Postives = 81/209 (38.76%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ--DAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS----SSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPA 952
            L I        G Y+C  + S     A A+  + +F  P     E    +  G+   + C  +G P P + W + G   N+     ++L     TL  +  Q  D GLY C A N +G  E+ F ++V   P I  T +      + G  + L C V  +P P+      D    +  + TI       I ++ + D   +  + +  A
Sbjct: 3264 LHIRNATRADEGKYSC--IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNM---DNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETID-QTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEA 3466          

HSP 14 Score: 50.8322 bits (120), Expect = 2.709e-6
Identity = 44/163 (26.99%), Postives = 61/163 (37.42%), Query Frame = 2
Query:  374 AGIYACEVM-----YSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            AG Y C V+     YS        E    IF V  ++       V  G+   L C         + W R G       NT     +  + +  VT  DAG+Y C A N  G   RK  L +   P + +TP   + Y  +   V L+C    DP P   ++ W
Sbjct:  494 AGEYECRVISNNGNYSVKTRVETRESPPEIFGVRNVS-------VPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTP--QDVYFNMREGVNLSCEAMGDPKP---EVHW 644          

HSP 15 Score: 50.8322 bits (120), Expect = 2.756e-6
Identity = 47/213 (22.07%), Postives = 79/213 (37.09%), Query Frame = 2
Query:  437 TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSK----QQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            T+   D   +      + V  G+   + C+ +G P PI+ W    R I  NS        V   N + + +     +G+Y C A N  G  E+K  + + + P+  I+P  ++   ++  +  + C V  DP P    I W        +  +   G  TI  +    + TF                  +C A NA G  + +VT      P
Sbjct:  994 TISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF----TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPM--ISPGQSSFNMVVDDLFTIPCDVYGDPKPV---ITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTF------------------TCHAQNAAGNDTRTVTLTVHTTP 1179          

HSP 16 Score: 49.6766 bits (117), Expect = 5.280e-6
Identity = 71/318 (22.33%), Postives = 127/318 (39.94%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSS 1024
            D+ + + +PPK      +   IN+ V+ G+ + LEC + +     +I W +  +  D    +   +  +S D S+  I Q            T E+  A  Y+C  +  A    A+A   + +   P+I    F   ++ +   + + C   GIP P + W   G    I++  GV      ++L    +     G Y C AEN+ G  E+   + +S  P + +        +  G    + C V  +P P    + W       +  G  +T   L  + + ++  LR    +    DG TY+C ATN  G   ++
Sbjct: 2934 DMMVEVLLPPK-----LSKEWINVEVQAGDPLTLECPIEDT-SGVHITWSRQ-FGKDGQLDM---RAQSSSDKSKLYIMQA-----------TPED--ADSYSCIAVNDAG--GAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG--KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVE--GRQTTIRCEVFGNPEPV---VNW-------LKDGEPYTSDLLQFSTKLSYLHLR----ETTLADGGTYTCIATNKAGESQTT 3208          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 59.6918 bits (143), Expect = 3.970e-9
Identity = 48/192 (25.00%), Postives = 73/192 (38.02%), Query Frame = 2
Query:  458 PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            PQ TY    N    G ++ ++C   G P P + W   G      +   + L +N + +     +D+G Y C A N  G     F+L +  +    I     +  Q LG  V   C    +PVP   D  W+          GRF +    +        LRI  + ++  D   YSC A N +G  S+    
Sbjct:  315 PQFTYKPRDNSFREGSEVKVNCEVMGNPKPTINWYHNGKRFISSRKRQLGLSNNVLRIYPFLEEDSGRYTCEAVNSVGKVRHAFSLDLISSVPPNIYEGPQSVSQNLGGSVVFVCKANGNPVP---DYTWSFDGSTIGHIKGRFMVSDDGTE-------LRI--SNIEKKDEGYYSCMAGNPVGAMSADAKL 494          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 58.5362 bits (140), Expect = 9.986e-9
Identity = 95/378 (25.13%), Postives = 144/378 (38.10%), Query Frame = 2
Query:   59 SHEQITPDVSISIEVPPKEFLKQ-----FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEI---------LTVEETY---AGIYACEV---------MYSANVVNA--KAERTLMIFDVPQITYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN-------QVTLSQVTYQDAGLYACYAENEWGSEERKF-----------ALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            +H  I    S++++VP +E  K+     F  G ++++  RG++  L+C V   P         +P                  ++  Y+ GQ  + N  R  I         LTV E+     GIY CE            +A+V  A  K E+  M    P     E  +  V  G  I L C   G+P P V W + GG   +I+++    +SN       Q+ +   T  D G Y C A NE GS   K             ++ S  P  T+     +     G  ++L C V A P+P   ++ W       +T   R  I +L+     T  I    P+ + D DG+ Y   ATN  GT     T    + P
Sbjct: 4268 AHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDP---------FP------------------EIKWYRNGQLLR-NGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGP--LIEDSRFE-WSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTL--KMGDVRTTEGQPLKLECKVDASPLP---EMVWYKD-GAIVTPSDRIQI-SLSPDGVATLLI----PSCVYDDDGI-YRVIATNPSGTAQDKGTATVKKLP 4602          

HSP 2 Score: 56.225 bits (134), Expect = 4.968e-8
Identity = 81/343 (23.62%), Postives = 128/343 (37.32%), Query Frame = 2
Query:   92 SIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFD-----------VPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNII-------KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSE--ERKFALSVSHAPVIT---------ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            S+E   ++   +F     +   K    +VLEC V   P+   + W            +  NK +T   ++   + +G +    R+ I + E ++ G Y C  +       +K E  L + D            P+         V   +   L C   G P P + W + G    +        K+ G +     +T   VT  DAG Y C AENE+GS   E    +++  AP I          + P    A   +G    L   +   P PS   +KW  + ++ +    R  I+ L    Q     L +  A+LDD+D   Y C A+N  G   S VT 
Sbjct: 2511 SLEKKSEKKAPEFIVALQDKTTKTSEKVVLECKVIGEPKP-KVSW------------LHDNKTITQESITVESV-EGVE----RVTITSSELSHQGKYTC--IAENTEGTSKTEAFLTVQDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT----LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKP----AVVTVGETAVLEGKISGKPKPS---VKWYKNGEE-LKPSDRVKIENLDDGTQR----LTVTNAKLDDMD--EYRCEASNEFGDVWSDVTL 2815          

HSP 3 Score: 53.5286 bits (127), Expect = 4.196e-7
Identity = 77/324 (23.77%), Postives = 119/324 (36.73%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKK-YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMI--FDVPQITYTEFKNK------VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLY------SNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQ------------MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            +  V  G  + L C V  +P+   +++K   P + DS  ++                 Q ++  +  L I    E   G Y C    +   +N      + +   +V +     F  K       D G   TL C   G P P + W R   N  +++N    +       S  +T+++ T  D G+Y C AEN  G  + +    V  A   T  P  +                 LG ++ L C V   P PS   +KW S     +    RF     AS   +    LRI  A + D +G TY C ATN  G+ ++    R
Sbjct: 4198 DKTVNGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSI-----------------QYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYR---NGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPS---VKW-SKDGGPLIEDSRFEWSNEAS---KGVYQLRIKNATVHD-EG-TYRCVATNENGSATTKSFVR 4492          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Lac (gene:FBgn0010238 transcript:FBtr0087933)

HSP 1 Score: 87.4261 bits (215), Expect = 1.672e-18
Identity = 74/265 (27.92%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  299 SRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERK-FALSVSHAPVITI-TPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRCG 1084
            SR+ +      ++ +L+I  ++ET AG Y C+V+ S  V    AE  L +   P I+    ++ V S G ++ + C A+G P P + WRR   N+ I+         N + +  V  +D G Y C A+N     +R+   + V  APVIT+  P    A Q     + L C ++A P P+   I W     Q +     ++I   A+ D+ T   LR+   +        Y C ATN  G   + V    +  P      P  CG
Sbjct:   83 SRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVIS-TVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRR--ENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQY---DMDLECHIEAYPPPA---IVWTKDDIQ-LANNQHYSISHFATADEYTDSTLRVITVEKRQYGD--YVCKATNRFGEAEARVNLFETIIP----VCPPACG 331          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: DIP-alpha (gene:FBgn0052791 transcript:FBtr0070588)

HSP 1 Score: 85.8853 bits (211), Expect = 1.788e-17
Identity = 88/324 (27.16%), Postives = 141/324 (43.52%), Query Frame = 2
Query:  116 FLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK---VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIK-NTGV-----VLYSNQVTLSQVTYQDAGLYACYAENEW-GSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNP 1057
            F  +F     N+ V  G +    C V ++     + W     K D+ A   I++ + +++  R  +    Q N+  L I  V E   G Y C++    N    K++   +   +P    +E  +    V  G  + L+C A G P PIV WRR  GN  ++K N G            + LS+++  + G Y C A N    S  ++ +LS+   PVI + PN       LG  VQ+ C V+A P    S   W     + I T G++ ++  + +  ET   + +   Q DD+   +Y C A N+LG   SS+  R  + P P
Sbjct:   40 FQPEFVESISNVSVAVGRDATFTCHVRHLGGY-RVGW----LKADTKAIQAIHENVITHN-PRVTVSHLDQ-NTWNLHIKAVSEEDRGGYMCQL----NTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQV-PN-QLVGAPLGTDVQIECHVEASP---KSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVG--SYRCIAKNSLGEVDSSI--RLYEIPGP 343          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: DIP-alpha (gene:FBgn0052791 transcript:FBtr0333795)

HSP 1 Score: 85.8853 bits (211), Expect = 1.788e-17
Identity = 88/324 (27.16%), Postives = 141/324 (43.52%), Query Frame = 2
Query:  116 FLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK---VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIK-NTGV-----VLYSNQVTLSQVTYQDAGLYACYAENEW-GSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNP 1057
            F  +F     N+ V  G +    C V ++     + W     K D+ A   I++ + +++  R  +    Q N+  L I  V E   G Y C++    N    K++   +   +P    +E  +    V  G  + L+C A G P PIV WRR  GN  ++K N G            + LS+++  + G Y C A N    S  ++ +LS+   PVI + PN       LG  VQ+ C V+A P    S   W     + I T G++ ++  + +  ET   + +   Q DD+   +Y C A N+LG   SS+  R  + P P
Sbjct:   40 FQPEFVESISNVSVAVGRDATFTCHVRHLGGY-RVGW----LKADTKAIQAIHENVITHN-PRVTVSHLDQ-NTWNLHIKAVSEEDRGGYMCQL----NTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQV-PN-QLVGAPLGTDVQIECHVEASP---KSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVG--SYRCIAKNSLGEVDSSI--RLYEIPGP 343          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Ama (gene:FBgn0000071 transcript:FBtr0081620)

HSP 1 Score: 77.411 bits (189), Expect = 3.467e-15
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNS----IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK-VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGS-EERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            G+++   CTV  + Q  ++ W K P + D+ + V   + + S    RY +   + P +        I  +E +  G Y C+V+ SA     K + +L I   P I     K+  V  G+++ L+C ANG P P + W R   ++ ++   G +L    + +  V   D G Y C A+N  G  ++R   + V   P I +        QM+    +L C V+  P P+   + W  +    + +     +   AS+   T  +LRI     +D     Y C+ATN LG   + +    +  P P ++
Sbjct:   39 GDSVEFNCTVEEVGQL-SVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTK-KLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAR--EHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAV--QRPKIAQMVSHSAELECSVQGYPAPT---VVWHKNG-VPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGD--YYCNATNKLGHADARLHLFQTVIPVPSLS 333          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Ama (gene:FBgn0000071 transcript:FBtr0081619)

HSP 1 Score: 77.411 bits (189), Expect = 3.467e-15
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNS----IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK-VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGS-EERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            G+++   CTV  + Q  ++ W K P + D+ + V   + + S    RY +   + P +        I  +E +  G Y C+V+ SA     K + +L I   P I     K+  V  G+++ L+C ANG P P + W R   ++ ++   G +L    + +  V   D G Y C A+N  G  ++R   + V   P I +        QM+    +L C V+  P P+   + W  +    + +     +   AS+   T  +LRI     +D     Y C+ATN LG   + +    +  P P ++
Sbjct:   39 GDSVEFNCTVEEVGQL-SVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTK-KLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAR--EHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAV--QRPKIAQMVSHSAELECSVQGYPAPT---VVWHKNG-VPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGD--YYCNATNKLGHADARLHLFQTVIPVPSLS 333          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 81.6481 bits (200), Expect = 9.787e-16
Identity = 85/327 (25.99%), Postives = 131/327 (40.06%), Query Frame = 2
Query:   89 ISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGG--NSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW-------ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            + + VPP+    Q     +N+ V     + L C  F +P    I W K       T  V +  G                     L+I  V+  +AG ++C    SA    AK E T+ +   P I+ T    +V   +G+++ + C  +G P P V W   G   + N   +   +     + +  V  +D GLY C A N  G++ R+F L++  AP+I  +   +    +LG    L C V+  P+P+   I W        SS Q T T GG+                LR+  A+ +D     Y+C ATN  GT     T R
Sbjct: 1333 LKVNVPPE---IQDDGQLLNLTVTLKQPLTLGCDAFGIPTP-TISWTKDNRPVLETPGVYLQNG------------------KRLLKIYRVQHDHAGRFSCTAQNSAG--EAKREYTIEVQAPPVISGTSGVQEVTIMAGQEVDMQCRVSGRPLPSVEWTHDGEVLSPNGDPHVEFLEKGQVLRVKSVRPRDRGLYQCVATNNAGTQTRQFRLTIQAAPLIRDSGEDSEVTVVLGFPAVLHCEVEGIPLPT---ITWLKDNQPIVSSPQLTYTQGGQS---------------LRVAAARGEDAG--AYTCRATNPAGTAHRHYTLR 1615          

HSP 2 Score: 76.2554 bits (186), Expect = 5.261e-14
Identity = 78/299 (26.09%), Postives = 122/299 (40.80%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKI-GQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN-QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            G + VL C V   P   ++ W+K          VP++        +R+ +  +G       L I TV+ +  G Y C V   A   +   +  L ++  P I+   F   V +G+   LSC + GIPAP V WRR G   ++ +++   L S+  + ++  T +D G + C   NE G E R   + +   PVI    +   A +M    V L C     P P    I W  +  Q    GG + +    + +     IL   P+         Y+CSA N +G     VT    + P 
Sbjct: 2687 GQDAVLPCEVEGAPSS-SVMWRK------DGGPVPLHN-------NRFTLLSEGS------LRISTVQLSDVGRYYCSVSNQAGSDHRGMD--LKVYVGPSISPGPFNVTVVTGQRAVLSCESTGIPAPQVSWRRNGSPISVDQSSAYRLMSSGSLVITSPTAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSSVTAVKM--SPVVLPCHATGRPEPV---ISWNKNWMQLGARGGSYRVLPTGALE-----ILAATPSHAGK-----YTCSARNPVGVAYKHVTLTVQEPPE 2948          

HSP 3 Score: 75.8702 bits (185), Expect = 6.426e-14
Identity = 62/224 (27.68%), Postives = 102/224 (45.54%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            L I  V  + +GIY C     A +  A+    L +   P +  TE   +V    G  +TL+C A G+P P + W + G   ++ +N  +     +  LS V   DAGLY+C A N+ GS  + F L+V   P IT + +       +  +++L C+    P P+ S +K            GR     +A  +++   +LRI   Q++D     Y+C A++  G
Sbjct: 2359 LRISPVHLSDSGIYTCVARSRAGL--AELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCEARGVPPPTLSWLKDGQPLSLHRNLLLDGQETRFLLSDVGPSDAGLYSCVASNQAGSSTKTFNLTVLEPPKITGSLSPEEQLIAVDSLLELECIATGLPPPTLSWLK-----------DGRPIQDNMAIIERDGQ-LLRINKVQVEDAG--LYTCLASSPAG 2566          

HSP 4 Score: 72.4034 bits (176), Expect = 7.629e-13
Identity = 66/250 (26.40%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVV-NAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            L+I  V+E  +G Y C    ++N+  ++ A   L +   P  + +        G +ITL CIA G P P ++WRR  G     K++G V    L S  + +  V   D G+Y C A+N++GS +    ++V+      +     +   M+   + L C +  D +P    I W  + +Q +  GGR  +++  S       + R  P      D  TY C+A N  G+ + +VT      P+ +  GP  
Sbjct:  752 LQIRGVQELDSGDYTC---VASNIAGSSSAVVVLQVGAAPTFSESPVDITASVGDNITLPCIARGFPTPSLIWRRQDGRPIFGKSSGHVGTSQLPSGALQIQSVWVDDEGVYLCEAKNQFGSIKALARVTVTGLEPPLLVQGAPSITTMIAQPLNLPCRL-LDGIPLPERI-WTHNGKQ-VRVGGRVFLRSDGS-----LHVDRAVPE-----DAGTYVCTAVNVAGSANITVTVEVHAPPD-IKAGPLH 984          

HSP 5 Score: 72.4034 bits (176), Expect = 8.465e-13
Identity = 63/233 (27.04%), Postives = 96/233 (41.20%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG---VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            LEIL    ++AG Y C       V  A    TL + + P+I     + +V     + L C   G P P + W+R G    +   TG    VL +  +  S+VT  DAG Y C A+NE G+   +  L +   PV+++ P       +LG  V L CV    P P   ++ W   ++  +            S+    F    ++       D   Y+CSA N++G  S  V  
Sbjct: 2911 LEILAATPSHAGKYTCSARNPVGV--AYKHVTLTVQEPPEIRPMAEEVQVVLHHSVVLPCEVQGFPRPTITWQREG----VPVATGHRLAVLSNGALKFSRVTLGDAGTYQCLAQNEAGTALAQTQLILQVPPVLSV-PRLEYVV-VLGQPVSLDCVADGQPKP---EVTWHRDRRPVVD-----------SSHLRLFSNGSLHITATQRGDAGIYTCSARNSVGRASHDVRL 3121          

HSP 6 Score: 69.3218 bits (168), Expect = 6.703e-12
Identity = 85/338 (25.15%), Postives = 127/338 (37.57%), Query Frame = 2
Query:   68 QITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT-YTEFKNKVDSGKD--ITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQET-FCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            Q   D S++I  PP   +       ++  V  G  + LEC     P    + W +              K L + +     I     P+   L  L+V+   +G Y C  + SA         TL     P I+  T    +V + +   +TL C A G P P + W R G    +     ++   + + +S V   D+G+Y C A +  G  E  F L V   P +  T        + G  V LTC  +  P P+   + W    Q           + L    QET F +  + P+     D   YSC A+N    GSS+ TF  +    P ITG
Sbjct: 2193 QTQKDYSLTIYAPPS-IIDSGHPSEVSAPV--GEELALECRAMGSPAP-KVSWLRN------------GKTLVNGNTEHINI----SPDGSTLTFLSVKPEDSGTYTCLAVSSAG--QETKIYTLFALVPPSISGETSVPREVHTTQHSVVTLECKAKGTPQPQISWLRDGHPLLLSPRIRLLSADSTLRISPVHLSDSGIYTCVARSRAGLAELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCEARGVPPPT---LSWLKDGQPLSLH------RNLLLDGQETRFLLSDVGPS-----DAGLYSCVASNQ--AGSSTKTFNLTVLEPPKITG 2492          

HSP 7 Score: 67.781 bits (164), Expect = 2.649e-11
Identity = 59/232 (25.43%), Postives = 98/232 (42.24%), Query Frame = 2
Query:  314 GQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            G G +    +LEI+ V+    G+Y C+V   A  V+     T+ +  V +    E   + + G  ITL C A+GIP P + W + G              +N++ L  +    AG Y C A+N  G  ++ ++L++   P I  + + +     +G  + L C     P P    + W  +  +T+  G    I    S D  T   L + P      D  TY+C A ++ G
Sbjct: 2068 GNGLRIERQQLEIVGVQVADGGVYTCKVSNIAGQVDRTFRVTVHVPPVMEGPLHETLTQ-NLGSHITLICEASGIPVPNIAWLKDGSPIESSLQWNWSTRANRLELGPLQLSHAGTYTCIAKNTEGQTQKDYSLTIYAPPSIIDSGHPSEVSAPVGEELALECRAMGSPAPK---VSWLRNG-KTLVNGNTEHINI--SPDGSTLTFLSVKPE-----DSGTYTCLAVSSAG 2287          

HSP 8 Score: 66.6254 bits (161), Expect = 4.643e-11
Identity = 69/292 (23.63%), Postives = 113/292 (38.70%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTE-----FKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETF-CILR 940
            V++ +  PP         G ++     G  + L C    +P+   I W K    G      P++    + D S Y              I +  E  AG+Y C    ++ V     E  L++   P+I   +      K   + G ++ L C   G P P+V W R G     +     +L S  + +S V   D+ LY C A N  G+    + L V   P I   P+   A  ++G  V L CVV+ +P P    + W  +    + +     I+ +  +D  T+ C+ R
Sbjct:  968 VTVEVHAPPD-----IKAGPLHYTASEGTPISLSCEARGVPKP-TISWSK----GRDPLNRPVSAPFEAADGSLY--------------ISSPTEEDAGVYICTA--TSAVGYTSREMHLIVNSKPRIVGADGSQVTVKMAAEVGSEVILPCEVQGSPTPLVTWSRNGQTIPPVTAWFTMLPSGSLKISDVRVVDSKLYTCSAVNPAGNVSLTYNLQVQAKPRIHPAPSTLKA--LIGQTVVLPCVVQGEPSP---QVSWLHNG-LPVASDRMLKIQAVQHSDSGTYRCVAR 1227          

HSP 9 Score: 65.855 bits (159), Expect = 8.349e-11
Identity = 68/261 (26.05%), Postives = 100/261 (38.31%), Query Frame = 2
Query:  317 QGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI-------TYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQ-----------------------MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            QG Q  S+R+     E+  AG Y C     A    A    TL I   PQI       ++   + KV     +TLSC+A G P P+  W + G   N   ++G+ + S+ + +        G Y C   N  G ++R F L++   PV     NG   +                        +LG  + L+C   A P P    + W    +Q  ++ G      LA        IL+I   QL+D     Y+C A N  G
Sbjct: 1579 QGGQ--SLRVAAARGED--AGAYTCRATNPAG--TAHRHYTLRIMVPPQIEGDSTILSFGRREEKVRINGTLTLSCLAKGFPEPVTQWFKDGQLLNGNTHSGLSVNSHMLHVDNAMLSHEGQYTCVVSNSAGEDKRDFHLTIQVPPVFHRVINGAADFTLGEREGDEEDPDSPDGMVERREVLLGHSISLSCESNAIPPPR---LSWYRQGRQLTSSDG----VVLAPGGH----ILQIPRVQLEDAG--KYTCQAVNEAG 1820          

HSP 10 Score: 65.0846 bits (157), Expect = 1.527e-10
Identity = 55/222 (24.77%), Postives = 92/222 (41.44%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            L I   +   AGIY C    S  V  A  +  L++   PQI   + +  V  G  + L C A G+P P + W + G + + +     +  S  + + +    DAGL+ C A N  GS      L+V+  P     P   +     G  + L+C  +  P P+   I W ++ +        +T  ++  T + +     +  +     DG TY+C A N +G
Sbjct: 3091 LHITATQRGDAGIYTCSARNS--VGRASHDVRLILHTPPQIFVGQSEISVMQGLRVMLPCAAQGVPEPRMSWEKKGVSVSNMPGKFTLRESGGLIIERAEAGDAGLFTCVATNTAGSARWDIRLTVNMRPAFKELP--GDVTLNKGQSLSLSCHAEGTPTPT---ITWTANNRP-------YTGASVDETGRSSVIFDNVTVS-----DGGTYACIAENTVG 3293          

HSP 11 Score: 64.6994 bits (156), Expect = 1.894e-10
Identity = 79/323 (24.46%), Postives = 125/323 (38.70%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            DV + +  PP+ F+     G   + V +G  ++L C    +P+   + W+K   KG S + +P               G+     S  L I   E   AG++ C    +A   +A+ +  L +   P          ++ G+ ++LSC A G P P + W    R   G S  +  TG     + V    VT  D G YAC AEN  G       + V   PV+    + +    + G    L C V  DPVPS   ++W    Q  +   G      L +        L +Y A + D     Y C A +  G    +++ +
Sbjct: 3118 DVRLILHTPPQIFV-----GQSEISVMQGLRVMLPCAAQGVPEP-RMSWEK---KGVSVSNMP---------------GKFTLRESGGLIIERAEAGDAGLFTCVATNTAG--SARWDIRLTVNMRPAFKELPGDVTLNKGQSLSLSCHAEGTPTPTITWTANNRPYTGAS--VDETG----RSSVIFDNVTVSDGGTYACIAENTVGLIRALSFVRVREPPVLRGEAHTSQTV-IQGKSAMLDCAVSGDPVPS---LRWHKDGQPLL---GSLRFHPLRNGS------LALYSAIIGDSG--EYRCVAESEAGAAERTISLK 3393          

HSP 12 Score: 63.5438 bits (153), Expect = 4.930e-10
Identity = 67/238 (28.15%), Postives = 106/238 (44.54%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYT----EFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGC----MVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGS 1018
            R  +  V  + AG+Y+C  + S    ++     L + + P+IT +    E    VDS   + L CIA G+P P + W    R I  N  II+  G +L  N+V +     +DAGLY C A +  G + R   + V   P +     G+N  + +       + L C   +DP P   +I+W     + +  GGR  I+++AS        +R++       D   YSC  TN  G+ S
Sbjct: 2451 RFLLSDVGPSDAGLYSC--VASNQAGSSTKTFNLTVLEPPKITGSLSPEEQLIAVDS--LLELECIATGLPPPTLSWLKDGRPIQDNMAIIERDGQLLRINKVQV-----EDAGLYTCLASSPAGEDGRNHWVRVQLPPTLL----GSNDIRTVSVPAKGHLTLECQTDSDPPP---EIEWYKDNVK-VQLGGR--IQSIASGQFLEIQDVRMH-------DSGQYSCVVTNIAGSTS 2662          

HSP 13 Score: 62.3882 bits (150), Expect = 1.061e-9
Identity = 58/230 (25.22%), Postives = 88/230 (38.26%), Query Frame = 2
Query:  377 GIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP----SSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            G Y C    +A +   +A   L + + P +           G    LSC   G     + W R G           VL ++ + +S V  QDAG Y C A N  G  +    L V  AP + ++P   +    LG  V ++C     P P    S  +I  ++  + +I+  G  TI+  A  D                     Y+C ATN +GT S SV    ++ P+
Sbjct:  491 GAYECVARSTAGM--GRALTQLTVREPPPVLRPPVNVTSSPGTVAVLSCQIQGSVRHNLTWYRTGSALPSRSGRVRVLANSSLEISWVRSQDAGPYQCRASNAHGESQAVVWLVVLEAPSVVVSPQTQSFS--LGAEVHISCSASGSPPPKVFWSHGNIFLSNHHRMSISESGMLTIRGAAPEDSG------------------NYTCLATNEVGTASQSVNVNYAEPPS 698          

HSP 14 Score: 62.3882 bits (150), Expect = 1.197e-9
Identity = 54/185 (29.19%), Postives = 81/185 (43.78%), Query Frame = 2
Query:  482 KNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLY--SNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNG--NNAYQMLGCMVQLTCVVKADPVPSSSDIK-----WASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            + +V  G  I+LSC +N IP P + W R G    +  + GVVL    + + + +V  +DAG Y C A NE G ++  + L V   PVI+   +    +   ++   V L C V   P PS S IK     ++ S+   +  G                 +L I   Q+   DG +Y C A N  G
Sbjct: 1751 RREVLLGHSISLSCESNAIPPPRLSWYRQG--RQLTSSDGVVLAPGGHILQIPRVQLEDAGKYTCQAVNEAGEDKMHYDLEVLVPPVISGQTDEFMQDVDTVVNSTVSLRCDVSGHPSPSVSWIKDGLPLYSDSRHNILEDGK----------------LLEIVNVQVS--DGASYQCVAENKAG 1915          

HSP 15 Score: 61.2326 bits (147), Expect = 2.382e-9
Identity = 63/239 (26.36%), Postives = 89/239 (37.24%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV-----PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP------SSSDIKWASSKQQTITTGGRFTIKTLASTDQETF----------------CILRIYPAQLDDLDGVT 979
            LEI  V    +G Y+C       VV   A  T + F V     P I           G+D  L C   G P+  V+WR+ GG   +  N   +L    + +S V   D G Y C   N+ GS+ R   L V   P  +I+P   N   + G    L+C     P P      + S I    S    + + G   I +  + D+  F                 IL++ P   DD+  VT
Sbjct: 2637 LEIQDVRMHDSGQYSC-------VVTNIAGSTSLFFTVEILLPPVIREGSSLIIAHVGQDAVLPCEVEGAPSSSVMWRKDGGPVPLHNNRFTLLSEGSLRISTVQLSDVGRYYCSVSNQAGSDHRGMDLKVYVGP--SISPGPFNVTVVTGQRAVLSCESTGIPAPQVSWRRNGSPISVDQSSAYRLMSSGSLVITSPTAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSSVT 2866          

HSP 16 Score: 60.4622 bits (145), Expect = 4.739e-9
Identity = 66/271 (24.35%), Postives = 111/271 (40.96%), Query Frame = 2
Query:  275 KGLTSYDLSRYKIGQGKQPNSIR--------LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETF-CILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            +G   ++L+ Y+ G      S R        LEI  V    AG Y C    +     ++A   L++ + P +  +        G ++ +SC A+G P P V W    GN   SN  + +  +  S  +T+     +D+G Y C A NE G+  +  +++V++A   +I+        + G    L C     P P    +KW           G   + T    +Q+     L+I   Q  +LD   Y+C A+N  G+ S+ V  +    P
Sbjct:  540 QGSVRHNLTWYRTGSALPSRSGRVRVLANSSLEISWVRSQDAGPYQCRASNAHG--ESQAVVWLVVLEAPSVVVSPQTQSFSLGAEVHISCSASGSPPPKVFWSH--GNIFLSNHHRMS--ISESGMLTIRGAAPEDSGNYTCLATNEVGTASQ--SVNVNYAEPPSISVVQQMVMVVAGEDASLECQASGTPSPI---VKWQK---------GDLDLGTAPFAEQDVHRGTLQIRGVQ--ELDSGDYTCVASNIAGSSSAVVVLQVGAAP 788          

HSP 17 Score: 56.9954 bits (136), Expect = 4.617e-8
Identity = 67/249 (26.91%), Postives = 102/249 (40.96%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMI-FDVPQITYTEFKNKVD----SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNT-GVVLYSN-QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            L+I  V+ + +G Y C         N+  E T+ I  DV +  Y E   +      +   + + C A G PAP V W + G   ++ ++  GV L  +  + +   +   +G + C A NE GS ERK  L V+  P I       N    L   + L C     P P+   I W    +  + T G +         Q    +L+IY  Q D      +SC+A N+ G      T    Q P P+I+G
Sbjct: 1209 LKIQAVQHSDSGTYRCVAR------NSAGEDTIQIVLDVLEGPYFETNGETVIESVANSKVLIPCPARGSPAPQVRWFKNGLEVHMERSEHGVSLAEDGALVIGSASASHSGDFKCVATNEAGSVERKTRLKVNVPPEIQDDGQLLNLTVTLKQPLTLGCDAFGIPTPT---ISWTKDNRPVLETPGVYL--------QNGKRLLKIYRVQHDHAG--RFSCTAQNSAGEAKREYTIE-VQAP-PVISG 1436          

HSP 18 Score: 56.225 bits (134), Expect = 9.094e-8
Identity = 66/280 (23.57%), Postives = 105/280 (37.50%), Query Frame = 2
Query:  269 INKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAER--TLMIFDVPQIT-YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQ--MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDL-----DGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            I  GL  Y  SR+ I +    +   LEI+ V+ +    Y C     A  V    ER  +L I   P+I    E +  V  G  I+L C     P   ++W + G          ++     + + +   QDAG Y C A N  G +++   L++   P +       +  +  ++G  + L C     P P   ++ W  +  Q     G                 LRI   QL+ +     DG  Y+C  +N    G    TFR +    P++ GP  
Sbjct: 1872 IKDGLPLYSDSRHNILE----DGKLLEIVNVQVSDGASYQCVAENKAGAV----ERLYSLSIQVPPRIVGRREEEMSVVEGHMISLLCDVQAYPPADIIWTKDGQMLEFTTGIHILPGGQMLQIPRAGQQDAGQYVCTATNSAGQDQKSILLTIYALPALVPRLESESEVRTPLVGSTLILRCEANGIPKP---EVTWYRNGLQLAAGNG-----------------LRIERQQLEIVGVQVADGGVYTCKVSNI--AGQVDRTFRVTVHVPPVMEGPLH 2121          

HSP 19 Score: 55.4546 bits (132), Expect = 1.445e-7
Identity = 64/297 (21.55%), Postives = 111/297 (37.37%), Query Frame = 2
Query:  128 FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSC-IANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            F+   +++    G+N+ L C     P   ++ W++               G   +  S   +G  + P+   L+I +V     G+Y CE       + A A  T+   + P +            + + L C + +GIP P  +W     N   ++  G V   +  +L   +   +DAG Y C A N  GS      + V   P I   P    A +  G  + L+C  +  P P+   I W+  +        R       + D        +Y +   + D   Y C+AT+A+G
Sbjct:  790 FSESPVDITASVGDNITLPCIARGFPTP-SLIWRR-------------QDGRPIFGKSSGHVGTSQLPSGA-LQIQSVWVDDEGVYLCEAKNQFGSIKALARVTVTGLEPPLLVQGAPSITTMIAQPLNLPCRLLDGIPLPERIWTH---NGKQVRVGGRVFLRSDGSLHVDRAVPEDAGTYVCTAVNVAGSANITVTVEVHAPPDIKAGPLHYTASE--GTPISLSCEARGVPKPT---ISWSKGRDPL----NRPVSAPFEAADGS------LYISSPTEEDAGVYICTATSAVG 1053          

HSP 20 Score: 55.4546 bits (132), Expect = 1.730e-7
Identity = 56/215 (26.05%), Postives = 89/215 (41.40%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTI--TTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +G Y C  + +  V  A     +   + P I+  +    V +G+D +L C A+G P+PIV W++   +          ++   + +  V   D+G Y C A N  GS      L V  AP  + +P    A   +G  + L C+ +  P PS   + W     + I   + G      L S        L+I    +DD +GV Y C A N  G+
Sbjct:  671 SGNYTC--LATNEVGTASQSVNVNYAEPPSISVVQQMVMVVAGEDASLECQASGTPSPIVKWQKGDLDLGTAPFAEQDVHRGTLQIRGVQELDSGDYTCVASNIAGSSSAVVVLQVGAAPTFSESPVDITAS--VGDNITLPCIARGFPTPS---LIWRRQDGRPIFGKSSGHVGTSQLPSG------ALQIQSVWVDD-EGV-YLCEAKNQFGS 870          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 80.1073 bits (196), Expect = 2.609e-15
Identity = 83/298 (27.85%), Postives = 121/298 (40.60%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV--SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    PQ   + W +    GD +A +P++         R  I       S  L I  + +   G Y C    S NV    A   +++   PQ T T     V  G+ +   C A+G P P++ W R GG+        VVL +  + +S+V   D G Y C A +  G+      L++  S  PV T  P         G  VQ+ C  + +P P    I W+    Q IT  G+F I             L ++   L   DG  Y C A N++G  SSS+  
Sbjct:  342 NTEVLVGESVTLECSATGQPQP-RVTWTR----GDQSA-LPVDP--------RINITP-----SGGLFIQNIHQADGGQYTC--FASNNVDTIHANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTR-GGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVES--GSDVQIPCSAQGEPTPI---ITWSKDGVQ-ITESGKFHINPDG--------YLEVHDVGL--ADGGRYECVARNSIGYSSSSMVL 601          

HSP 2 Score: 56.6102 bits (135), Expect = 6.958e-8
Identity = 53/192 (27.60%), Postives = 75/192 (39.06%), Query Frame = 2
Query:  452 DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ-DAGLYACYAENEWG----SEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +VP+IT       V SG  +  +C A G P P ++W R     N+  +T + L  +   + Q T + D G+Y C A+N  G    SE           P   I P   N   ++G  V L C     P P    + W    Q  +    R  I     T      I  I+ A     DG  Y+C A+N + T
Sbjct:  236 EVPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQP--QNTEVLVGESVTLECSATGQPQPR---VTWTRGDQSALPVDPRINI-----TPSGGLFIQNIHQA-----DGGQYTCFASNNVDT 412          

HSP 3 Score: 56.225 bits (134), Expect = 8.409e-8
Identity = 60/255 (23.53%), Postives = 89/255 (34.90%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIF---DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA-------SSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            L I    ET  G+Y C     A  V   +E TL  F     P         +V  G+ +TL C A G P P V W R   ++  +     +  S  + +  +   D G Y C+A N   +      + V   P  T+TP   +  +  G  V   C     P P    I W        + ++  + + G   I  +A  DQ                    Y C A + +GT  ++V     Q   P+ T   R
Sbjct:  294 LMIQDTRETDQGVYQCMAKNVAGEVKT-SEVTLRYFRSPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTWTRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIVQARPQFTVTPQDQSVLE--GQTVDFPCEASGFPQPV---IAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQ------------------YECQAVSPVGTARAAVHLNILQSVTPVFTSAPR 524          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 80.1073 bits (196), Expect = 2.657e-15
Identity = 83/298 (27.85%), Postives = 121/298 (40.60%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV--SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    PQ   + W +    GD +A +P++         R  I       S  L I  + +   G Y C    S NV    A   +++   PQ T T     V  G+ +   C A+G P P++ W R GG+        VVL +  + +S+V   D G Y C A +  G+      L++  S  PV T  P         G  VQ+ C  + +P P    I W+    Q IT  G+F I             L ++   L   DG  Y C A N++G  SSS+  
Sbjct:  345 NTEVLVGESVTLECSATGQPQP-RVTWTR----GDQSA-LPVDP--------RINITP-----SGGLFIQNIHQADGGQYTC--FASNNVDTIHANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTR-GGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVES--GSDVQIPCSAQGEPTPI---ITWSKDGVQ-ITESGKFHINPDG--------YLEVHDVGL--ADGGRYECVARNSIGYSSSSMVL 604          

HSP 2 Score: 56.6102 bits (135), Expect = 6.960e-8
Identity = 53/192 (27.60%), Postives = 75/192 (39.06%), Query Frame = 2
Query:  452 DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ-DAGLYACYAENEWG----SEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +VP+IT       V SG  +  +C A G P P ++W R     N+  +T + L  +   + Q T + D G+Y C A+N  G    SE           P   I P   N   ++G  V L C     P P    + W    Q  +    R  I     T      I  I+ A     DG  Y+C A+N + T
Sbjct:  239 EVPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQP--QNTEVLVGESVTLECSATGQPQPR---VTWTRGDQSALPVDPRINI-----TPSGGLFIQNIHQA-----DGGQYTCFASNNVDT 415          

HSP 3 Score: 56.225 bits (134), Expect = 7.652e-8
Identity = 60/255 (23.53%), Postives = 89/255 (34.90%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIF---DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA-------SSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            L I    ET  G+Y C     A  V   +E TL  F     P         +V  G+ +TL C A G P P V W R   ++  +     +  S  + +  +   D G Y C+A N   +      + V   P  T+TP   +  +  G  V   C     P P    I W        + ++  + + G   I  +A  DQ                    Y C A + +GT  ++V     Q   P+ T   R
Sbjct:  297 LMIQDTRETDQGVYQCMAKNVAGEVKT-SEVTLRYFRSPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTWTRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIVQARPQFTVTPQDQSVLE--GQTVDFPCEASGFPQPV---IAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQ------------------YECQAVSPVGTARAAVHLNILQSVTPVFTSAPR 527          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 80.1073 bits (196), Expect = 2.889e-15
Identity = 83/298 (27.85%), Postives = 121/298 (40.60%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV--SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    PQ   + W +    GD +A +P++         R  I       S  L I  + +   G Y C    S NV    A   +++   PQ T T     V  G+ +   C A+G P P++ W R GG+        VVL +  + +S+V   D G Y C A +  G+      L++  S  PV T  P         G  VQ+ C  + +P P    I W+    Q IT  G+F I             L ++   L   DG  Y C A N++G  SSS+  
Sbjct:  340 NTEVLVGESVTLECSATGQPQP-RVTWTR----GDQSA-LPVDP--------RINITP-----SGGLFIQNIHQADGGQYTC--FASNNVDTIHANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTR-GGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVES--GSDVQIPCSAQGEPTPI---ITWSKDGVQ-ITESGKFHINPDG--------YLEVHDVGL--ADGGRYECVARNSIGYSSSSMVL 599          

HSP 2 Score: 56.225 bits (134), Expect = 7.503e-8
Identity = 53/192 (27.60%), Postives = 75/192 (39.06%), Query Frame = 2
Query:  452 DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ-DAGLYACYAENEWG----SEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +VP+IT       V SG  +  +C A G P P ++W R     N+  +T + L  +   + Q T + D G+Y C A+N  G    SE           P   I P   N   ++G  V L C     P P    + W    Q  +    R  I     T      I  I+ A     DG  Y+C A+N + T
Sbjct:  234 EVPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQP--QNTEVLVGESVTLECSATGQPQPR---VTWTRGDQSALPVDPRINI-----TPSGGLFIQNIHQA-----DGGQYTCFASNNVDT 410          

HSP 3 Score: 56.225 bits (134), Expect = 8.178e-8
Identity = 60/255 (23.53%), Postives = 89/255 (34.90%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIF---DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA-------SSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            L I    ET  G+Y C     A  V   +E TL  F     P         +V  G+ +TL C A G P P V W R   ++  +     +  S  + +  +   D G Y C+A N   +      + V   P  T+TP   +  +  G  V   C     P P    I W        + ++  + + G   I  +A  DQ                    Y C A + +GT  ++V     Q   P+ T   R
Sbjct:  292 LMIQDTRETDQGVYQCMAKNVAGEVKT-SEVTLRYFRSPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTWTRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIVQARPQFTVTPQDQSVLE--GQTVDFPCEASGFPQPV---IAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQ------------------YECQAVSPVGTARAAVHLNILQSVTPVFTSAPR 522          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 79.7221 bits (195), Expect = 3.168e-15
Identity = 83/298 (27.85%), Postives = 121/298 (40.60%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV--SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            N  V  G ++ LEC+    PQ   + W +    GD +A +P++         R  I       S  L I  + +   G Y C    S NV    A   +++   PQ T T     V  G+ +   C A+G P P++ W R GG+        VVL +  + +S+V   D G Y C A +  G+      L++  S  PV T  P         G  VQ+ C  + +P P    I W+    Q IT  G+F I             L ++   L   DG  Y C A N++G  SSS+  
Sbjct:  310 NTEVLVGESVTLECSATGQPQP-RVTWTR----GDQSA-LPVDP--------RINITP-----SGGLFIQNIHQADGGQYTC--FASNNVDTIHANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTR-GGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVES--GSDVQIPCSAQGEPTPI---ITWSKDGVQ-ITESGKFHINPDG--------YLEVHDVGL--ADGGRYECVARNSIGYSSSSMVL 569          

HSP 2 Score: 56.225 bits (134), Expect = 7.419e-8
Identity = 53/192 (27.60%), Postives = 75/192 (39.06%), Query Frame = 2
Query:  452 DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ-DAGLYACYAENEWG----SEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +VP+IT       V SG  +  +C A G P P ++W R     N+  +T + L  +   + Q T + D G+Y C A+N  G    SE           P   I P   N   ++G  V L C     P P    + W    Q  +    R  I     T      I  I+ A     DG  Y+C A+N + T
Sbjct:  204 EVPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLLEDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQP--QNTEVLVGESVTLECSATGQPQPR---VTWTRGDQSALPVDPRINI-----TPSGGLFIQNIHQA-----DGGQYTCFASNNVDT 380          

HSP 3 Score: 56.225 bits (134), Expect = 9.200e-8
Identity = 60/255 (23.53%), Postives = 89/255 (34.90%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIF---DVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA-------SSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            L I    ET  G+Y C     A  V   +E TL  F     P         +V  G+ +TL C A G P P V W R   ++  +     +  S  + +  +   D G Y C+A N   +      + V   P  T+TP   +  +  G  V   C     P P    I W        + ++  + + G   I  +A  DQ                    Y C A + +GT  ++V     Q   P+ T   R
Sbjct:  262 LMIQDTRETDQGVYQCMAKNVAGEVKT-SEVTLRYFRSPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTWTRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIVQARPQFTVTPQDQSVLE--GQTVDFPCEASGFPQPV---IAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQ------------------YECQAVSPVGTARAAVHLNILQSVTPVFTSAPR 492          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 77.411 bits (189), Expect = 1.766e-14
Identity = 65/225 (28.89%), Postives = 109/225 (48.44%), Query Frame = 2
Query:  386 ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQF 1048
            +CEV  +    N    RT+ ++  P+++       VD G D T  C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ ER  +L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ STD+     L I      D   + Y+C+A N+ G+ +  +  +   F
Sbjct:  266 SCEVTNALGSTNVS--RTVDVYFGPRMSSEPESITVDLGSDATFHCAWIGNPSLTIVWMKRG--------SGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETV-STDEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLKEQVF 472          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 77.411 bits (189), Expect = 2.010e-14
Identity = 67/227 (29.52%), Postives = 111/227 (48.90%), Query Frame = 2
Query:  386 ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +CEV  +    N    RT+ ++  P+++       VD G D T  C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ ER  +L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ STD+     L I      D   + Y+C+A N+ G+ +  +  +  Q PN
Sbjct:  289 SCEVTNALGSTNVS--RTVDVYFGPRMSSEPESITVDLGSDATFHCAWIGNPSLTIVWMKRG--------SGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETV-STDEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLK-EQGPN 496          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 77.411 bits (189), Expect = 2.161e-14
Identity = 67/227 (29.52%), Postives = 111/227 (48.90%), Query Frame = 2
Query:  386 ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +CEV  +    N    RT+ ++  P+++       VD G D T  C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ ER  +L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ STD+     L I      D   + Y+C+A N+ G+ +  +  +  Q PN
Sbjct:  271 SCEVTNALGSTNVS--RTVDVYFGPRMSSEPESITVDLGSDATFHCAWIGNPSLTIVWMKRG--------SGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETV-STDEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLK-EQGPN 478          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 77.0258 bits (188), Expect = 2.240e-14
Identity = 75/266 (28.20%), Postives = 127/266 (47.74%), Query Frame = 2
Query:  296 LSRYKIGQGKQPNSIRLEILTVEETYAGIY---------ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +++Y+  +G Q   I  E+   +ETY  +          +CEV  +    N    RT+ ++  P+++       VD G D T  C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ ER  +L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ STD+     L I      D   + Y+C+A N+ G+ +  +  +  Q PN
Sbjct:  245 VTQYRWAKGGQ---ILKEV--TDETYETVVDFSFFTEPVSCEVTNALGSTNVS--RTVDVYFGPRMSSEPESITVDLGSDATFHCAWIGNPSLTIVWMKRG--------SGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETV-STDEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLK-EQGPN 486          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 77.411 bits (189), Expect = 2.335e-14
Identity = 67/227 (29.52%), Postives = 111/227 (48.90%), Query Frame = 2
Query:  386 ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG--GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +CEV  +    N    RT+ ++  P+++       VD G D T  C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ ER  +L+V+  P+I+ T      + + G   Q+ C +++ P P    I W S K+  + +G  GR+T++T+ STD+     L I      D   + Y+C+A N+ G+ +  +  +  Q PN
Sbjct:  279 SCEVTNALGSTNVS--RTVDVYFGPRMSSEPESITVDLGSDATFHCAWIGNPSLTIVWMKRG--------SGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDR--IAW-SWKENVLESGTSGRYTVETV-STDEGVISTLTISNIVRADFQTI-YNCTAWNSFGSDTEIIRLK-EQGPN 486          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 75.485 bits (184), Expect = 6.793e-14
Identity = 83/331 (25.08%), Postives = 125/331 (37.76%), Query Frame = 2
Query:  107 PKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN--KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV-SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS---SSDIKW-ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            P + + QF +    +Y   G N+ LEC     P   +I W+K      STA +  +  +                    L+I  ++    G+Y CE    A  +  K +    I+      + E  N  +VD G D+   CIA G P P + W         +KN G   +  ++ L  VT+++AG+Y C AEN +GS      L + + AP   + P         G  V + C  KA P P    S   +W  +S +  I   G   I  +                     DG  Y+C A N  G  +S+ T         +IT P R
Sbjct:  241 PADIVVQFKD----IYTMMGQNVTLECFALGNPVP-DIRWRKVLEPMPSTAEISTSGAV--------------------LKIFNIQLEDEGLYECE----AENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRW---------LKN-GYSYHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRN------------------DGGIYTCFAENNRGKANSTGTL--------VITNPTR 506          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 75.485 bits (184), Expect = 6.793e-14
Identity = 83/331 (25.08%), Postives = 125/331 (37.76%), Query Frame = 2
Query:  107 PKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN--KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV-SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS---SSDIKW-ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            P + + QF +    +Y   G N+ LEC     P   +I W+K      STA +  +  +                    L+I  ++    G+Y CE    A  +  K +    I+      + E  N  +VD G D+   CIA G P P + W         +KN G   +  ++ L  VT+++AG+Y C AEN +GS      L + + AP   + P         G  V + C  KA P P    S   +W  +S +  I   G   I  +                     DG  Y+C A N  G  +S+ T         +IT P R
Sbjct:  241 PADIVVQFKD----IYTMMGQNVTLECFALGNPVP-DIRWRKVLEPMPSTAEISTSGAV--------------------LKIFNIQLEDEGLYECE----AENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRW---------LKN-GYSYHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRN------------------DGGIYTCFAENNRGKANSTGTL--------VITNPTR 506          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 75.485 bits (184), Expect = 6.793e-14
Identity = 83/331 (25.08%), Postives = 125/331 (37.76%), Query Frame = 2
Query:  107 PKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN--KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV-SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS---SSDIKW-ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            P + + QF +    +Y   G N+ LEC     P   +I W+K      STA +  +  +                    L+I  ++    G+Y CE    A  +  K +    I+      + E  N  +VD G D+   CIA G P P + W         +KN G   +  ++ L  VT+++AG+Y C AEN +GS      L + + AP   + P         G  V + C  KA P P    S   +W  +S +  I   G   I  +                     DG  Y+C A N  G  +S+ T         +IT P R
Sbjct:  241 PADIVVQFKD----IYTMMGQNVTLECFALGNPVP-DIRWRKVLEPMPSTAEISTSGAV--------------------LKIFNIQLEDEGLYECE----AENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRW---------LKN-GYSYHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRN------------------DGGIYTCFAENNRGKANSTGTL--------VITNPTR 506          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 75.485 bits (184), Expect = 9.985e-14
Identity = 85/319 (26.65%), Postives = 126/319 (39.50%), Query Frame = 2
Query:  155 VKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEF---KNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM----VQLTCVVKADPVPSSSDIKWASSKQ-------QTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            V RG ++ LEC V  +PQ   + W K           P+ KG     L   +I          L++  V  +  G Y C  +  A + + + +  L +   P I           V     ++L+C A+GIP P + W + G   N+  +  ++     + L Q   +DAG Y C   N  G + + F LSV   P I     G N  + +       V LTC V+ +PVP    I W    Q         + +GGRF               L+I  AQ+       Y+C A+N  G  S S  FR + F +P I G
Sbjct: 2303 VIRGKSISLECEVQGIPQP-TVTWMK--------DGRPLTKGKGVEILDEGRI----------LQLKNVHVSDTGRYVCVAVNVAGMTDKRYD--LSVHAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAGQYTCIVRNAAGEDRKMFGLSVLVPPHIV----GENTLEDVKIKEKQSVTLTCEVRGNPVPQ---ITWHKDGQLLQEDEAHHMMSGGRF---------------LQITNAQVSHTG--RYTCLASNIAGDKSKS--FRLNVFVSPTIAG 2574          

HSP 2 Score: 73.9442 bits (180), Expect = 2.664e-13
Identity = 83/296 (28.04%), Postives = 124/296 (41.89%), Query Frame = 2
Query:   86 SISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK---VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNG--NNAYQMLGCMVQLTCVVKADPVPSSSDIK--WASSKQQT--ITTGGRF--TIKTLASTDQETFCILR 940
            ++++ VPP  +    ++  + +    GN + L C    +P   ++ WKK   KG    A             R  I  G +    RL+I   E+  AG+Y C     A V  AK E  L ++  P IT +        V  GK I+L C   GIP P V W + G      K   ++     + L  V   D G Y C A N  G  ++++ LSV HAP   I  +G   N   +    V LTC     P+PS + +K  W  +   +  I +GGR    ++T      +  CI+R
Sbjct: 2187 NVNVWVPPSIY---GSDELVQLTAIEGNLITLLCESSGIPPP-DLTWKK---KGSLVLA---------DSAGRVHILSGGR----RLQISIAEKADAGLYTCVASNVAGV--AKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWMKDGRPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSV-HAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAGQYTCIVR 2459          

HSP 3 Score: 71.2478 bits (173), Expect = 2.007e-12
Identity = 83/317 (26.18%), Postives = 128/317 (40.38%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            V ++++VPP       A+  ++  V R    V+ C+   +P   +I W K     +    +P   G        Y+I      +S  +EI T +  +AG Y C    +A   +A    TL + + P I     +  V     I L C A GIP P + W++ G N      +  +L S  + +S+    DAG Y C A+N  G+   K  L+V   PV  I+ +       +   V L C  +  P P   DI W         +  +  + + A         L+I  AQ DD     Y+C A N  G+ S S T 
Sbjct: 3888 VDLTVQVPPT-----IADEPMDFLVTRQAPAVMTCSASGVPVP-SIHWTK-----NGLRLLPRGDG--------YRI-----LSSGAIEIPTTQLNHAGRYTCVARNAAG--SAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITWQKEGINVITSGKSLAILPSGSLQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPV--ISSHQKEYVVTMDKPVSLLCETEGSPPP---DITWHKDGHALTESIRQRILNSGA---------LQIAFAQPDDAG--QYTCMAANMAGSSSVSSTL 4162          

HSP 4 Score: 71.2478 bits (173), Expect = 2.078e-12
Identity = 78/290 (26.90%), Postives = 115/290 (39.66%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKK-YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  V   N + LEC     P     ++K  +P  G ++AA           L R ++          LEI + + + AGIY C  + SA     +   +L +   P I+ +    +V       L C A GIPAP + W + G   +   N   +L   ++  L+     DAG Y C A N  G ++R   L V   P   I     N   ++G  V+L C   A P P+   + W           GR  +K    +  E   +L+I  AQ  D     Y+C ATN  G
Sbjct: 1928 NETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAF----------LKRGQV----------LEIGSAQISDAGIYKCVAINSAGAT--ELFYSLQVHVPPSISGSSSMVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQILSGGRILALTSAQMSDAGRYTCVAVNAAGEKQRDIDLRVYAPP--NIMGEEQNVSVLIGQAVELFCQSDAVPPPT---LMWLKD--------GRPLLKRPGLSISENGSVLKIEDAQAGDTG--RYTCEATNVAG 2180          

HSP 5 Score: 67.3958 bits (163), Expect = 3.419e-11
Identity = 80/326 (24.54%), Postives = 126/326 (38.65%), Query Frame = 2
Query:   71 ITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT------YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS----SSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +T  V +S+ VPPK       +G  ++ V+ G  + + C     P    I W K               G    D +++    G    ++ +E   + +  AG+Y C     A   + +AE TL + + P +        T F+ ++ + + I   C A G P P + W    G     +  GV +  +   L  + VT  + G Y C A NE G+ ERK+ L V   PVI    +  N   +   +  L C V+  P P       DI+   S    I   G+               IL+++    +D     YSC A N  GT
Sbjct: 1159 VTQSVKLSVHVPPK-----IQHGNRHIKVQVGQRVDILCNAHGSPPP-VITWFK--------------SGRPFLDGAQHP---GSPDGTLSIEQAVISD--AGVYTCAATNIAG--SDEAEVTLHVQEPPSVEDLQPPFNTPFQERL-ANQRIEFPCPAKGTPKPTIKWLH-NGREVTGQEPGVSILEDGALLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGK---------------ILKLFKVSAEDAG--RYSCKAINIAGT 1438          

HSP 6 Score: 65.4698 bits (158), Expect = 1.174e-10
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            +LEIL+  E   G Y C     A     K E  +++   P +   E  +   V +   + L C  +G P P ++W + G   +      ++L   ++ ++Q    D GLY C A N  G   ++F ++V H P    + +      +    V L C+    P PS   I W    Q   T  G   I       Q +  +L+I  A L+D     Y+C ATNA G           + P+    G  R
Sbjct: 1695 KLEILSALEVDRGQYICVATSVAGEREIKYEVDVLV--PPAVEGGEETSYFIVLANNLLELDCQVSGSPPPTIMWLKGGQLIDERDGFKILLNGRKLVIAQAQVSDTGLYQCVATNIAGDHRKEFEVTV-HVPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPS---ITWLKDDQPVNTAHGNLKI-------QSSGRVLQIAKALLEDAG--RYTCVATNAAGEAHQHTQLHVHEPPSLDDAGKMR 1927          

HSP 7 Score: 65.0846 bits (157), Expect = 1.807e-10
Identity = 67/273 (24.54%), Postives = 109/273 (39.93%), Query Frame = 2
Query:  242 KGDSTAAVPINKGLTSYDLSRYKIGQGKQPNS--------IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQ-------TITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            KG ST+      G  +  +S  + GQ   P++        + L+++  E    G Y C     A  V+      L + + P I  +E   +V       + LSCIA+GIPAP + W + G      +    +     + +S    +D G Y C A +  G +++++ + V   P I       +   +    V L C  K+D VP    I W  +++Q        I +GGR+               L+I  A L D     Y+C A+N  G
Sbjct: 3448 KGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHF--VLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPKISWMKDGRPFLQTEQVQTLEGGAILRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQVTLEC--KSDAVPPPV-IMWLKNREQLQATPRVRILSGGRY---------------LQINNADLGDT--ANYTCVASNIAG 3698          

HSP 8 Score: 64.3142 bits (155), Expect = 3.191e-10
Identity = 92/339 (27.14%), Postives = 138/339 (40.71%), Query Frame = 2
Query:   86 SISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAER--TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNII-KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-------ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG--TGSSSVTFRSSQFPNPLIT 1066
            ++++ VPP+       +  ++  V   +  VL C    +P    I W+K          V I   L  Y    Y          + LE + +E++  G Y C     AN    +  R  TL +  +P  T       ++ G+ + LSC A GIP P + W     N+NII  +   +   +++ + +V+ +D+G Y C AEN  G  +    + V   PV         I P G NA         L C VK DP P+   I+W S K   I    R  I+ L +        L IY    +D     Y+C A N  G    S S+T +SS    P+IT
Sbjct: 4161 TLTVHVPPR-----IQSTEVHFTVNENSQAVLPCVADGIPTPA-IHWEK--------DGVLIANLLGKYTAQPY--------GELILENVVLEDS--GTYTC----VANNAAGEDTRIVTLAVHTLPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTF---NNNIIPAHFDSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAI--------LNCEVKGDPAPT---IQW-SRKGADIEISHR--IRQLGNGS------LAIYGTVNEDAG--DYTCVAANEAGMVERSMSLTLQSS----PIIT 4442          

HSP 9 Score: 63.1586 bits (152), Expect = 7.169e-10
Identity = 77/331 (23.26%), Postives = 124/331 (37.46%), Query Frame = 2
Query:   68 QITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAER-TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV--VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            + T + ++++ VPP         G  ++      ++ LEC    +P    I W+K             +  + +   +RY I +        L I +   T  G Y C    + NV      R  L +   P I        V      TL+C A GIP P V WR+ G   N+ +N     +L S  + +   +  D   Y C   ++ G ++R   L+V   P I   P      +    +  +TC     PVPS   I W  +  + +  G  + I +  +        + I   QL+      Y+C A NA G+    VT R  + P
Sbjct: 3699 KTTREFNLTVNVPPS-----IGGGPQSLVTLLNKSIALECRAEGVPAP-RITWRK-------------DGVVLAESHARYSILENG-----FLHIESAHVTDTGRYLC---MATNVAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTIADEPMDFLVTRQAPAV--MTCSASGVPVPS---IHWTKNGLRLLPRGDGYRILSSGA--------IEIPTTQLNHAG--RYTCVARNAAGSAHRHVTLRVQEPP 3987          

HSP 10 Score: 62.3882 bits (150), Expect = 1.093e-9
Identity = 48/167 (28.74%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAER-TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN-SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            NS  L+I   +   AG Y C    +AN+  + +   TL +   P+I  TE    V+      L C+A+GIP P + W + G   +N++       Y  ++ L  V  +D+G Y C A N  G + R   L+V   P  T  P   +  +  G  ++L+C     P+P
Sbjct: 4128 NSGALQIAFAQPDDAGQYTC---MAANMAGSSSVSSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLIANLLGKYTAQPY-GELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHTLPTFTELPGDLSLNK--GEQLRLSCKAVGIPLP 4288          

HSP 11 Score: 62.3882 bits (150), Expect = 1.102e-9
Identity = 76/316 (24.05%), Postives = 130/316 (41.14%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMY-VKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-----VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            VS+++ VPP   +K   + ++++  V+ G ++ LEC    +P    I W K               G    D +  +I  G Q     L I   E +  G Y C  +  A   +      L ++  P I   E +  V++    +TL+C A GIP P + W +   N   I+N+      ++   +++ +++    ++G Y C A N  G  ++ F L +   P +      +    +LG  V+L C     P P    ++W    +  +      T +   +TD  T   L IY A   D+    Y+C ATN  G
Sbjct: 3047 VSLTVHVPPS--IKDHGSQSLSIVNVREGTSVSLECESNAVPPP-VITWSK--------------NGRMIPDSTNVEILTGGQ----TLHIRRAEVSDTGQYVCRAINVAGRDDKNFH--LNVYVPPTIEGPETEVIVETISNPVTLTCDATGIPPPTITWLK---NHKPIENSDPLEVHILSGGSKLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPH---LQWLRDGKPIVNG---ETERVRVTTDGST---LNIYRALTSDMG--KYTCVATNPAG 3325          

HSP 12 Score: 62.003 bits (149), Expect = 1.785e-9
Identity = 62/228 (27.19%), Postives = 95/228 (41.67%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
             L I  V +  +G Y C    S   V  KA   + + + P        N ++  G +  L+C   G PAP + W R G +   S+ I+  G    +  + +     +DAG Y C A NE G  ER  +L++  +P+IT+ P         G  V L C    +P P+   I W S + Q I+   R ++   +S          +Y A     D   Y C A N +G+
Sbjct: 4311 ELVIEKVSKEDSGTYVCTAENSVGFV--KAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTIQWSRKGADIEISHRIRQLG----NGSLAIYGTVNEDAGDYTCVAANEAGMVERSMSLTLQSSPIITLEP--VETVVDAGGRVILDCQAAGEPQPT---ITW-SRQGQPISWDNRLSMLPNSS----------LYIAAARKEDTSEYECVARNLMGS 4516          

HSP 13 Score: 60.8474 bits (146), Expect = 4.005e-9
Identity = 55/239 (23.01%), Postives = 90/239 (37.66%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            + I+  + +   +Y C     A V       +L +F  P +       ++    G   +++C  +G PAP + W R G       +  V      + L +   +D G Y C A NE G   + F L V   P I  +        ++   ++L+C+    P P    I W           GR  ++T      E   ILR+  AQ++D     Y+C A++  G        R    PN
Sbjct: 3397 VRIVRAQVSDIAVYTCVASNRAGV--DSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPK---ISWMKD--------GRPFLQTEQVQTLEGGAILRVSSAQVEDTG--RYTCLASSPAGDDDKEYLVRVHVPPN 3620          

HSP 14 Score: 60.4622 bits (145), Expect = 5.319e-9
Identity = 62/244 (25.41%), Postives = 104/244 (42.62%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVT----LSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKA-DPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            L+I   ++  AG Y C  +  A    A    TL +   P          V+ G ++TL C   G P P + WRR+       +   V   S   T    +S +   D G Y C AEN++G  + +  ++V+   AP+I I+P  + A  + G  + L C + A +P+P   + +W  +    +      T+++  S        L I   +L   DG  Y+C A+N  GT + + +      P+
Sbjct:  757 LKIQETQDLDAGDYTCVAINEAG--RATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFISQLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISP--SMASVIEGQPLTLPCTLLAGNPIP---ERRWMKNSAMLVQN-PYITVRSDGS--------LHIERVRLQ--DGGKYTCVASNVAGTNNKTTSVAVHVLPS 982          

HSP 15 Score: 60.077 bits (144), Expect = 6.370e-9
Identity = 57/228 (25.00%), Postives = 87/228 (38.16%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK-VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  +L I   + +  G+Y C     A   + + E  + +   P I  ++   K V   K +TL CIANGIP P + W +     N       +  S +V  +++   +DAG Y C A N  G   +   L V   P +       N   ++   +QL C     P+P    I W         +     +K           +L I  AQ+ D     Y C A N+ G
Sbjct: 1785 NGRKLVIAQAQVSDTGLYQCVATNIAG--DHRKEFEVTVHVPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWLKDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPV---ITWYKDSHPLSGSASAAFLKRGQ--------VLEIGSAQISDAG--IYKCVAINSAG 1997          

HSP 16 Score: 59.6918 bits (143), Expect = 9.139e-9
Identity = 62/250 (24.80%), Postives = 99/250 (39.60%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            L++  V    AG Y+C+ +  A    ++ + ++ +   P I      ++V      ++TL C   G+P P + W + G     G+ NI + + G  L+     L      D G Y C   N  G + +   L+V   P I           +L  +V+L C  +  PVP+   I W    Q   ++     I        +   +L I  AQ+   D  TY+C A N  GT   S  F    +  P I G
Sbjct: 1415 LKLFKVSAEDAGRYSCKAINIAGT--SQKDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFLGDPNIELSDRGQSLH-----LRNARRSDKGRYQCTVSNAAGKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPA---ITWYKDGQVVTSSSQALYI--------DKGQLLHIQRAQVS--DSATYTCHAANVAGTAEKS--FHVDIYVPPTIEG 1642          

HSP 17 Score: 59.3066 bits (142), Expect = 9.873e-9
Identity = 64/253 (25.30%), Postives = 108/253 (42.69%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV--PQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM---VQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKT---LASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +L+I   + + +G Y C     A+ +  KA++  ++F    P +   E  ++V    G+++ L C A+GIP P + W R G     G +  ++   V    + + + +    D G Y C A N  G E+R F L+V   P   I  N   A +++  +   + + C     P P    I W       +  G    I +   L S  Q    ++RI  AQ+ D+    Y+C A+N  G  S   + +    PN
Sbjct: 3207 KLQIARPQRSNSGNYTC----VASNMEGKAQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVR---VTTDGSTLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYVPP--KIRGNKEEAEKLMALVDTSINIECKATGTPPPQ---INW-------LKNGLPLPISSHIRLLSAGQ----VVRIVRAQVSDI--AVYTCVASNRAGVDSKHYSLQVFVPPN 3434          

HSP 18 Score: 56.9954 bits (136), Expect = 5.404e-8
Identity = 59/232 (25.43%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVL--YSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            AG YAC    +A     K   TL   + P++   + +  V  G    + C  +GIP P V W +  G+  +  +T + +      + + +    DAG Y C A NE G    +  L V   PV    P  ++    +G  V L C V+  P P    IKW       + +   F++  ++        I  ++ +     D  TY C A N  G   S  T   +    PLI
Sbjct:  676 AGTYACLASNAAGT--DKQTSTLRYIEAPKLVVEQSELLVALGDTTVMECKTSGIPPPQVKWFK--GDLELRPSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEAGRATGRLTLDVGSPPVFIQEP--SDVAVEIGSNVTLPCYVQGYPEPK---IKWRRLDNMPVFS-RPFSVSFISQLRTGALFISNLWAS-----DKGTYICEAENQFGKIQSQTTVTVTGLVAPLI 892          

HSP 19 Score: 56.225 bits (134), Expect = 9.277e-8
Identity = 60/242 (24.79%), Postives = 101/242 (41.74%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            P    L+I   +   AG Y C  +  A   + + +  +++  V +   ++   +V     K   + C ++G PAP   W++ G        +  ++ G  L   Q+  +Q+T  D G Y C AEN  GS ++ F L+V H P   I PN  +   ++   + L C V   P P   D+ W  +++       +     L      T  I+R   A++   DG  Y+C A N  G     V+ 
Sbjct: 2827 PGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLRYDVHVLLPPVIKGANSDLPEEVTVLVNKSTQMECSSSGNPAPRNYWQKDGQILLEDEHHKFQSDGRSL---QILNAQIT--DTGRYVCVAENTAGSAKKYFNLNV-HVPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPP---DLSWLKNEEPI-----KPNTNVLTVPGGRTLQIIR---AKIS--DGGDYTCIAINQAGESKKKVSL 3049          

HSP 20 Score: 55.0694 bits (131), Expect = 2.444e-7
Identity = 63/239 (26.36%), Postives = 98/239 (41.00%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYT-EFKNK-VDSGKDITLSCIANGIPAPIVLWRR-----IGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWAS-----SKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            AG Y C    +A    A     L + + P +    + +N+ V     I L C A G P P++ W +      G  S      G VL   ++  +Q++  DAG+Y C A N  G+ E  ++L V   P  +I+ + +    ++  + +L C  +  P PS + +K  S     S    I +GGR               IL +  AQ+ D     Y+C A NA G     +  R    PN
Sbjct: 1892 AGRYTCVATNAAG--EAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAFLKRGQVL---EIGSAQIS--DAGIYKCVAINSAGATELFYSLQVHVPP--SISGSSSMVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQILSGGR---------------ILALTSAQMSDAG--RYTCVAVNAAGEKQRDIDLRVYAPPN 2104          

HSP 21 Score: 53.9138 bits (128), Expect = 4.936e-7
Identity = 58/244 (23.77%), Postives = 94/244 (38.52%), Query Frame = 2
Query:  323 KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN-QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            ++  S+  +   V  +  G Y C  + SA     +A+    + + P I        V  G+   L+C+        + W+R G +  +  +  +   +N  + L  V   DAG Y C   +E GS      L+V   P +T+ P   N     G  + + C     P P    I W +  +  I    R+ +     T + T  I    P      D  TY+C A+NA GT   + T R  + P
Sbjct:  477 RESASVNWDFTKVTLSDEGFYDCIAVSSAGT--GRAQTFFDVSEPPPIIQLPNNVTVTPGERAVLACLVISAVDYNLTWQRSGRDIRLADSARIRTLANLSLELRSVKIGDAGEYRCVVSSEGGSAAASVFLTVQEKPKVTVMP--KNQSFTGGSEISIMCSATGYPKPK---IVW-TMNEMFIMGSHRYRM-----TSEGTLFIKNAVPK-----DAGTYACLASNAAGTDKQTSTLRYIEAP 702          

HSP 22 Score: 51.6026 bits (122), Expect = 2.760e-6
Identity = 42/177 (23.73%), Postives = 72/177 (40.68%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN----KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            P    L+I+  + +  G Y C  +  A    +K + +L +   P I     ++     V  G  ++L C +N +P P++ W + G       N  ++     + + +    D G Y C A N  G +++ F L+V   P I   P      + +   V LTC     P P+   I W
Sbjct: 3014 PGGRTLQIIRAKISDGGDYTCIAINQAG--ESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPTIE-GPETEVIVETISNPVTLTCDATGIPPPT---ITW 3184          

HSP 23 Score: 50.0618 bits (118), Expect = 7.319e-6
Identity = 78/338 (23.08%), Postives = 129/338 (38.17%), Query Frame = 2
Query:  113 EFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGD--STAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--------SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQM-LGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN-----PLITGPFR 1078
              L    +G   +    G  + L C    +P+  +I W K   KG+  ST++   + G    D S Y +  G +               +G Y C    +A     K +  L ++  P++   +     D        +G++  L C A  +P PI+ W +     +        L S  + +++    D+G+Y C A N  G+  +   LSV   P I    +GN   ++ +G  V + C     P P    I W  S +  +        +   S D      L I  A + D  GV Y+C+ATN  G+  + VT    + P+     P    PF+
Sbjct:  978 HVLPSIQHGQQILSTIEGVPVTLPCRASGIPKP-SITWSK---KGELISTSSAKFSAGA---DGSLYVVSPGSE--------------ESGEYICTATNAAGYAKRKVQ--LTVYVRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITWAKDSQLISPFSPRHTFLPSGSMKITETRVSDSGMYLCVATNIAGNVTQSVKLSVHVPPKIQ---HGNRHIKVQVGQRVDILCNAHGSPPPV---ITWFKSGRPFLDGA-----QHPGSPDG----TLSIEQAVISDA-GV-YTCAATNIAGSDEAEVTLHVQEPPSVEDLQPPFNTPFQ 1275          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 75.485 bits (184), Expect = 1.008e-13
Identity = 85/319 (26.65%), Postives = 126/319 (39.50%), Query Frame = 2
Query:  155 VKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEF---KNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM----VQLTCVVKADPVPSSSDIKWASSKQ-------QTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            V RG ++ LEC V  +PQ   + W K           P+ KG     L   +I          L++  V  +  G Y C  +  A + + + +  L +   P I           V     ++L+C A+GIP P + W + G   N+  +  ++     + L Q   +DAG Y C   N  G + + F LSV   P I     G N  + +       V LTC V+ +PVP    I W    Q         + +GGRF               L+I  AQ+       Y+C A+N  G  S S  FR + F +P I G
Sbjct: 2303 VIRGKSISLECEVQGIPQP-TVTWMK--------DGRPLTKGKGVEILDEGRI----------LQLKNVHVSDTGRYVCVAVNVAGMTDKRYD--LSVHAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAGQYTCIVRNAAGEDRKMFGLSVLVPPHIV----GENTLEDVKIKEKQSVTLTCEVRGNPVPQ---ITWHKDGQLLQEDEAHHMMSGGRF---------------LQITNAQVSHTG--RYTCLASNIAGDKSKS--FRLNVFVSPTIAG 2574          

HSP 2 Score: 74.3294 bits (181), Expect = 2.403e-13
Identity = 83/296 (28.04%), Postives = 124/296 (41.89%), Query Frame = 2
Query:   86 SISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK---VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNG--NNAYQMLGCMVQLTCVVKADPVPSSSDIK--WASSKQQT--ITTGGRF--TIKTLASTDQETFCILR 940
            ++++ VPP  +    ++  + +    GN + L C    +P   ++ WKK   KG    A             R  I  G +    RL+I   E+  AG+Y C     A V  AK E  L ++  P IT +        V  GK I+L C   GIP P V W + G      K   ++     + L  V   D G Y C A N  G  ++++ LSV HAP   I  +G   N   +    V LTC     P+PS + +K  W  +   +  I +GGR    ++T      +  CI+R
Sbjct: 2187 NVNVWVPPSIY---GSDELVQLTAIEGNLITLLCESSGIPPP-DLTWKK---KGSLVLA---------DSAGRVHILSGGR----RLQISIAEKADAGLYTCVASNVAGV--AKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWMKDGRPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSV-HAPPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAGQYTCIVR 2459          

HSP 3 Score: 71.2478 bits (173), Expect = 2.009e-12
Identity = 80/291 (27.49%), Postives = 115/291 (39.52%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKK--YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  V   N + LEC     P    I W K  +P  G ++AA           L R ++          LEI + + + AGIY C  + SA     +   +L +   P I+ +    +V       L C A GIPAP + W + G   +   N   +L   ++  L+     DAG Y C A N  G ++R   L V   P   I     N   ++G  V+L C   A P P+   + W           GR  +K    +  E   +L+I  AQ  D     Y+C ATN  G
Sbjct: 1928 NETVVVNNPIQLECKATGKPLP-VITWYKDSHPLSGSASAAF----------LKRGQV----------LEIGSAQISDAGIYKCVAINSAGAT--ELFYSLQVHVPPSISGSSSMVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQILSGGRILALTSAQMSDAGRYTCVAVNAAGEKQRDIDLRVYAPP--NIMGEEQNVSVLIGQAVELFCQSDAVPPPT---LMWLKD--------GRPLLKRPGLSISENGSVLKIEDAQAGDTG--RYTCEATNVAG 2180          

HSP 4 Score: 71.2478 bits (173), Expect = 2.027e-12
Identity = 85/317 (26.81%), Postives = 128/317 (40.38%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            V ++++VPP       A+  ++  V R    V+ C+   +P   +I W K     +    +P   G        Y+I      +S  +EI T +  +AG Y C    +A   +A    TL + + P I     +  V     I L C A GIP P + W++ G N      +  +L S  + +S+    DAG Y C A+N  G+   K  L+V   PV  I+ +       +   V L C  +  P P   DI W       +T   R  I    +        L+I  AQ DD     Y+C A N  G+ S S T 
Sbjct: 3888 VDLTVQVPPT-----IADEPMDFLVTRQAPAVMTCSASGVPVP-SIHWTK-----NGLRLLPRGDG--------YRI-----LSSGAIEIPTTQLNHAGRYTCVARNAAG--SAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPCEATGIPTPFITWQKEGINVITSGKSLAILPSGSLQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPV--ISSHQKEYVVTMDKPVSLLCETEGSPPP---DITWHKDG-HALTESIRQRILNSGA--------LQIAFAQPDDAG--QYTCMAANMAGSSSVSSTL 4162          

HSP 5 Score: 67.3958 bits (163), Expect = 3.307e-11
Identity = 80/326 (24.54%), Postives = 126/326 (38.65%), Query Frame = 2
Query:   71 ITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT------YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS----SSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +T  V +S+ VPPK       +G  ++ V+ G  + + C     P    I W K               G    D +++    G    ++ +E   + +  AG+Y C     A   + +AE TL + + P +        T F+ ++ + + I   C A G P P + W    G     +  GV +  +   L  + VT  + G Y C A NE G+ ERK+ L V   PVI    +  N   +   +  L C V+  P P       DI+   S    I   G+               IL+++    +D     YSC A N  GT
Sbjct: 1159 VTQSVKLSVHVPPK-----IQHGNRHIKVQVGQRVDILCNAHGSPPP-VITWFK--------------SGRPFLDGAQHP---GSPDGTLSIEQAVISD--AGVYTCAATNIAG--SDEAEVTLHVQEPPSVEDLQPPFNTPFQERL-ANQRIEFPCPAKGTPKPTIKWLH-NGREVTGQEPGVSILEDGALLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGK---------------ILKLFKVSAEDAG--RYSCKAINIAGT 1438          

HSP 6 Score: 65.4698 bits (158), Expect = 1.185e-10
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            +LEIL+  E   G Y C     A     K E  +++   P +   E  +   V +   + L C  +G P P ++W + G   +      ++L   ++ ++Q    D GLY C A N  G   ++F ++V H P    + +      +    V L C+    P PS   I W    Q   T  G   I       Q +  +L+I  A L+D     Y+C ATNA G           + P+    G  R
Sbjct: 1695 KLEILSALEVDRGQYICVATSVAGEREIKYEVDVLV--PPAVEGGEETSYFIVLANNLLELDCQVSGSPPPTIMWLKGGQLIDERDGFKILLNGRKLVIAQAQVSDTGLYQCVATNIAGDHRKEFEVTV-HVPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPS---ITWLKDDQPVNTAHGNLKI-------QSSGRVLQIAKALLEDAG--RYTCVATNAAGEAHQHTQLHVHEPPSLDDAGKMR 1927          

HSP 7 Score: 65.0846 bits (157), Expect = 1.645e-10
Identity = 67/273 (24.54%), Postives = 109/273 (39.93%), Query Frame = 2
Query:  242 KGDSTAAVPINKGLTSYDLSRYKIGQGKQPNS--------IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQ-------TITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            KG ST+      G  +  +S  + GQ   P++        + L+++  E    G Y C     A  V+      L + + P I  +E   +V       + LSCIA+GIPAP + W + G      +    +     + +S    +D G Y C A +  G +++++ + V   P I       +   +    V L C  K+D VP    I W  +++Q        I +GGR+               L+I  A L D     Y+C A+N  G
Sbjct: 3448 KGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHF--VLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPKISWMKDGRPFLQTEQVQTLEGGAILRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDEAQDFTVLRNRQVTLEC--KSDAVPPPV-IMWLKNREQLQATPRVRILSGGRY---------------LQINNADLGDT--ANYTCVASNIAG 3698          

HSP 8 Score: 64.3142 bits (155), Expect = 3.139e-10
Identity = 92/339 (27.14%), Postives = 138/339 (40.71%), Query Frame = 2
Query:   86 SISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAER--TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNII-KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-------ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG--TGSSSVTFRSSQFPNPLIT 1066
            ++++ VPP+       +  ++  V   +  VL C    +P    I W+K          V I   L  Y    Y          + LE + +E++  G Y C     AN    +  R  TL +  +P  T       ++ G+ + LSC A GIP P + W     N+NII  +   +   +++ + +V+ +D+G Y C AEN  G  +    + V   PV         I P G NA         L C VK DP P+   I+W S K   I    R  I+ L +        L IY    +D     Y+C A N  G    S S+T +SS    P+IT
Sbjct: 4161 TLTVHVPPR-----IQSTEVHFTVNENSQAVLPCVADGIPTPA-IHWEK--------DGVLIANLLGKYTAQPY--------GELILENVVLEDS--GTYTC----VANNAAGEDTRIVTLAVHTLPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTF---NNNIIPAHFDSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAI--------LNCEVKGDPAPT---IQW-SRKGADIEISHR--IRQLGNGS------LAIYGTVNEDAG--DYTCVAANEAGMVERSMSLTLQSS----PIIT 4442          

HSP 9 Score: 63.1586 bits (152), Expect = 6.698e-10
Identity = 77/331 (23.26%), Postives = 124/331 (37.46%), Query Frame = 2
Query:   68 QITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAER-TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV--VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            + T + ++++ VPP         G  ++      ++ LEC    +P    I W+K             +  + +   +RY I +        L I +   T  G Y C    + NV      R  L +   P I        V      TL+C A GIP P V WR+ G   N+ +N     +L S  + +   +  D   Y C   ++ G ++R   L+V   P I   P      +    +  +TC     PVPS   I W  +  + +  G  + I +  +        + I   QL+      Y+C A NA G+    VT R  + P
Sbjct: 3699 KTTREFNLTVNVPPS-----IGGGPQSLVTLLNKSIALECRAEGVPAP-RITWRK-------------DGVVLAESHARYSILENG-----FLHIESAHVTDTGRYLC---MATNVAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQVPPTIADEPMDFLVTRQAPAV--MTCSASGVPVPS---IHWTKNGLRLLPRGDGYRILSSGA--------IEIPTTQLNHAG--RYTCVARNAAGSAHRHVTLRVQEPP 3987          

HSP 10 Score: 62.3882 bits (150), Expect = 1.066e-9
Identity = 48/167 (28.74%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAER-TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN-SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            NS  L+I   +   AG Y C    +AN+  + +   TL +   P+I  TE    V+      L C+A+GIP P + W + G   +N++       Y  ++ L  V  +D+G Y C A N  G + R   L+V   P  T  P   +  +  G  ++L+C     P+P
Sbjct: 4128 NSGALQIAFAQPDDAGQYTC---MAANMAGSSSVSSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLIANLLGKYTAQPY-GELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHTLPTFTELPGDLSLNK--GEQLRLSCKAVGIPLP 4288          

HSP 11 Score: 62.3882 bits (150), Expect = 1.075e-9
Identity = 76/316 (24.05%), Postives = 130/316 (41.14%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMY-VKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-----VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            VS+++ VPP   +K   + ++++  V+ G ++ LEC    +P    I W K               G    D +  +I  G Q     L I   E +  G Y C  +  A   +      L ++  P I   E +  V++    +TL+C A GIP P + W +   N   I+N+      ++   +++ +++    ++G Y C A N  G  ++ F L +   P +      +    +LG  V+L C     P P    ++W    +  +      T +   +TD  T   L IY A   D+    Y+C ATN  G
Sbjct: 3047 VSLTVHVPPS--IKDHGSQSLSIVNVREGTSVSLECESNAVPPP-VITWSK--------------NGRMIPDSTNVEILTGGQ----TLHIRRAEVSDTGQYVCRAINVAGRDDKNFH--LNVYVPPTIEGPETEVIVETISNPVTLTCDATGIPPPTITWLK---NHKPIENSDPLEVHILSGGSKLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPH---LQWLRDGKPIVNG---ETERVRVTTDGST---LNIYRALTSDMG--KYTCVATNPAG 3325          

HSP 12 Score: 62.003 bits (149), Expect = 1.786e-9
Identity = 62/228 (27.19%), Postives = 95/228 (41.67%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
             L I  V +  +G Y C    S   V  KA   + + + P        N ++  G +  L+C   G PAP + W R G +   S+ I+  G    +  + +     +DAG Y C A NE G  ER  +L++  +P+IT+ P         G  V L C    +P P+   I W S + Q I+   R ++   +S          +Y A     D   Y C A N +G+
Sbjct: 4311 ELVIEKVSKEDSGTYVCTAENSVGFV--KAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTIQWSRKGADIEISHRIRQLG----NGSLAIYGTVNEDAGDYTCVAANEAGMVERSMSLTLQSSPIITLEP--VETVVDAGGRVILDCQAAGEPQPT---ITW-SRQGQPISWDNRLSMLPNSS----------LYIAAARKEDTSEYECVARNLMGS 4516          

HSP 13 Score: 60.8474 bits (146), Expect = 3.840e-9
Identity = 55/239 (23.01%), Postives = 90/239 (37.66%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            + I+  + +   +Y C     A V       +L +F  P +       ++    G   +++C  +G PAP + W R G       +  V      + L +   +D G Y C A NE G   + F L V   P I  +        ++   ++L+C+    P P    I W           GR  ++T      E   ILR+  AQ++D     Y+C A++  G        R    PN
Sbjct: 3397 VRIVRAQVSDIAVYTCVASNRAGV--DSKHYSLQVFVPPNMDNAMGTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPK---ISWMKD--------GRPFLQTEQVQTLEGGAILRVSSAQVEDTG--RYTCLASSPAGDDDKEYLVRVHVPPN 3620          

HSP 14 Score: 60.4622 bits (145), Expect = 5.143e-9
Identity = 62/244 (25.41%), Postives = 104/244 (42.62%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVT----LSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKA-DPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            L+I   ++  AG Y C  +  A    A    TL +   P          V+ G ++TL C   G P P + WRR+       +   V   S   T    +S +   D G Y C AEN++G  + +  ++V+   AP+I I+P  + A  + G  + L C + A +P+P   + +W  +    +      T+++  S        L I   +L   DG  Y+C A+N  GT + + +      P+
Sbjct:  757 LKIQETQDLDAGDYTCVAINEAG--RATGRLTLDVGSPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFISQLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISP--SMASVIEGQPLTLPCTLLAGNPIP---ERRWMKNSAMLVQN-PYITVRSDGS--------LHIERVRLQ--DGGKYTCVASNVAGTNNKTTSVAVHVLPS 982          

HSP 15 Score: 60.077 bits (144), Expect = 5.751e-9
Identity = 57/228 (25.00%), Postives = 87/228 (38.16%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK-VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  +L I   + +  G+Y C     A   + + E  + +   P I  ++   K V   K +TL CIANGIP P + W +     N       +  S +V  +++   +DAG Y C A N  G   +   L V   P +       N   ++   +QL C     P+P    I W         +     +K           +L I  AQ+ D     Y C A N+ G
Sbjct: 1785 NGRKLVIAQAQVSDTGLYQCVATNIAG--DHRKEFEVTVHVPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWLKDDQPVNTAHGNLKIQSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPV---ITWYKDSHPLSGSASAAFLKRGQ--------VLEIGSAQISDAG--IYKCVAINSAG 1997          

HSP 16 Score: 59.6918 bits (143), Expect = 8.914e-9
Identity = 62/250 (24.80%), Postives = 99/250 (39.60%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            L++  V    AG Y+C+ +  A    ++ + ++ +   P I      ++V      ++TL C   G+P P + W + G     G+ NI + + G  L+     L      D G Y C   N  G + +   L+V   P I           +L  +V+L C  +  PVP+   I W    Q   ++     I        +   +L I  AQ+   D  TY+C A N  GT   S  F    +  P I G
Sbjct: 1415 LKLFKVSAEDAGRYSCKAINIAGT--SQKDFSVNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGKPLFLGDPNIELSDRGQSLH-----LRNARRSDKGRYQCTVSNAAGKQAKDIKLTVYVPPSIKGGNITTEISALLNSIVKLECETRGLPVPA---ITWYKDGQVVTSSSQALYI--------DKGQLLHIQRAQVS--DSATYTCHAANVAGTAEKS--FHVDIYVPPTIEG 1642          

HSP 17 Score: 59.6918 bits (143), Expect = 9.386e-9
Identity = 64/253 (25.30%), Postives = 108/253 (42.69%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV--PQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM---VQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKT---LASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +L+I   + + +G Y C     A+ +  KA++  ++F    P +   E  ++V    G+++ L C A+GIP P + W R G     G +  ++   V    + + + +    D G Y C A N  G E+R F L+V   P   I  N   A +++  +   + + C     P P    I W       +  G    I +   L S  Q    ++RI  AQ+ D+    Y+C A+N  G  S   + +    PN
Sbjct: 3207 KLQIARPQRSNSGNYTC----VASNMEGKAQKNFILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVR---VTTDGSTLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYVPP--KIRGNKEEAEKLMALVDTSINIECKATGTPPPQ---INW-------LKNGLPLPISSHIRLLSAGQ----VVRIVRAQVSDI--AVYTCVASNRAGVDSKHYSLQVFVPPN 3434          

HSP 18 Score: 56.9954 bits (136), Expect = 5.792e-8
Identity = 59/232 (25.43%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVL--YSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            AG YAC    +A     K   TL   + P++   + +  V  G    + C  +GIP P V W +  G+  +  +T + +      + + +    DAG Y C A NE G    +  L V   PV    P  ++    +G  V L C V+  P P    IKW       + +   F++  ++        I  ++ +     D  TY C A N  G   S  T   +    PLI
Sbjct:  676 AGTYACLASNAAGT--DKQTSTLRYIEAPKLVVEQSELLVALGDTTVMECKTSGIPPPQVKWFK--GDLELRPSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEAGRATGRLTLDVGSPPVFIQEP--SDVAVEIGSNVTLPCYVQGYPEPK---IKWRRLDNMPVFS-RPFSVSFISQLRTGALFISNLWAS-----DKGTYICEAENQFGKIQSQTTVTVTGLVAPLI 892          

HSP 19 Score: 56.6102 bits (135), Expect = 8.094e-8
Identity = 60/242 (24.79%), Postives = 101/242 (41.74%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            P    L+I   +   AG Y C  +  A   + + +  +++  V +   ++   +V     K   + C ++G PAP   W++ G        +  ++ G  L   Q+  +Q+T  D G Y C AEN  GS ++ F L+V H P   I PN  +   ++   + L C V   P P   D+ W  +++       +     L      T  I+R   A++   DG  Y+C A N  G     V+ 
Sbjct: 2827 PGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLRYDVHVLLPPVIKGANSDLPEEVTVLVNKSTQMECSSSGNPAPRNYWQKDGQILLEDEHHKFQSDGRSL---QILNAQIT--DTGRYVCVAENTAGSAKKYFNLNV-HVPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPP---DLSWLKNEEPI-----KPNTNVLTVPGGRTLQIIR---AKIS--DGGDYTCIAINQAGESKKKVSL 3049          

HSP 20 Score: 55.0694 bits (131), Expect = 2.425e-7
Identity = 63/239 (26.36%), Postives = 98/239 (41.00%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYT-EFKNK-VDSGKDITLSCIANGIPAPIVLWRR-----IGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWAS-----SKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            AG Y C    +A    A     L + + P +    + +N+ V     I L C A G P P++ W +      G  S      G VL   ++  +Q++  DAG+Y C A N  G+ E  ++L V   P  +I+ + +    ++  + +L C  +  P PS + +K  S     S    I +GGR               IL +  AQ+ D     Y+C A NA G     +  R    PN
Sbjct: 1892 AGRYTCVATNAAG--EAHQHTQLHVHEPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPVITWYKDSHPLSGSASAAFLKRGQVL---EIGSAQIS--DAGIYKCVAINSAGATELFYSLQVHVPP--SISGSSSMVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQILSGGR---------------ILALTSAQMSDAG--RYTCVAVNAAGEKQRDIDLRVYAPPN 2104          

HSP 21 Score: 53.9138 bits (128), Expect = 4.939e-7
Identity = 58/244 (23.77%), Postives = 94/244 (38.52%), Query Frame = 2
Query:  323 KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN-QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            ++  S+  +   V  +  G Y C  + SA     +A+    + + P I        V  G+   L+C+        + W+R G +  +  +  +   +N  + L  V   DAG Y C   +E GS      L+V   P +T+ P   N     G  + + C     P P    I W +  +  I    R+ +     T + T  I    P      D  TY+C A+NA GT   + T R  + P
Sbjct:  477 RESASVNWDFTKVTLSDEGFYDCIAVSSAGT--GRAQTFFDVSEPPPIIQLPNNVTVTPGERAVLACLVISAVDYNLTWQRSGRDIRLADSARIRTLANLSLELRSVKIGDAGEYRCVVSSEGGSAAASVFLTVQEKPKVTVMP--KNQSFTGGSEISIMCSATGYPKPK---IVW-TMNEMFIMGSHRYRM-----TSEGTLFIKNAVPK-----DAGTYACLASNAAGTDKQTSTLRYIEAP 702          

HSP 22 Score: 51.6026 bits (122), Expect = 2.623e-6
Identity = 42/177 (23.73%), Postives = 72/177 (40.68%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN----KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            P    L+I+  + +  G Y C  +  A    +K + +L +   P I     ++     V  G  ++L C +N +P P++ W + G       N  ++     + + +    D G Y C A N  G +++ F L+V   P I   P      + +   V LTC     P P+   I W
Sbjct: 3014 PGGRTLQIIRAKISDGGDYTCIAINQAG--ESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPTIE-GPETEVIVETISNPVTLTCDATGIPPPT---ITW 3184          

HSP 23 Score: 50.0618 bits (118), Expect = 7.843e-6
Identity = 78/338 (23.08%), Postives = 129/338 (38.17%), Query Frame = 2
Query:  113 EFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGD--STAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--------SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQM-LGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN-----PLITGPFR 1078
              L    +G   +    G  + L C    +P+  +I W K   KG+  ST++   + G    D S Y +  G +               +G Y C    +A     K +  L ++  P++   +     D        +G++  L C A  +P PI+ W +     +        L S  + +++    D+G+Y C A N  G+  +   LSV   P I    +GN   ++ +G  V + C     P P    I W  S +  +        +   S D      L I  A + D  GV Y+C+ATN  G+  + VT    + P+     P    PF+
Sbjct:  978 HVLPSIQHGQQILSTIEGVPVTLPCRASGIPKP-SITWSK---KGELISTSSAKFSAGA---DGSLYVVSPGSE--------------ESGEYICTATNAAGYAKRKVQ--LTVYVRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITWAKDSQLISPFSPRHTFLPSGSMKITETRVSDSGMYLCVATNIAGNVTQSVKLSVHVPPKIQ---HGNRHIKVQVGQRVDILCNAHGSPPPV---ITWFKSGRPFLDGA-----QHPGSPDG----TLSIEQAVISDA-GV-YTCAATNIAGSDEAEVTLHVQEPPSVEDLQPPFNTPFQ 1275          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|Q26474|LACH_SCHAM (Lachesin OS=Schistocerca americana OX=7009 GN=LAC PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.654e-20
Identity = 89/303 (29.37%), Postives = 135/303 (44.55%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKG--LTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERK-FALSVSHAPVITI-TPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQ--ETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            G  + LEC+V    Q   + W K   +      +PI+ G  L   D SR+ +      ++  L+I  ++ET AG Y C+V+   N     AE  L +   P I+    ++ V S G+ + L C A G PAP V WRR   N+ I+   G +   N + +S++  +D G Y C AEN  G   R+  A+ V   PVIT+  P    A Q     + L C V+A P P+   I W    +  ++    ++I   A+ D+  +T  ++ I   Q        Y C A N LG     V    +  P
Sbjct:   36 GGTVELECSV-QYAQDYPVLWMKVD-RNRQVDPLPISTGSSLIIRD-SRFALRYDTASSTYTLQIKDIQETDAGFYQCQVIIGLNN-KITAEVDLQVRRPPVISDNSTRSLVVSEGQAVRLECYAGGYPAPRVSWRR--ENNAILPTGGSIYRGNVLKISRIGKEDRGTYYCVAENGVGKGARRNIAVEVEFPPVITVPRPRLGQALQY---DMDLECHVEAYPPPA---ITWLKD-ETVLSNNQHYSISHFATADEFTDTTRVITIEKRQYG-----KYQCKAANKLGEAREEVELFETIIP 320          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|Q24372|LACH_DROME (Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.676e-17
Identity = 74/265 (27.92%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  299 SRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERK-FALSVSHAPVITI-TPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRCG 1084
            SR+ +      ++ +L+I  ++ET AG Y C+V+ S  V    AE  L +   P I+    ++ V S G ++ + C A+G P P + WRR   N+ I+         N + +  V  +D G Y C A+N     +R+   + V  APVIT+  P    A Q     + L C ++A P P+   I W     Q +     ++I   A+ D+ T   LR+   +        Y C ATN  G   + V    +  P      P  CG
Sbjct:   83 SRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVIS-TVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRR--ENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQY---DMDLECHIEAYPPPA---IVWTKDDIQ-LANNQHYSISHFATADEYTDSTLRVITVEKRQYGD--YVCKATNRFGEAEARVNLFETIIP----VCPPACG 331          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|Q92154|SMP_COTJA (Schwann cell myelin protein OS=Coturnix japonica OX=93934 GN=SMP PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.232e-14
Identity = 68/232 (29.31%), Postives = 109/232 (46.98%), Query Frame = 2
Query:  386 ACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
             C V +  + ++ +A+  L +   PQ+       +V  G D+ L C A G PAP++ W R  G+  + +  G  L   ++ LS V   D G ++C AEN  G   R   L V++AP   +  NG + + + G  V +TC  +++P           +   T+  GG    K +A+   E    + + PA+ +  DG TYSC A N  G  S+S    S ++P PL+    RC
Sbjct:  215 GCGVTFINSSLSFQADVGLDVQYEPQVVGLWGPTEVVEGSDVELGCEAEGRPAPLISWFR--GSEVLREEPGRNL---RLLLSNVGPDDGGSFSCVAENRHGRHNRSLQLRVAYAPRAPVI-NG-SLWVVSGDPVSVTCRAESEP-----------AAILTVLRGG----KVMAAAIYEDHVTMEMRPARPE--DGGTYSCVAENQHGASSTSFNI-SVEYP-PLVLPASRC 420          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|P15364|AMAL_DROME (Protein amalgam OS=Drosophila melanogaster OX=7227 GN=Ama PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 3.476e-14
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNS----IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK-VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGS-EERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            G+++   CTV  + Q  ++ W K P + D+ + V   + + S    RY +   + P +        I  +E +  G Y C+V+ SA     K + +L I   P I     K+  V  G+++ L+C ANG P P + W R   ++ ++   G +L    + +  V   D G Y C A+N  G  ++R   + V   P I +        QM+    +L C V+  P P+   + W  +    + +     +   AS+   T  +LRI     +D     Y C+ATN LG   + +    +  P P ++
Sbjct:   39 GDSVEFNCTVEEVGQL-SVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTK-KLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAR--EHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAV--QRPKIAQMVSHSAELECSVQGYPAPT---VVWHKNG-VPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGD--YYCNATNKLGHADARLHLFQTVIPVPSLS 333          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 6.971e-14
Identity = 81/317 (25.55%), Postives = 128/317 (40.38%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            V ++++VPP       A+   +  V +    V+ CT   +P   +I W K     +    +P   G        Y+I      +S  +EIL  +  +AG Y C    +A   +A    TL + + P I     +  V     I L C A G P+P + W++ G N N       VL S  + +S+   +DAG Y C A+N  G+   K  L+V   PV  I+P+       +   + L+C     P P   DI W           GR  ++++    Q       +  A +   D   Y+C A N  G+ S+S   
Sbjct: 3889 VDLTVQVPPS-----IADEPTDFLVTKHAPAVITCTASGVPFP-SIHWTK-----NGIRLLPRGDG--------YRI-----LSSGAIEILATQLNHAGRYTCVARNAAG--SAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFITWQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV--ISPHLKEYVIAVDKPITLSCEADGLPPP---DITWHKD--------GRAIVESIR---QRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKL 4163          

HSP 2 Score: 70.8626 bits (172), Expect = 2.004e-11
Identity = 60/243 (24.69%), Postives = 101/243 (41.56%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMV----QLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            + I+  + +   +Y C     A V N      L +F  P +  +    ++    G   +++CI +G PAP + W R G    +  +  V  +   + L +   +D+G Y C A NE G   + F L V   P I    NG+  ++ +  +V    +LTC+    P P  + +K      QT        ++TL   +     +LRI  AQ++D     Y+C A++  G        R    PN
Sbjct: 3398 IRIVRAQVSDVAVYTCVASNRAGVDNK--HYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHI----NGSEEHEEISVIVNNPLELTCIASGIPAPKMTWMKDGRPLPQT------DQVQTLGGGE-----VLRISTAQVEDTG--RYTCLASSPAGDDDKEYLVRVHVPPN 3621          

HSP 3 Score: 70.4774 bits (171), Expect = 2.445e-11
Identity = 86/323 (26.63%), Postives = 129/323 (39.94%), Query Frame = 2
Query:   71 ITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNA-KAERTLMIFDVPQITYTE------FKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            +T  V +++ VPPK        G  ++ V+ G  + + C     P    I W K    G ST  V     +++ D +              L I     + AGIY C    + N+    + E TL + + P +   E      F+ +V + + I   C A G P P + W    G     +  G+ +  +   L  + VT  D G Y C A NE G+ ERK+ L V   PVI       N   +L  +  L C V+  P P    I W     Q   +    TI+T+ +       IL+++ A  +D     YSC A N  GT
Sbjct: 1159 VTQAVKLNVHVPPK-----IQRGPKHLKVQVGQRVDIPCNAQGTPLP-VITWSK----GGSTMLVDGEHHVSNPDGT--------------LSIDQATPSDAGIYTC---VATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERV-ANQRIEFPCPAKGTPKPTIKWLH-NGRELTGREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPI---IMWYKDNVQVTESS---TIQTVNNGK-----ILKLFRATPEDAG--RYSCKAINIAGT 1439          

HSP 4 Score: 69.3218 bits (168), Expect = 6.223e-11
Identity = 83/321 (25.86%), Postives = 127/321 (39.56%), Query Frame = 2
Query:  149 MYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI--TYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM----VQLTCVVKADPVPSSSDIKWASSKQ-------QTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            + V RG ++ LEC V  +P    + W K  +        P+ K      L    I          L++  +  +  G Y C  +  A + + K +  L +   P I   +   +N  V     ++L+C A+GIP P + W + G   ++  +  ++     + L Q T +DAG Y C   N  G E + F LSV   P I     G N  + +       V LTC V  +PVP   +I W    Q         I +GGRF               L+I   Q+       Y+C A++  G  S S  F  + F +P I G
Sbjct: 2302 IIVTRGKSISLECEVQGIPPP-TVTWMKDGH--------PLIKAKGVEILDEGHI----------LQLKNIHVSDTGRYVCVAVNVAGMTDKKYD--LSVHAPPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIV----GENTLEDVKVKEKQSVTLTCEVTGNPVP---EITWHKDGQPLQEDEAHHIISGGRF---------------LQITNVQVPHTG--RYTCLASSPAGHKSRS--FSLNVFVSPTIAG 2575          

HSP 5 Score: 65.855 bits (159), Expect = 7.286e-10
Identity = 76/316 (24.05%), Postives = 121/316 (38.29%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFA---NGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-ITPNGNNAYQ--MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            V +++ V P+ F  Q     +  + + V  G  + L C V ++P    I W K     ++    P +   T       KI + +  +S             G+Y C     A  V    +  L +   P+I       KV  G+ + + C A G P P++ W + G    +     V      +++ Q T  DAG+Y C A N  G++E +  L V   P +  + P  N  +Q  +    ++  C  K  P P+   IKW  + ++   TG    I  L   D     I  + P      D   Y C A N  GT
Sbjct: 1064 VQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPP-IITWAK-----ETQLISPFSPRHTFLPSGSMKITETRTSDS-------------GMYLCVATNIAGNVTQAVK--LNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPT---IKWLHNGRE--LTGREPGISILE--DGTLLVIASVTP-----YDNGEYICVAVNEAGT 1346          

HSP 6 Score: 65.4698 bits (158), Expect = 1.020e-9
Identity = 63/232 (27.16%), Postives = 94/232 (40.52%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVL--YSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            AGIY C    SA     K   TL   + P++   + +  V  G    + C  +GIP P V W +  G+  +  +T +++      + + +    DAG Y C A NE G    K  L V   PV    P   +    +G  V L C V+  P P+   IKW       I +   F++ +++        IL ++ +     D  TY C A N  G   S  T   +    PLI
Sbjct:  676 AGIYGCLASNSAGT--DKQNSTLRYIEAPKLMVVQSELLVALGDITVMECKTSGIPPPQVKWFK--GDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEP--ADVSMEIGSNVTLPCYVQGYPEPT---IKWRRLDNMPIFS-RPFSVSSISQLRTGALFILNLWAS-----DKGTYICEAENQFGKIQSETTVTVTGLVAPLI 892          

HSP 7 Score: 64.6994 bits (156), Expect = 1.427e-9
Identity = 75/310 (24.19%), Postives = 117/310 (37.74%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            + + +  PP     + A   +N  V   N + LEC     P     ++K       ST+   +N+G                     ++I + + + AGIY C  + SA     +   +L +   P I+ +     V     + L C A GIPAP + W + G   +   N   VL   ++  L+     D G Y C A N  G ++R   L V   P   I     N   ++   V+L C   A P P+   + W           G   +K    +  E   +L+I  AQ+ D     Y+C ATN  G
Sbjct: 1911 IQLHVHEPPS---LEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQI-------------------IDIESAQISDAGIYKCVAINSAGAT--ELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPP--NIMGEEQNVSVLISQAVELLCQSDAIPPPT---LTWLKD--------GHPLLKKPGLSISENRSVLKIEDAQVQDTG--RYTCEATNVAG 2181          

HSP 8 Score: 64.3142 bits (155), Expect = 1.880e-9
Identity = 62/228 (27.19%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSG-KDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N  +L I   + +  G+Y C  M +    + K E  + +   P I  +    +V    K + L CIANGIP P + W +     N  +    +  S +V  +++   +DAG Y C A N  G  ++   L V   P +       N   ++   VQL C    +PVP    I W   K   + +G   T  T  +  Q    I+ I  AQ+ D     Y C A N+ G
Sbjct: 1786 NGRKLVIAQAQVSNTGLYRC--MAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPV---ITWY--KDNRLLSGS--TSMTFLNRGQ----IIDIESAQISDAG--IYKCVAINSAG 1998          

HSP 9 Score: 64.3142 bits (155), Expect = 2.393e-9
Identity = 52/195 (26.67%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  278 GLTSYDLSRYKIGQG-------KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVP-QITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS----NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP 826
            GL   D++ +K G+        +  +S  L+I  V+   AG Y C    +ANV  + +  T +   VP +I  TE    V+      L C+A+GIP P + W++     N++    +  Y+     ++ L  V  +D+G Y C A N  G +    +L+V   P  T  P   +  +  G  ++L+C     P+P
Sbjct: 4104 GLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQPGDAGHYTC---MAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKK----DNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNK--GEQLRLSCKATGIPLP 4289          

HSP 10 Score: 62.3882 bits (150), Expect = 7.393e-9
Identity = 60/241 (24.90%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCM-VQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            +LEI++ +E   G Y C     A     K E  +++   P I   +  +   V     + L C   G P P ++W + G   +      ++L   ++ ++Q    + GLY C A N  G  +++F ++V   P  TI  +G +   ++    V L C+    P PS   I W    Q   T  G   I       Q +  +L+I    L+D     Y+C ATNA G     +     + P+
Sbjct: 1696 KLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLV--PPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPP--TIKSSGLSERVVVKYKPVALQCIANGIPNPS---ITWLKDDQPVNTAQGNLKI-------QSSGRVLQIAKTLLEDAG--RYTCVATNAAGETQQHIQLHVHEPPS 1920          

HSP 11 Score: 62.003 bits (149), Expect = 1.137e-8
Identity = 73/323 (22.60%), Postives = 119/323 (36.84%), Query Frame = 2
Query:   89 ISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV--VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            +++ VPP         G  ++ +    + VLEC    +P    I W+K             +  + + + +RY I +        L I +   T  G Y C    +A     + +  L +   P I        V      TL+C A GIP P + WR+ G   N+ +N     +L S  + +   +  D   Y C   N  G ++R   L+V   P I   P      +    ++  TC     P PS   I W  +  + +  G  + I +  +        + I   QL+      Y+C A NA G+    VT    + P
Sbjct: 3707 LTVNVPPN-----IKGGPQSLVILLNKSTVLECIAEGVPTP-RITWRK-------------DGAVLAGNHARYSILENG-----FLHIQSAHVTDTGRYLCMATNAAGTDRRRID--LQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVI--TCTASGVPFPS---IHWTKNGIRLLPRGDGYRILSSGA--------IEILATQLNHAG--RYTCVARNAAGSAHRHVTLHVHEPP 3988          

HSP 12 Score: 60.8474 bits (146), Expect = 2.262e-8
Identity = 66/247 (26.72%), Postives = 106/247 (42.91%), Query Frame = 2
Query:  344 LEILTVEETY---AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVV-----LYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSH--APVITITPNGNNAYQMLGCMVQLTCVVKA-DPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            L +L ++ET    AG Y C  +  A     K   TL +   P          ++ G ++TL C   G P P + WRR+  N  I      V     L +  + +  +   D G Y C AEN++G  + +  ++V+   AP+I I+P+  N  +  G  + L C + A +P+P    IK ++   Q        T+++  S        L I   QL   DG  Y+C A+N  GT + + +      P
Sbjct:  754 LGLLKIQETQDLDAGDYTCVAINEAGRATGKI--TLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRL-DNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVANVIE--GQQLTLPCTLLAGNPIPERRWIKNSAMLLQN----PYITVRSDGS--------LHIERVQLQ--DGGEYTCVASNVAGTNNKTTSVVVHVLP 981          

HSP 13 Score: 59.6918 bits (143), Expect = 5.074e-8
Identity = 60/250 (24.00%), Postives = 101/250 (40.40%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIG-----GNSNI-IKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            L++       AG Y+C+ +  A    ++    + +   P I  T F N+V     +D+ L C   G P P + W + G     G+ N+ + + G VL+     L      D G Y C   N  G + +   L++   P I       +   ++  +++L C  +  P+P+   I W    Q  +++     I      D+  +  L I  AQ+   D  TY+C   N  GT   S  F    +  P+I G
Sbjct: 1416 LKLFRATPEDAGRYSCKAINIAGT--SQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLH-----LKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPA---ITWYKDGQPIMSSSQALYI------DKGQY--LHIPRAQVS--DSATYTCHVANVAGTAEKS--FHVDVYVPPMIEG 1643          

HSP 14 Score: 59.3066 bits (142), Expect = 8.279e-8
Identity = 80/255 (31.37%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERT----LMIFDVPQITYTEFKNKV--DSGKDITLSCIANGIPAPIVLWRRIGGNSNII-KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-------ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            LE + +E++  G Y C     AN  NA  E T    L +  +P  T+TE    V  + G+ + LSC A GIP P + W     N+NII  +   V   +++ + +V+ +D+G Y C AEN  G  +    + V   PV         I P G NA         L C VK DP P+   I+W + K   I    R  I+ L +        L IY    +D     Y+C ATN  G    S++  + Q P P+IT
Sbjct: 4226 LENVVLEDS--GFYTC----VAN--NAAGEDTHTVSLTVHVLP--TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTF---NNNIIPAHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAI--------LNCEVKGDPTPT---IQW-NRKGVDIEISHR--IRQLGNGS------LAIYGTVNEDAG--DYTCVATNEAGVVERSMSL-TLQSP-PIIT 4443          

HSP 15 Score: 56.9954 bits (136), Expect = 3.624e-7
Identity = 58/228 (25.44%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-----VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            L I   E +  G Y C  +  A   +      L ++  P I   E +  V++    +TL+C A GIP P + W +   N   I+N+      ++   +++ +++  + D+G Y C A N  G  ++ + LS+   P +      ++   +LG  V+L C     P P    I+W     + I +G    I+  A+        L IY A   D     Y+C ATN  G
Sbjct: 3115 LHIKKAEVSDTGQYVCRAINVAGRDDKNFH--LNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPPPTIAWLK---NHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPL---IQWLKDG-KPIASGETERIRVSANGS-----TLNIYGALTSDTG--KYTCVATNPAG 3326          

HSP 16 Score: 56.6102 bits (135), Expect = 5.108e-7
Identity = 61/253 (24.11%), Postives = 109/253 (43.08%), Query Frame = 2
Query:  329 PNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN----KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN--QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
            P    L+I+  + +  G Y C  +  A    +K + +L ++  P I   + ++     V  G  ++L C +N +P P++ W + G    I ++T V + ++   + + +    D G Y C A N  G +++ F L+V   P I   P      + +   V LTC     P P+   I W  + ++ I       ++ L+   +     L+I  +Q  D     Y+C A+N  G  +    F S Q P P + G
Sbjct: 3015 PGGRTLQIIRAKVSDGGEYTCIAINQAG--ESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNG--RMITESTHVEILADGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIE-GPEREVIVETISNPVTLTCDATGIPPPT---IAWLKNHKR-IENSDSLEVRILSGGSK-----LQIARSQHSDSG--NYTCIASNMEGK-AQKYYFLSIQVP-PSVAG 3249          

HSP 17 Score: 56.225 bits (134), Expect = 6.721e-7
Identity = 58/247 (23.48%), Postives = 94/247 (38.06%), Query Frame = 2
Query:  338 IRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGP 1072
            +R+    VE+T  G Y C  + S+   +   E  + +   P I  T+    +     + +TL C ++ +P P++ W R G          ++     + ++     D   Y C A N  G   R+F L+V+  P I   P   +   +L     L C+ +  P P    I W            R++I       +  F  L I  A + D     Y C ATNA GT    +  +    P  +  GP
Sbjct: 3584 LRISTAQVEDT--GRYTC--LASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGP--QSLVILLNKSTVLECIAEGVPTPR---ITWRKDGAVLAGNHARYSIL------ENGF--LHIQSAHVTDTG--RYLCMATNAAGTDRRRIDLQ-VHVPPSIAPGP 3810          

HSP 18 Score: 55.8398 bits (133), Expect = 9.635e-7
Identity = 45/187 (24.06%), Postives = 75/187 (40.11%), Query Frame = 2
Query:  491 VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFP 1051
            V +G+++TL C    +P PI+ W +     +        L S  + +++    D+G+Y C A N  G+  +   L+V   P I   P   +    +G  V + C  +  P+P    I W+      +  G         S    T  I +  P+     D   Y+C ATN  GT  + +T    + P
Sbjct: 1091 VLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPK--HLKVQVGQRVDIPCNAQGTPLPV---ITWSKGGSTMLVDGEHH-----VSNPDGTLSIDQATPS-----DAGIYTCVATNIAGTDETEITLHVQEPP 1262          

HSP 19 Score: 55.4546 bits (132), Expect = 1.144e-6
Identity = 51/191 (26.70%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  338 IRLEILTVEETYAGIYACEVMYSANVVNAKAERT--LMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGN--SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQML---GCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGG 883
            +++E   V++T  G Y CE    A  V  K E+   + I+  P I  ++   +  V  G  I+L C ++GIP P ++W++ G    ++ +    ++    Q+ +S     DA LY+C A N  G+ ++++ L V   P  TIT +G++  +++   G  + L C V+  P P+   + W       I   G
Sbjct: 2159 LKIEDAQVQDT--GRYTCE----ATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRP--TITNSGSHPTEIIVTRGKSISLECEVQGIPPPT---VTWMKDGHPLIKAKG 2338          

HSP 20 Score: 54.6842 bits (130), Expect = 2.330e-6
Identity = 60/230 (26.09%), Postives = 94/230 (40.87%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS-GKDITLSCIANGIPAPIVLWRRIGGN---SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGN--NAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
             L I  V +  +G Y C    S   V  KA   + + + P        N ++  G +  L+C   G P P + W R G +   S+ I+  G    +  + +     +DAG Y C A NE G  ER  +L++   P+IT+ P     NA    G  + L C    +P P+   I W S +  +I+   R  + +  S          +Y A     D   + C A N +G+
Sbjct: 4312 ELVIERVSKEDSGTYVCTAENSVGFV--KAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLG----NGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEPVETVINA----GGKIILNCQATGEPQPT---ITW-SRQGHSISWDDRVNVLSNNS----------LYIADAQKEDTSEFECVARNLMGS 4517          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A430QLU6 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0000472 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 7.003e-68
Identity = 131/361 (36.29%), Postives = 197/361 (54.57%), Query Frame = 2
Query:   29 FSVLILLIGY------SHEQITPDVSISIEVPPKEFLK--QFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
            F ++I+LI +        + +TP+VSI  E P     +     N T+ +    G  ++++C VFNMP+   IFW++    GD  + V IN GL S D+SR++IGQGKQ +S+RLEI++++++Y G Y CE  Y+ +V  A+  R L +F  P I    + +    DSG  ++L C A+GIP P + WRR  G S+II+N G V   N +   QV   DAG Y CYAEN  G    +  L V HAP++ I P     +Q  GC ++L C++ A+P       +W S++  TIT+G   T  T  +       +L + P +  D  G  Y+C+A+N+LGT S++     S    PLI G + C
Sbjct:   31 FYIIIVLIVFFVPYVPCEQVVTPEVSIYDETPDAHTGRVVYLENKTVLINGLVGEKVIIQCNVFNMPRGARIFWRRDSLSGDEVSEV-INDGLMSRDMSRWEIGQGKQQDSVRLEIMSLDKSYEGKYTCECQYTGSVEPARVHRILRVFAKPNIVRHMSSYDTDADSGDPVSLHCNADGIPPPFIYWRRTAGASSIIRNFGTVKSGNVIKFDQVEADDAGEYMCYAENSMGRALWRVRLQVRHAPIVRIFP--VEPFQKSGCNLRLICLIDANPPVEKHACQWISNRTGTITSGSVGTRLTYLNAGLIRDLVLDLTPIKTLDF-GDLYTCTASNSLGTVSATTLITESFTEVPLINGRYAC 387          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A3Q0KLA3 (Putative neurotrimin (HNT) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.237e-66
Identity = 128/341 (37.54%), Postives = 187/341 (54.84%), Query Frame = 2
Query:   71 ITPDVSISIEVPPK--EFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
            +TP+VSI  E P      +    N T+ +    G  ++++C VFNMP+   IFW++    GD  + V IN GL S D+SR++IGQGKQ +S+RLEI++++++Y G Y CE  Y+ +V  A+  R L +F  P I    + +   VDSG  ++L C A+GIP P + WRR  G S+II+N G V   N +   QV   DAG Y CYAEN  G    +  L V HAP++ I P     +Q  GC ++L CV+ A+P       +W S++  TIT+G   T  T  +       +L + P +  D  G  Y+C+A+N+LGT S++     S     LI G   C
Sbjct:   18 VTPEVSIYDETPDALTGRVVYLENKTVLINGLVGEKVIIQCNVFNMPRGARIFWRRDSLSGDEVSEV-INDGLMSRDMSRWEIGQGKQQDSVRLEIMSLDKSYEGKYTCECQYTGSVEPARVHRILRVFAKPNIVRHMSSYDTDVDSGDPVSLHCNADGIPPPFIYWRRTAGASSIIRNFGAVKSGNVIKFDQVEADDAGEYMCYAENSMGRALWRVRLQVRHAPIVRIFP--VEPFQKSGCNLRLICVINANPPVEQHACRWISNRTGTITSGSVGTRLTYLNAGLIRDLVLDLTPIKTLDF-GDLYTCTASNSLGTISATTMITESFSEVLLINGRHAC 354          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A095BUC0 (Neural cell adhesion molecule 1 OS=Schistosoma haematobium OX=6185 GN=MS3_00611 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 3.999e-65
Identity = 118/308 (38.31%), Postives = 174/308 (56.49%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
            G  ++++C VFNMP+   IFW++    GD  + V IN GL S D+SR++IGQGKQ +S+RLEI++++++Y G Y CE  Y+ +V  A+  R L +F  P I    + +    DSG  ++L C A+GIP P + WRR  G S+II+N G V   N +   QV   DAG Y CYAEN  G    +  L V HAP++ I P     +Q  GC ++L C++ A+P       +W S++  TIT+G   T  T  +       +L + P +  D  G  Y+C+A+N+LGT S++     S    PLI G + C
Sbjct:   66 GEKVIIQCNVFNMPRGARIFWRRDSLSGDEVSEV-INDGLMSRDMSRWEIGQGKQQDSVRLEIMSLDKSYEGKYTCECQYTGSVEPARVHRILRVFAKPNIVRHMSSYDTDADSGDPVSLHCNADGIPPPFIYWRRTAGASSIIRNFGTVKSGNVIKFDQVEADDAGEYMCYAENSMGRALWRVRLQVRHAPIVRIFP--VEPFQKSGCNLRLICLIDANPPVEQHACQWISNRTGTITSGSVGTRLTYLNAGLIRDLVLDLTPIKTLDF-GDLYTCTASNSLGTVSATTMITESFTEVPLINGRYAC 369          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A4Z2DHV0 (Neural cell adhesion molecule 1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000782 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.390e-64
Identity = 129/360 (35.83%), Postives = 190/360 (52.78%), Query Frame = 2
Query:   29 FSVLILLIGY-----SHEQITPDVSISIEVPPKEFLK--QFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
              ++I+L+ +       + ITP+VSI  E P     +     N T+ +    G  +V++C VFNMP+   IFW++    GD  + V IN GL S D+SR+++GQGKQ +S+RLEI++++++Y G Y CE  Y+ +V  A+  R L +F  P I    + +    D G  +TL C A+GIP P + WRR  G S+II+N G V   N +   QV   DAG Y CYAEN  G    +  L V HAP++ I P      Q  GC ++L CV+ A+P       +W S++  TIT+G   T  T  +       +L + P    D  G  Y+C+A+N+LGT ++      S     LI G   C
Sbjct:   32 LKIIIMLVIFMPNVPCEQVITPEVSIYDETPDAHTGRVIYLENKTVLINGLVGEKIVIQCNVFNMPRGARIFWRRDSLSGDEVSEV-INDGLMSRDMSRWEVGQGKQQDSVRLEIMSLDKSYEGKYTCECQYTGSVEPARVHRILRVFAKPNIVRHMSSYNTDADFGDPVTLQCNADGIPPPFIYWRRTAGASSIIRNFGTVKSGNIIKFDQVEADDAGEYMCYAENSMGRALWRVRLQVRHAPIVRIYPVA--PLQKSGCNLRLMCVIDANPPVEQHACQWTSNRTGTITSGSVRTRLTYLNAGLIRDLVLDLEPISRLDF-GDLYTCTASNSLGTTTAITMVTESSTEVLLINGRHAC 387          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A5K4ELZ8 (Putative neurotrimin (HNT) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.560e-64
Identity = 128/341 (37.54%), Postives = 187/341 (54.84%), Query Frame = 2
Query:   71 ITPDVSISIEVPPK--EFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRC 1081
            +TP+VSI  E P      +    N T+ +    G  ++++C VFNMP+   IFW++    GD  + V IN GL S D+SR++IGQGKQ +S+RLEI++++++Y G Y CE  Y+ +V  A+  R L +F  P I    + +   VDSG  ++L C A+GIP P + WRR  G S+II+N G V   N +   QV   DAG Y CYAEN  G    +  L V HAP++ I P     +Q  GC ++L CV+ A+P       +W S++  TIT+G   T  T  +       +L + P +  D  G  Y+C+A+N+LGT S++     S     LI G   C
Sbjct:   18 VTPEVSIYDETPDALTGRVVYLENKTVLINGLVGEKVIIQCNVFNMPR--GIFWRRDSLSGDEVSEV-INDGLMSRDMSRWEIGQGKQQDSVRLEIMSLDKSYEGKYTCECQYTGSVEPARVHRILRVFAKPNIVRHMSSYDTDVDSGDPVSLHCNADGIPPPFIYWRRTAGASSIIRNFGAVKSGNVIKFDQVEADDAGEYMCYAENSMGRALWRVRLQVRHAPIVRIFP--VEPFQKSGCNLRLICVINANPPVEQHACRWISNRTGTITSGSVGTRLTYLNAGLIRDLVLDLTPIKTLDF-GDLYTCTASNSLGTISATTMITESFSEVLLINGRHAC 352          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam1a (neural cell adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-990415-31])

HSP 1 Score: 79.7221 bits (195), Expect = 2.371e-15
Identity = 69/239 (28.87%), Postives = 107/239 (44.77%), Query Frame = 2
Query:  332 NSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV-----PQIT--YTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA------SSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            N+  L+I  +++T  G Y CE       + A+ E  L I  V     P I   YT+     D G+ +TL+C A+G P PIV W  +    N ++N  +    +++T+  V   D G Y C A N+ G +E++ +LSV   P IT     N     L   + LTC    DP PS   I W+      S  +Q++   G   +++ A     T   ++         D   Y C+A N++G
Sbjct:  167 NNNHLQIRGIKKTDEGDYTCE-----GRIMARGEIDLRIIKVIVNVLPTIRTRYTKLNATADIGEAVTLACSADGYPEPIVTWAHL-EEENEMENYSLNDDGSELTIKDVKKVDEGDYVCIARNKAGEKEQEVSLSVFVQPKITYLE--NQTASELEEQITLTCEATGDPTPS---IVWSFGRRVFSEGEQSLD--GNVVVRSDARVSSLTLKYVQF-------TDAGQYLCTARNSIG 385          

HSP 2 Score: 77.7962 bits (190), Expect = 1.092e-14
Identity = 70/245 (28.57%), Postives = 106/245 (43.27%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW---RRIGGNSNIIKNTGVVLYSN----QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
             L I  V++   G Y C     A     + E +L +F  P+ITY E +   +  + ITL+C A G P P ++W   RR+        +  VV+ S+     +TL  V + DAG Y C A N  G + +   L V +AP I         Y   G    ++C V A P    + ++W    QQ    G   T   + +T   T   L + P    D    +Y+C+ATN +GT S       ++ P+
Sbjct:  264 ELTIKDVKKVDEGDYVCIARNKAG--EKEQEVSLSVFVQPKITYLENQTASELEEQITLTCEATGDPTPSIVWSFGRRVFSEGEQSLDGNVVVRSDARVSSLTLKYVQFTDAGQYLCTARNSIGEDIQGMYLEVRYAPKIQ---GAVTVYTWEGNAANISCEVLAHP---GAAVQWFRDGQQ--LPGVNTTNIKIYNTP--TVSYLEVTPESQGDFG--SYNCTATNVIGTESKEFLLIQAEVPS 494          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 76.6406 bits (187), Expect = 1.983e-14
Identity = 81/313 (25.88%), Postives = 119/313 (38.02%), Query Frame = 2
Query:  128 FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACE--VMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPL 1060
            F N         G+N ++ C V + P    + WK    K  S   V            R+KI      N+  L+I  +++T  G+Y CE  VM    +        + +    ++   E     D G    L+C  +G P P V+W+R        +  G     +++T+  V   D G Y C A N+ G  E + +L V   P IT   N   A +M   M  LTC    DP P+   I W S   +T T G +     +          L +  AQ    D   Y C+A NA+G  S  +       P  L
Sbjct:  112 FKNAPSPQEFTEGDNAIIVCDVVSSPPP-TVIWKHKRVKVQSEKDV------------RFKI-----LNNNHLQIRGIKKTDEGVYNCEGRVMTRGEIDFRPIRVVVNVLPTVRVRQAEVNATADLGLSAMLACDGDGFPEPTVMWKRE---EEEEEEEGFNEDGSEMTIMDVKKLDEGDYTCIASNKAGKAEEEVSLRVFVKPRITFLEN-QTATEMEEQMT-LTCEATGDPTPT---ITW-SYGTRTFTEGEQSADGMVVVRSDARVSSLTLKYAQY--TDAGEYLCTARNAVGETSQHMYLEVHYAPKIL 395          

HSP 2 Score: 70.8626 bits (172), Expect = 1.450e-12
Identity = 71/251 (28.29%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWR---RIGGNSNIIKNTGVVLYSN----QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNA-YQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN-PLIT 1066
             + I+ V++   G Y C  + S     A+ E +L +F  P+IT+ E +   +  + +TL+C A G P P + W    R         +  VV+ S+     +TL    Y DAG Y C A N  G   +   L V +AP I     G+ A Y   G    ++C   A   PS   I W      T+       IK + +T   +F  L + P   +D    +Y+C+A+N +GT S       ++ P+ P+IT
Sbjct:  257 EMTIMDVKKLDEGDYTC--IASNKAGKAEEEVSLRVFVKPRITFLENQTATEMEEQMTLTCEATGDPTPTITWSYGTRTFTEGEQSADGMVVVRSDARVSSLTLKYAQYTDAGEYLCTARNAVGETSQHMYLEVHYAPKIL----GSVAVYTWEGNPANISCETLAH--PSEVSIVWLRDG-FTLPNANTSNIK-IYNTPSASF--LEVNPDSQNDFG--SYNCTASNVIGTESKEFILIQAEVPSVPVIT 493          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 75.0998 bits (183), Expect = 8.219e-14
Identity = 79/318 (24.84%), Postives = 125/318 (39.31%), Query Frame = 2
Query:  128 FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACE--VMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS---NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIY------PAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQF 1048
            F N         G+N ++ C V + P    + WK    K  S   V            R+KI      N+  L+I  +++T  G+Y CE  VM    +        + +    ++   E     D G    L+C  +G P P V+W+R   N  ++++     ++   +++T+  V   D G Y C A N+ G  E + +L V   P IT   N   A +M   M  LTC    DP P+   I W+            +  +T    +QE   + RIY      P Q    DG+    S         SS+T + +Q+
Sbjct:   22 FKNAPSPQEFTEGDNAIIVCDVVSSPPP-TVIWKHKRVKVQSEKDV------------RFKIL-----NNNHLQIRGIKKTDEGVYNCEGRVMTRGEIDFRPIRVVVNVLPTVRVRQAEVNATADLGLSAMLACDGDGFPEPTVMWKRSLRNDVLLESGDKYSFNEDGSEMTIMDVKKLDEGDYTCIASNKAGKAEEEVSLRVFVKPRITFLEN-QTATEMEEQMT-LTCEATGDPTPT---ITWS------------YGTRTFTEGEQEH--LKRIYQASWTRPEQHKSADGMVVVRSDARV-----SSLTLKYAQY 297          

HSP 2 Score: 63.929 bits (154), Expect = 2.376e-10
Identity = 71/269 (26.39%), Postives = 113/269 (42.01%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRR-----IGGNSNIIKN---------------TGVVLYSNQVTLSQVT-----YQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNA-YQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN-PLIT 1066
             + I+ V++   G Y C  + S     A+ E +L +F  P+IT+ E +   +  + +TL+C A G P P + W         G    +K                 G+V+  +   +S +T     Y DAG Y C A N  G   +   L V +AP I     G+ A Y   G    ++C   A   PS   I W      T+       IK + +T   +F  L + P   +D    +Y+C+A+N +GT S       ++ P+ P+IT
Sbjct:  173 EMTIMDVKKLDEGDYTC--IASNKAGKAEEEVSLRVFVKPRITFLENQTATEMEEQMTLTCEATGDPTPTITWSYGTRTFTEGEQEHLKRIYQASWTRPEQHKSADGMVVVRSDARVSSLTLKYAQYTDAGEYLCTARNAVGETSQHMYLEVHYAPKIL----GSVAVYTWEGNPANISCETLAH--PSEVSIVWLRDG-FTLPNANTSNIK-IYNTPSASF--LEVNPDSQNDFG--SYNCTASNVIGTESKEFILIQAEVPSVPVIT 427          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 73.1738 bits (178), Expect = 2.874e-13
Identity = 65/267 (24.34%), Postives = 122/267 (45.69%), Query Frame = 2
Query:  296 LSRYKIGQG----KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQ--ETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQ-FPNPLITG 1069
            +++YK  +G    K+ +    E++     +    +CEV       N    R + ++  P++       +VD G D   +C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ E++ +L+V+  P I+ T      +   G   Q+ C +++ P P      W  +  ++  T GR+T++T+++ D    T  +  I PA    +    Y+C+A N+ G+ +  +  +  +  P  +I G
Sbjct:  231 VTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNIS--RNVDVYFGPRMAAEPQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRG--------SGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKG---QIKCFIRSTPPPDRIAWSWKETVLES-GTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTI----YNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 73.1738 bits (178), Expect = 3.096e-13
Identity = 65/267 (24.34%), Postives = 122/267 (45.69%), Query Frame = 2
Query:  296 LSRYKIGQG----KQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS-NQVTLSQVTYQDAGLYACYA-ENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQ--ETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQ-FPNPLITG 1069
            +++YK  +G    K+ +    E++     +    +CEV       N    R + ++  P++       +VD G D   +C   G P+  ++W + G        +GVVL + N +TL  V  +DAG Y C A     G+ E++ +L+V+  P I+ T      +   G   Q+ C +++ P P      W  +  ++  T GR+T++T+++ D    T  +  I PA    +    Y+C+A N+ G+ +  +  +  +  P  +I G
Sbjct:  231 VTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNIS--RNVDVYFGPRMAAEPQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRG--------SGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKG---QIKCFIRSTPPPDRIAWSWKETVLES-GTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTI----YNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 67.781 bits (164), Expect = 3.802e-12
Identity = 71/301 (23.59%), Postives = 117/301 (38.87%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLT---SYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV--SHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILR-IYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQF 1048
            G ++ LEC+    P    + W +     D +  +P +   +   S  L   + G G +                G Y C    + + + A A  T+++   PQ         V  G  + L C A G P P++ W + G      +    VL S  + +++V   D G + C A N  G       L+V     PV ++TP  ++     G  V++ C  + +P PS   + WA      IT  G+F +        E +  +R   PA     D   Y C A N++G  S+S+    + F
Sbjct:  293 GESVTLECSAGGHPAP-RVSWTR-----DDSEQLPADPRFSVTASGGLHVERAGPGDE----------------GRYTCHASNNQDSIRASA--TILLKSAPQFILAPEDQVVTEGHTVDLHCEAQGRPLPVIAWTKAGSQLPSDRRL-TVLSSGTLRIARVALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPVFSVTP--SDITTDSGRDVRIACSAQGEPQPS---LMWAKDGVH-ITESGKFHVSA------EGYLEIRDAGPA-----DQGRYECIARNSIGHASTSMLLSVTAF 551          

HSP 2 Score: 62.7734 bits (151), Expect = 1.427e-10
Identity = 54/202 (26.73%), Postives = 75/202 (37.13%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ---ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVP----SSSDIKWASSKQQTITTGGRFTIKTLASTDQETF 928
            L I     T  G Y C     A  V A  E  L  FDVP            +V  G+ +TL C A G PAP V W R             V  S  + + +    D G Y C+A N   S      + +  AP   + P      +  G  V L C  +  P+P    + +  +  S ++ T+ + G   I  +A  DQ  F
Sbjct:  239 LMIRDTRHTDQGTYQCMARNVAGEVKA-PEVVLRYFDVPAPPTFVIQPHDTEVLVGESVTLECSAGGHPAPRVSWTRDDSEQLPADPRFSVTASGGLHVERAGPGDEGRYTCHASNNQDSIRASATILLKSAPQFILAPEDQVVTE--GHTVDLHCEAQGRPLPVIAWTKAGSQLPSDRRLTVLSSGTLRIARVALHDQGQF 437          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 66.6254 bits (161), Expect = 7.984e-12
Identity = 82/341 (24.05%), Postives = 127/341 (37.24%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKK--YPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIG-------GNSNIIKNTGVVLYS--NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAP-----VITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
            D+ + + V P   ++Q A   +N    RG N  L CT    P+   I W +  +P    S    P   G  S     + +     P  I+ ++   E T                N +     + F  P+ITY E K   +  + I L+C + G P P + WRR+        G   +     V  Y+  + +TL  V Y DAG Y C A N  G       L V++ P      +T     NNA       V +TC V A+P    + + W+   Q   +      +  +       F +L I P    D    +Y+C A N + + S       +  P+
Sbjct:   90 DIRVLVNVAPTVRVRQNA---VNATADRGENARLVCTADGFPEP-IITWTRSIHPVMKSS----PERDGHLSQHPG-HSVSHRDVPKKIKGDMGDKEAT----------------NVQTNFHSLYFLKPEITYLENKTTSELEEQIVLTCESEGEPLPTITWRRVSDQHVFRQGQQTLEGRIEVRSYAKVSSLTLRDVQYTDAGEYMCIANNNVGQASAAMHLDVAYGPKFAGEKVTYHSWPNNA-------VNVTCEVLANP---KAAVSWSRDGQPIPSA----NLTNVIVHSFPGFSVLEITPESQSDFG--SYNCVAVNNIASESKEFVLVEAALPS 389          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010567.1 (pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1 gene:ENSPMAG00000009565.1 transcript:ENSPMAT00000010567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.206e-10
Identity = 81/305 (26.56%), Postives = 112/305 (36.72%), Query Frame = 2
Query:  149 MYVKRGNNMV-------LECTVFNMPQQGNIFWKKYPYK----GDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEI-----LTVEE---TYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-------VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHA------PVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWAS-----SKQQTITTGGRFTIKTLASTDQETFCILRIYPA 952
            MYV  G NMV        E  VF  P     F +K P       DS A              R++   G  P   R EI     L VE    T  G Y C  +    V  A+A  +L++   PQ         V  G+  T  C   G P P V W+R G  + +  N          V  +  +T++ V   D+G Y C A +  GS   K  L V  A      P+I   P   N    +G +  L C     P PS   +K  S     S +  + +GG  +IK +   D   +  + + P+
Sbjct:  199 MYVCVGTNMVGERDSEPAELAVFERP----TFARK-PMNLVMLADSDAEFRCEVHGDPPPTVRWRKEDGDLPKGSRFEIQDDYTLRVERVGGTDEGTYTC--VGENRVGKAEASASLVVHAPPQFVVRPRDQIVAQGQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQPSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGP--ANQTLAVGSVALLACQAMGMPTPSVHWLKDGSKLSLGSARLGLQSGGTLSIKDVQLMDAGLYTCVAVSPS 494          

HSP 2 Score: 51.9878 bits (123), Expect = 2.718e-7
Identity = 46/184 (25.00%), Postives = 74/184 (40.22%), Query Frame = 2
Query:  488 KVDSGKDITLSCIA-NGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFA-LSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            KV + +   + C    G P P V W+R  G +   K+  V +   ++ +S     DAG+Y C   N  G  + + A L+V   P     P   N   +     +  C V  DP P+   ++W   +   +  G RF I+     D  T  + R+        D  TY+C   N +G   +S + 
Sbjct:  142 KVAAREPAVMECRPPRGHPEPTVSWKR-NGVALTDKDERVTIRGGKLMISNTQKADAGMYVCVGTNMVGERDSEPAELAVFERPTFARKP--MNLVMLADSDAEFRCEVHGDPPPT---VRW-RKEDGDLPKGSRFEIQ-----DDYTLRVERV-----GGTDEGTYTCVGENRVGKAEASASL 308          

HSP 3 Score: 48.9062 bits (115), Expect = 2.609e-6
Identity = 49/204 (24.02%), Postives = 78/204 (38.24%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV------PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYA 676
             S+ +  PP     QF     +  V +G +    C     P    +FW++   +G      P      S   SR+ + Q     +  L I  V+ + +G Y C+ +  A  + AKA   L + D       P I        +  G    L+C A G+P P V W + G   ++      +     +++  V   DAGLY C A
Sbjct:  306 ASLVVHAPP-----QFVVRPRDQIVAQGQSATFLCETTGNPPPA-VFWQR---EGSQNLLFPNQPSQPS---SRFSVSQ-----TGHLTITDVQRSDSGYYTCQALSVAGSILAKA--LLEVGDALADSPPPIIRQGPANQTLAVGSVALLACQAMGMPTPSVHWLKDGSKLSLGSARLGLQSGGTLSIKDVQLMDAGLYTCVA 490          

HSP 4 Score: 48.521 bits (114), Expect = 3.045e-6
Identity = 39/166 (23.49%), Postives = 63/166 (37.95%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAER--TLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN-QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPS 829
            +L I   ++  AG+Y C      N+V  +      L +F+ P          + +  D    C  +G P P V WR+  G  ++ K +   +  +  + + +V   D G Y C  EN  G  E   +L V   P   + P      Q  G      C    +P P+
Sbjct:  186 KLMISNTQKADAGMYVC---VGTNMVGERDSEPAELAVFERPTFARKPMNLVMLADSDAEFRCEVHGDPPPTVRWRKEDG--DLPKGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLVVHAPPQFVVRPRDQIVAQ--GQSATFLCETTGNPPPA 344          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004759.1 (pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 gene:ENSPMAG00000004331.1 transcript:ENSPMAT00000004759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.179e-10
Identity = 72/306 (23.53%), Postives = 113/306 (36.93%), Query Frame = 2
Query:  140 TINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEV---MYSAN---VVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSN-IIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            T  M+  +G+ +V+EC    +P   ++ W++                  S  + R +   G    ++RL  + VE++  G Y C     M SA+   VV     R       P  T       V  G D  L C+A G P P   W   G   N         +  +++ L ++    + +Y C A N +G+      +SV   P   IT +      +    V L C V   P P+   I+W+   Q          + TL     + F    +Y  +    D   Y C ATN L TG+ +   R
Sbjct:  215 TTRMHSLKGSTLVMECIAEGLPTP-DVRWER-----------------VSGHMPRGRFSTGNHNKTLRLHPVEVEDS--GQYKCIASNNMGSAHHSFVVTVDGSRAA----APYWTARPEDRIVAPGDDAVLHCVAGGKPPPETHWLLNGKPLNEAPAEPHRTVKGDRIVLKKLVIGQSAVYQCVASNVFGTIIANALVSVLAVPPKFITKDKEEYVVVEKQPVLLDCKVFGSPKPA---IRWSKDGQ----------VNTLQDKKFKEFENGSLYIHEAKKADQGLYMCEATNDLDTGTINAKLR 483          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004605.1 (pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-1 gene:ENSPMAG00000004199.1 transcript:ENSPMAT00000004605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 2.842e-10
Identity = 64/280 (22.86%), Postives = 97/280 (34.64%), Query Frame = 2
Query:  134 NGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKN-KVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGV-VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA--------SSKQQTITTGGRFTIKTLASTDQETF-CILR 940
             G   + V  G  + L CT    P+   + W      GD    +P  +         +  G         L +       AG Y C     A V +A     + +   P++      +  V  G  + L C+A G P P+V+WR    +     +  + VL    + L  V   DAG Y C   N  G +     +S++ AP I   P         G  + L C    DP P    I W         SS +      G   I++ A +D   + C+ R
Sbjct:    7 RGATTVSVAAGRPLSLPCTASGWPEPA-VSWA---LPGDGGQLLPNQRSGAGSGARVFANGT--------LLVPAAMWRDAGTYKCTAANVAGVDSAAV--IVTVLGPPRVAAPPPGDVAVPYGGALRLRCVAEGEPRPVVVWRLPSASPPPSADRRMRVLPDGSLALDGVVASDAGRYVCTVRNRHGEDSATATVSINQAPQIQDKPERAVVRITSGDSIALECRASGDPAPL---ITWRLPDGSVPHSSGRLLTHANGSLEIRSAARSDAGRYACVAR 269          

HSP 2 Score: 58.151 bits (139), Expect = 1.979e-9
Identity = 43/175 (24.57%), Postives = 73/175 (41.71%), Query Frame = 2
Query:  458 PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKN------TGVVLYSNQVTL-SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADP-------VPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILR 940
            P +        V +G+ ++L C A+G P P V W   G    ++ N      +G  +++N   L     ++DAG Y C A N  G +     ++V   P +   P G+ A    G + +L CV + +P       +PS+S    A  + + +  G       +AS      C +R
Sbjct:    3 PTVVRGATTVSVAAGRPLSLPCTASGWPEPAVSWALPGDGGQLLPNQRSGAGSGARVFANGTLLVPAAMWRDAGTYKCTAANVAGVDSAAVIVTVLGPPRVAAPPPGDVAVPYGGAL-RLRCVAEGEPRPVVVWRLPSASPPPSADRRMRVLPDGSLALDGVVASDAGRYVCTVR 176          

HSP 3 Score: 56.6102 bits (135), Expect = 5.896e-9
Identity = 45/177 (25.42%), Postives = 72/177 (40.68%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQ----ITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIK--NTGVVLYS---NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            LEI +   + AG YAC    +    +A+    L +   P     +  T  + +V  G  + L+C A G P P   W   GG + + +  N G    +     + +   T  D G+Y C A +  G  +R   L V   P IT          + G  ++L C+    PVP   +++W
Sbjct:  251 LEIRSAARSDAGRYACVARGADGSRDARLSVDLTVMGAPAPPSFLAPTTERVEVAPGASVALACPARGEPPPQTTWTLPGG-AQLARGSNRGARFSAGLDGALLVRGATLADTGVYRCSARSPSGVADRVVLLEVGPQPRITPP----AVVVLRGAPLRLPCMASGAPVP---EVRW 419          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO32002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB1])

HSP 1 Score: 64.6994 bits (156), Expect = 1.150e-12
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  500 GKDITLSCIANGIPAPIVLWRRIGGNSNIIKN-TGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWA 850
            G+ +TL+C A G P P + W + G ++ +  N T  +++     ++ V   DAG Y C A NE G+  R  +++V + P I  TP    AY  LG  V L C   + P P    I WA
Sbjct:    4 GESLTLNCTATGCPTPNITWTKQGVSAALRSNITTEIIHQ----IASVQKSDAGRYTCAANNEIGAVSRTLSVTVHYPPTIVTTPKNTTAY--LGGNVTLYCNASSHPAP---QIYWA 112          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO27911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7Y5])

HSP 1 Score: 65.855 bits (159), Expect = 1.374e-12
Identity = 49/174 (28.16%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  491 VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITIT-PNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            VD   D+TL CI++G+P P+V W +  GN+ ++      L  N      +TYQD+G Y C A N   ++     L V   PVIT   P   +     G +  + C  +++P    ++  W     +   TG    ++++   D+     L I  A      G TY C A N +G
Sbjct:   15 VDEYDDVTLRCISDGVPEPVVTWYK-EGNATLLHTGKEFLVGN------LTYQDSGNYICQAVNSEATDRATLELVVQVVPVITTDKPTDTDIAGEAGKVSSIRCSARSEP---PAEYWWTRGSDRIPLTGSSPRVRSI--NDEGNSRTLMIEVASF----GETYYCHARNIMG 172          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO31942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF5])

HSP 1 Score: 65.855 bits (159), Expect = 1.776e-11
Identity = 80/321 (24.92%), Postives = 128/321 (39.88%), Query Frame = 2
Query:   71 ITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINK-GLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTIT------TGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            IT D +I+++ PP+    Q      N  V+ G  + L C V   P   ++ W K    G ST     N+ G T  +  +Y              + T     +G    + + +  +V  K     +I + P  T  E          + LSCI++G PAP+V W R G    ++ +   V YS+ VT S+     AG Y C A NE GS+     ++V++ P +  +    +++     ++ L C  +  P+P    I W     Q IT      +GG+  + T                   D  D   Y C A+N LG+
Sbjct:   80 ITQDFTINVQYPPEITPIQ------NTTVRAGETITLTCAVAGNPTP-SVSWSKA-GSGQSTGGNVFNEAGATKAETGQY--------------VCTAVNIVSGNTQTKTVSTYVIVKYKPS---IIANSPYQTVNETTGS------LKLSCISDGYPAPMVTWSRDG----VVVSPTSVYYSDSVTRSE-----AGTYTCTATNEMGSDTNTVQVTVNYKPEMASSTTNTSSWNRK--VLSLQCKARGVPLP---QITWYKPGGQPITAGVSPISGGQLQVTTTQ-----------------DSGDYGQYKCRASNLLGS 338          

HSP 2 Score: 57.3806 bits (137), Expect = 8.414e-9
Identity = 41/135 (30.37%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  491 VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENE--WGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRF 889
            V   KD +++C A+G PAP V W      S +   TG  + S    L ++    AG+Y C A N+   G+  + F ++V + P IT      N     G  + LTC V  +P PS   + W+ +     T G  F
Sbjct:   14 VAEDKDFSITCSASGRPAPNVTWVNKTSGSPVAHGTGSAILS----LLKIQRHQAGVYQCQATNDVKRGAITQDFTINVQYPPEITPI---QNTTVRAGETITLTCAVAGNPTPS---VSWSKAGSGQSTGGNVF 138          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 60.8474 bits (146), Expect = 6.445e-11
Identity = 56/185 (30.27%), Postives = 84/185 (45.41%), Query Frame = 2
Query:  485 NKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFA-LSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            N+ DS   +TL C A+G PAP + W   G     +++ G +L     TL  VT ++AG Y C A+N      +  A LSV+ AP I       +    LG  + LTC V+  P+PS   + W+  + Q       F+I     +      +L + P Q  D     Y C A N +G  S ++T +
Sbjct:   15 NRTDS---VTLQCHASGDPAPNITWSHEGAP---LEHNGSIL-----TLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIE-RQKKKHFETSLGKAINLTCDVEGGPLPS---VTWSRKRSQ-------FSI---IFSPVRMRSVLEVIPKQSRDFGD--YICMARNIMGWDSHTLTLK 172          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO30601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0B1])

HSP 1 Score: 61.2326 bits (147), Expect = 7.984e-11
Identity = 58/234 (24.79%), Postives = 91/234 (38.89%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW 847
            N  V+ G  + L C V   P   ++ W K      ++  V    G T  D  +Y              + T   T  G          N     A   +++  +P I  T     V+    + L+C ++G PAP V W R G    ++ +   V YSN VT S+     AG Y C A NE GS+     ++V++ P +  + N + +      ++ L C  +  P P    I W
Sbjct:    3 NTTVRAGETITLTCAVAGNPTP-SVSWSKAGSGHSTSGNVFTKAGATKADTGQY--------------VCTAVNTVTG----------NTQTRTASTYVIVKYIPSILPTPPDETVNETDSLKLTCTSDGYPAPTVTWSRDG----VVVSRTSVYYSNSVTRSE-----AGTYTCTATNEMGSDATTVQVTVNYKPEMESSTNRDTSSWDRK-VLSLQCKARGVPSP---HITW 198          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: hmcn2 (hemicentin-1 [Source:NCBI gene;Acc:101165068])

HSP 1 Score: 76.6406 bits (187), Expect = 3.463e-14
Identity = 65/250 (26.00%), Postives = 110/250 (44.00%), Query Frame = 2
Query:  236 PYKGDSTAAVPINKGLTSYDLSRYKIGQ------GKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIK------WASSKQQTITTGGRFTIKTLASTDQETFCILRI 943
            P  G S     +  G    +++ YK GQ      G + NS +LEI+ V+ +  G Y C+V   A  V+    RT  +   P +     +  ++S  G  + L C A G+P P + W + G   + ++    V   N++ L  ++   AG Y C A+N  G  ++ + L+V  +P I  +   ++    +G  V L C V   P P  S +K       ++S       GG+ T   L++ D  T+  L +
Sbjct: 1925 PQLGSSVTLRCVANGFPKPEVTWYKNGQQLAAGNGLKMNSNQLEIIGVQISDGGTYTCKVSNMAGQVD----RTFKLAVHPPVLDGPLRESINSTLGSHVALLCEATGVPVPSITWLKDGSPISSLQWQWSV-RGNRLELGPLSLSHAGTYTCVAKNSEGQTQKDYTLTV-QSPTILDSDQASDVSAPMGEEVTLDCRVNGIPTPRISWLKDGVTLVESNSHHILSPDGGKLTFLRLSAEDSGTYTCLAV 2168          

HSP 2 Score: 63.1586 bits (152), Expect = 4.673e-10
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKD--ITLSCIANGIPAPIVLWRRIG---GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTF 1033
            RL++  V  + AG+Y+C    ++N   +  +   +    P+I  + F  ++    +  + L C A G+P P + W + G     S+I+   G     N V +S+V  +DAGLY C A +  G + +   + V   P +  + +       L   + + C+  +DP P   DI+W   + + +  GGR  ++ LA    +   I  + P      DG  YSC  TN    GSSS+ F
Sbjct: 2334 RLQLPDVAPSDAGLYSC---VASNQAGSSTKSFNLTVLPPKIISSSFPVELTLAVNSPLELECSAEGVPPPTLSWLKDGRPLERSDIVHQDG-----NFVRISKVQVEDAGLYTCLASSLAGEDGKNTWVRV-QPPTLLGSGDVRTLSVPLNGHLTMECLADSDPPP---DIQWYKDEVK-LQLGGR--VQRLAGG--QYLEIQEMRPE-----DGGQYSCVVTNM--AGSSSLFF 2545          

HSP 3 Score: 63.1586 bits (152), Expect = 4.714e-10
Identity = 74/267 (27.72%), Postives = 111/267 (41.57%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDS--GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQ--------------------QTITTGGRF--TIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR--SSQFPNPLIT 1066
            L+I  V +   G Y C+ +  A   +   E  L +     +  +EF  ++ +     + L C   G PAP + W + G    + K++   + S+   L  V   D   Y C AEN+ G+ E+ F+L+V   P IT  P   +   + G M  L C V+A P P   +I W    Q                      +   G++  T    A  DQ++F +L IY   L  L     S S T  LG   SSVT R  ++ FP P +T
Sbjct: 1694 LQIPRVRKEDTGKYTCKAVNEAGEDHMHFE--LEVLPPVIMGTSEFMEEMGAVVNSTVVLHCEVTGHPAPAISWLKDG--QPVYKDSQHHISSDGTQLQSVQVSDMAGYMCVAENKVGTVEKLFSLTV-QPPTIT-GPREESVSVIEGHMASLLCDVQAYPPP---EITWTRDGQVLQFSTGVHILPGQMLQLPRARLEDAGQYVCTASNSAGQDQKSF-LLSIYLPTLKPLHDAE-SESMTPQLG---SSVTLRCVANGFPKPEVT 1946          

HSP 4 Score: 62.7734 bits (151), Expect = 7.250e-10
Identity = 64/232 (27.59%), Postives = 94/232 (40.52%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWG--SEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTI--TTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            LEI +   ++AG Y C     A V +     T+   ++ Q+   E +  +  G    L C   G+P P V W+R G    I  +   VL S  +  S+VT  DAG Y C A+N+ G    + K  L +S  P +  T        +LG  V L CV    P P   ++ W   ++     T    F+  TLA T  +               D   Y+C+A N  G  S  +
Sbjct: 2786 LEITSALPSHAGRYTCSARNPAGVAHKHISLTIQPPEIRQMP-EEVQAVLHHG--TVLPCDVQGLPRPSVTWQREG--VPIAAHRLAVLSSGALKFSRVTLGDAGTYQCVAKNDAGVAVAKTKLVLQLS-VPRVEYT-------AVLGQPVSLECVADGQPQP---EVTWHKDRRPVADSTHTHVFSNGTLAITSTQRS-------------DAGFYTCTARNVAGRASHDM 2988          

HSP 5 Score: 61.6178 bits (148), Expect = 1.714e-9
Identity = 66/229 (28.82%), Postives = 91/229 (39.74%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQV-TLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFC----ILRIYPAQLDDLDGVTYSCSATNALG 1009
            L I  V+  +AG +AC    SA     K     ++ + P I+ T    +  V   +++   C  +G PAP V W R G  S         L   QV  +  V  +D GLY C A N  G++ R+F L+V                 +LG    L C V+  P P    I W    Q  +            S+ Q T+      LR+  AQ  D  G+ YSC ATN  G
Sbjct: 1313 LRIYRVQPEHAGQFACTAQNSAGEARRKYN---IVVEPPVISGTSQLQELTVAQEQEVEFQCRVSGRPAPRVEWSRDGVLSRDGDPHVEFLEEGQVLKVKSVRLRDQGLYQCLARNNAGTQMRQFRLTVQ-----------TEMSVVLGFPTVLPCEVEGSPTPG---ITWLKDNQPIV------------SSPQLTYSRNGQALRLGSAQ-GDSSGL-YSCRATNPAG 1510          

HSP 6 Score: 60.8474 bits (146), Expect = 2.897e-9
Identity = 61/236 (25.85%), Postives = 93/236 (39.41%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTG-VVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGV-----TYSCSATNALGTGSSSVTF 1033
            L I  V+ + AG Y C     A   +   +  L +F  P I+   F   V +G    LSC   GIP+P V W+R G   +I  + G  +L S  + L   + +D G + C A N+ G EER+    +   P I        A +     V L C  + +P P+   + W  S  +    GG +                R+ P  L+    +      Y+CSA N  G     ++ 
Sbjct: 2606 LHIHQVQLSDAGRYYCTASNQAGSDHQAMD--LRVF-APSISPGPFNVTVTAGVRALLSCETTGIPSPKVSWKRNGTPLDISHHPGEYLLASGSLVLLSPSSEDEGYFECTAVNDVG-EERRVIEVILQPPSIEDDVTAVKAVKR--SSVVLPCHAQGEPEPT---VTWTKSGAKLGVRGGSY----------------RVLPTVLEITSALPSHAGRYTCSARNPAGVAHKHISL 2816          

HSP 7 Score: 58.5362 bits (140), Expect = 1.373e-8
Identity = 56/200 (28.00%), Postives = 87/200 (43.50%), Query Frame = 2
Query:  491 VDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIK-NTGV-VLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQ--MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFR 1078
            V  G   +L C     P P + W R G    +++ +TGV +L    + L +   +DAG Y C A N  G +++ F LS+ + P +    +  +      LG  V L CV    P P   ++ W  + QQ     G        +++Q     L I   Q+   DG TY+C  +N    G    TF+ +  P P++ GP R
Sbjct: 1832 VIEGHMASLLCDVQAYPPPEITWTRDG---QVLQFSTGVHILPGQMLQLPRARLEDAGQYVCTASNSAGQDQKSFLLSI-YLPTLKPLHDAESESMTPQLGSSVTLRCVANGFPKP---EVTWYKNGQQLAAGNG-----LKMNSNQ-----LEIIGVQIS--DGGTYTCKVSNM--AGQVDRTFKLAVHP-PVLDGPLR 2009          

HSP 8 Score: 58.151 bits (139), Expect = 1.903e-8
Identity = 39/133 (29.32%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV-----PQITYTEFKNKVD--SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSV 721
            L I  V+++ +G+Y C       V  ++A    + +DV     P + + E    V    G  +TL+C A+G+P P + W + G   ++ +N  +     ++ L  V   DAGLY+C A N+ GS  + F L+V
Sbjct: 2242 LLIAHVQQSDSGVYTC-------VARSRAGLAELSYDVQVQVPPGVDHVEPVEPVTVVQGSLVTLTCEAHGVPPPTLTWMKDGQPLSLHRNLLLDGQETRLQLPDVAPSDAGLYSCVASNQAGSSTKSFNLTV 2367          

HSP 9 Score: 57.7658 bits (138), Expect = 2.526e-8
Identity = 60/215 (27.91%), Postives = 84/215 (39.07%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQM---LGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            AG Y C    + NV  +      +    P+I    +    + G  ITLSC A G+P P V+W + G                   +   T  DAG+Y C A +  G   R+  LSV + P I    + +   +M   +G  V L C V+  P P    + W S     I     FTI    S        LRI   +L  +D   Y+C+A N  G
Sbjct:  901 AGTYIC---TAENVAGSANITVSLEVQPPEINAGPYHYIANEGVAITLSCEATGVPKPTVVWSKDG----------------HFHIPHPTSADAGIYICTATSHVGYASREIQLSV-NMPTILGVSSHDTVIKMSAEVGTEVVLPCEVQGSPSPL---VTW-SRNGHPIPPVTAFTILPSGS--------LRIIDVRL--MDSKLYTCTAENPAG 1081          

HSP 10 Score: 56.225 bits (134), Expect = 7.514e-8
Identity = 68/308 (22.08%), Postives = 117/308 (37.99%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTE--FKNKVDSGKD--ITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPF 1075
            G  + L+C V  +P    I W K               G+T  + + + I     P+  +L  L +    +G Y C  + +      +  +   ++ +P     E     +V   +D  +TL C A G P P + W +  G   ++     +L  + + ++ V   D+G+Y C A +  G  E  + + V   P +           + G +V LTC     P P+   + W    Q           + L    QET    R+    +   D   YSC A+N    GSS+ +F  +  P  +I+  F
Sbjct: 2108 GEEVTLDCRVNGIPTP-RISWLK--------------DGVTLVESNSHHI---LSPDGGKLTFLRLSAEDSGTYTCLAVSTV----GQDTKIYTVYVLPPSISDESTIPREVQVTQDSVVTLECRAAGHPPPQISWMK-NGRPLLLSPRTRLLSGDSLLIAHVQQSDSGVYTCVARSRAGLAELSYDVQVQVPPGVDHVEPVEPVTVVQGSLVTLTCEAHGVPPPT---LTWMKDGQPLSLH------RNLLLDGQET----RLQLPDVAPSDAGLYSCVASNQ--AGSSTKSFNLTVLPPKIISSSF 2377          

HSP 11 Score: 53.9138 bits (128), Expect = 4.140e-7
Identity = 65/265 (24.53%), Postives = 105/265 (39.62%), Query Frame = 2
Query:  128 FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI-TYTEFKNKVDSGKDITLSC-IANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTD 916
            F+    ++    G N+ L C    +PQ   + W    ++ +    +P       +  S  +  Q K+   + + I   +E   G+Y CE       +  KAE T+ +  +P +  +T        G+ +++ C + NGIP P   W R G     +++ G  LY     + +   QDAG Y C AEN  GS     +L V   P I   P    A +  G  + L+C     P P+   + W+          G F I    S D
Sbjct:  748 FSEEPTDVTANVGENITLPCVARGLPQP-TVTW----HRQNGRQVLP-------WTDSHSRTTQ-KENGHLEIRIWVDDE---GLYICEAKNQFGTI--KAEATVTVTGLPPLLAHTTPVITTGIGQSLSIPCMLLNGIPLPERFWSRNGKPRRFLRSDGS-LY-----IEKAIPQDAGTYICTAENVAGSANITVSLEV-QPPEINAGPYHYIANE--GVAITLSCEATGVPKPT---VVWSKD--------GHFHIPHPTSAD 974          

HSP 12 Score: 53.5286 bits (127), Expect = 5.783e-7
Identity = 49/168 (29.17%), Postives = 72/168 (42.86%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQI-----TYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQ 862
            AGIY C    +++V  A  E  L + ++P I       T  K   + G ++ L C   G P+P+V W R G     +     +L S  + +  V   D+ LY C AEN  G+    + L V       I P       +LG  V L CV + +P P   +I W  + Q
Sbjct:  975 AGIYICTA--TSHVGYASREIQLSV-NMPTILGVSSHDTVIKMSAEVGTEVVLPCEVQGSPSPLVTWSRNGHPIPPV-TAFTILPSGSLRIIDVRLMDSKLYTCTAENPAGNVSVGYNLHVQKP---RIQPAPTILKVLLGQTVTLPCVAQGEPSP---EISWFHNGQ 1132          

HSP 13 Score: 53.1434 bits (126), Expect = 7.164e-7
Identity = 77/339 (22.71%), Postives = 121/339 (35.69%), Query Frame = 2
Query:  146 NMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI-------TYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQM------------------LGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDL------DGVTYSCSATNALGTGSSSVTFRSSQFPNPLITG 1069
             M V  G   VL C V   P  G I W K     D+   V      +S  L+  + GQ        L + + +   +G+Y+C     A +  A    +L +   PQI       T+   + KV     + LSC+A G P P V W + G   +   + G+  + N + +        G Y C   N  G ++R F +++   P+     N   A+ +                  LG  V L+C   A P P    + W    ++  +  G                 L ++P Q+  +      D   Y+C A N    G   + F     P P+I G
Sbjct: 1441 EMSVVLGFPTVLPCEVEGSPTPG-ITWLK-----DNQPIV------SSPQLTYSRNGQA-------LRLGSAQGDSSGLYSCRATNPAGI--AVKHYSLSVLP-PQIEGDSSTFTFAGQEEKVRINGSLALSCVAKGFPEPKVRWFKDGQLLSGKHHAGIQHHGNFLHIEPAMLSHEGQYTCVVTNSAGEDKRDFHVTI-QPPIFQRVTNREAAWGLGHEGDDHEEEMTEKKEVVLGHSVSLSCENNAIPPPK---LSWYKDGRKLTSADG-----------------LVLHPGQVLQIPRVRKEDTGKYTCKAVNE--AGEDHMHFELEVLP-PVIMG 1733          

HSP 14 Score: 50.8322 bits (120), Expect = 3.493e-6
Identity = 48/168 (28.57%), Postives = 67/168 (39.88%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV----PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSS 835
            LEI  +     G Y+C       VV   A  + + F +    P I  +     V   +D  LSC   G  +P V+WR+  G      N    +    + + QV   DAG Y C A N+ GS+ +   L V  AP  +I+P   N     G    L+C     P P  S
Sbjct: 2517 LEIQEMRPEDGGQYSC-------VVTNMAGSSSLFFTIDIVPPVIKESSSVVTVRVNQDAVLSCEVEGDSSPSVMWRK-DGFPLPKHNRYTAMSEGSLHIHQVQLSDAGRYYCTASNQAGSDHQAMDLRV-FAP--SISPGPFNVTVTAGVRALLSCETTGIPSPKVS 2673          

HSP 15 Score: 50.447 bits (119), Expect = 4.795e-6
Identity = 60/233 (25.75%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRI--GGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCI-LRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            AG Y C    + N     ++   + + VP+IT  +       G D TL C A GIP P+V W +    G++  ++     ++   + +  V   DAG Y+C A +  G+     +L V  +P+ +  P    A   +G  + L CV +  P P+   + W     + +     +T     +T +E   + +RI+   +DD +G+ Y C A N  GT  +  T   +  P PL+
Sbjct:  632 AGNYTC---TATNDAGTASQSVALTYAVPKITVPQQVILSSVGADATLECKATGIPPPLVRWYKALEVGSAPFVEQD---VHRGTLHIRAVQEVDAGQYSCVASSSAGTSSGTVSLVVG-SPLFSEEPTDVTAN--VGENITLPCVARGLPQPT---VTWHRQNGRQVLP---WTDSHSRTTQKENGHLEIRIW---VDD-EGL-YICEAKNQFGTIKAEATVTVTGLP-PLL 843          

HSP 16 Score: 49.6766 bits (117), Expect = 7.482e-6
Identity = 54/225 (24.00%), Postives = 79/225 (35.11%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ-DAGLYACYAENEWGSEERKFALSVSHAPVITITPNG---NNAYQMLGCMVQLTCVVKADPVP 826
            G  + LEC     PQ    + K      DST     + G                     L I + + + AG Y C    +A  V  +A   +     P I   + +  V  G    L C A G P P V W + G     +      L S ++ + +     DAG++ C A N  GS  +   LS++  PV    P     N    +L     L+C  +  P P
Sbjct: 2920 GQPVSLECVADGQPQPEVTWHKDRRPVADSTHTHVFSNGT--------------------LAITSTQRSDAGFYTC----TARNVAGRASHDMR---PPMIPPVQTELSVIQGFQALLPCAAQGSPEPRVSWEKDGAIVPNVPGKFTFLRSGELIIERAEQPGDAGVFTCVATNPAGSARQDIRLSINMRPVFKELPGDVTLNKGQSLL-----LSCHAQGTPPP 3112          

HSP 17 Score: 49.2914 bits (116), Expect = 9.589e-6
Identity = 57/223 (25.56%), Postives = 85/223 (38.12%), Query Frame = 2
Query:  374 AGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQ--VTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFR 1036
            AG++ C     A   +A+ +  L I   P          ++ G+ + LSC A G P P++ W       N I   GVV  + +  V +  VT   AG + C AEN  G+  R  +      PV+    + +    + G    L C V  DP P    I W  +        GR     + S    +  I  I  A     D   Y C A +  GT   ++T +
Sbjct: 3057 AGVFTCVATNPAG--SARQDIRLSINMRPVFKELPGDVTLNKGQSLLLSCHAQGTPPPVISW-----TVNNIPYEGVVDEAGRSSVIIDNVTLSHAGTFVCVAENSVGA-IRALSFVRVRPPVLKGEAHTSQTV-IQGGSANLDCPVHGDPSPV---IHWLRNGNPV----GRLL--RMQSLHNGSLVIYSITTA-----DEGEYQCVAKSEAGTAERTITLK 3256          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: ncam1b (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101167636])

HSP 1 Score: 75.8702 bits (185), Expect = 4.397e-14
Identity = 77/294 (26.19%), Postives = 125/294 (42.52%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV-------PQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG-----GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            G+   L C V + P    + WK   YKG     + + K +      R+KI    Q N+  L+I  +++T  G+Y CE       + A+ E  L +  V        +I  +E     D G+   ++C  +G P P+V W R G +    +        +++T+  VT  D G Y C A+N+ G ++++ +L V   P IT   N  ++   +   V LTC    DP P+   I W SS     T G     G   +++ A     T   ++         D   Y C+A +A+G
Sbjct:  130 GDVANLVCDVVSSPSP-TVLWK---YKG---TKIQMEKDV------RFKI----QSNN-HLQIHGIKKTDEGLYTCEAR-----LMARGEIDLRVIKVIVNVRPTVRILQSELNATADVGQPAKMTCAVDGFPEPMVTWTRNGVDLEPGEKYSFNEDGSEITIMDVTKLDEGEYTCIAKNKAGKDDKELSLRVFVKPKITYIMNQTSSE--MEEQVTLTCEASGDPTPT---ISW-SSGDHVFTEGEQSPDGNVVVRSDARVSSLTLKYVKY-------TDAGQYLCTARSAIG 387          

HSP 2 Score: 67.0106 bits (162), Expect = 2.777e-11
Identity = 65/245 (26.53%), Postives = 103/245 (42.04%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWR---RIGGNSNIIKNTGVVLYSN----QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
             + I+ V +   G Y C     A       E +L +F  P+ITY   +   +  + +TL+C A+G P P + W     +        +  VV+ S+     +TL  V Y DAG Y C A +  G ++++  L V + P I+ T      Y      V +TC VKA   PS     W     Q +       IK   +    T   L++ P    D    +Y+C+A+N +GT S       ++ P+
Sbjct:  266 EITIMDVTKLDEGEYTCIAKNKAG--KDDKELSLRVFVKPKITYIMNQTSSEMEEQVTLTCEASGDPTPTISWSSGDHVFTEGEQSPDGNVVVRSDARVSSLTLKYVKYTDAGQYLCTARSAIGEDDQRAYLEVRYTPKISGTV---AVYTWERNPVNITCEVKA--FPSDVSTVWLRDGLQ-LPNSNTSNIKIFRTP---TSSYLQVTPEYESDFG--SYNCTASNEMGTESKEFLLIQAEVPS 497          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: ncam1b (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101167636])

HSP 1 Score: 75.485 bits (184), Expect = 6.077e-14
Identity = 78/306 (25.49%), Postives = 123/306 (40.20%), Query Frame = 2
Query:  128 FANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDV-----P--QITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTG-----GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            F N         G+   L C V + P    + WK   YKG     + + K +      R+KI          L+I  +++T  G+Y CE       + A+ E  L +  V     P  +I  +E     D G+   ++C  +G P P+V W R G +    +        +++T+  VT  D G Y C A+N+ G ++++ +L V   P IT     N     +   V LTC    DP P+   I W SS     T G     G   +++ A     T   ++         D   Y C+A +A+G
Sbjct:  141 FTNAPSPQEFTVGDVANLVCDVVSSPSP-TVLWK---YKG---TKIQMEKDV------RFKIQSNNH-----LQIHGIKKTDEGLYTCEAR-----LMARGEIDLRVIKVIVNVRPTVRILQSELNATADVGQPAKMTCAVDGFPEPMVTWTRNGVDLEPGEKYSFNEDGSEITIMDVTKLDEGEYTCIAKNKAGKDDKELSLRVFVKPKITYI--MNQTSSEMEEQVTLTCEASGDPTPT---ISW-SSGDHVFTEGEQSPDGNVVVRSDARVSSLTLKYVKY-------TDAGQYLCTARSAIG 410          

HSP 2 Score: 65.855 bits (159), Expect = 7.058e-11
Identity = 65/245 (26.53%), Postives = 103/245 (42.04%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWR---RIGGNSNIIKNTGVVLYSN----QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPN 1054
             + I+ V +   G Y C     A       E +L +F  P+ITY   +   +  + +TL+C A+G P P + W     +        +  VV+ S+     +TL  V Y DAG Y C A +  G ++++  L V + P I+ T      Y      V +TC VKA   PS     W     Q +       IK   +    T   L++ P    D    +Y+C+A+N +GT S       ++ P+
Sbjct:  289 EITIMDVTKLDEGEYTCIAKNKAG--KDDKELSLRVFVKPKITYIMNQTSSEMEEQVTLTCEASGDPTPTISWSSGDHVFTEGEQSPDGNVVVRSDARVSSLTLKYVKYTDAGQYLCTARSAIGEDDQRAYLEVRYTPKISGT---VAVYTWERNPVNITCEVKA--FPSDVSTVWLRDGLQ-LPNSNTSNIKIFRTP---TSSYLQVTPEYESDFG--SYNCTASNEMGTESKEFLLIQAEVPS 520          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 73.9442 bits (180), Expect = 1.544e-13
Identity = 72/271 (26.57%), Postives = 115/271 (42.44%), Query Frame = 2
Query:  272 NKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAE----RTLMIFDVP---QITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSN------IIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW-ASSKQQTITTG-----GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            ++ +T    SR+++     PN+  L+I  V +   G+Y CE       V A+ E       ++ +VP    +    F    D  + +T +CI +G P P V W R G            K  G     + +T+  +   D G YAC A N+ GS+ER+  L V   P IT      N   + G    ++CV + +P+P   DI W  +S  Q+   G     GRF ++      +    +L I   +L DL    + C A + +G    S+
Sbjct:  151 DREITDQYHSRFQV----LPNN-NLQIHQVTKADEGVYRCEAS-----VEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGSPEPAVTWHRKGQQLEPSEQYTFDKKEG---GRSTLTIRNIRQTDGGAYACKATNKAGSQERELFLKVFVQPHIT---QLKNVTAVEGSAAMISCVAEGEPLP---DISWRRASDGQSFMDGVKNRDGRFEVR-----GRHGKSVLTISGVRLTDLG--RFDCEAQSRIGGHQKSM 395          

HSP 2 Score: 49.2914 bits (116), Expect = 8.037e-6
Identity = 64/250 (25.60%), Postives = 99/250 (39.60%), Query Frame = 2
Query:  326 QPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN-SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEER--KFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            +P+  +L I       AGIY C+    A+ + A+A   L I+        E   +   G    + C     P P+V+W R     ++   +   VL +N + + QVT  D G+Y C A  E   E      A+ V+  PV+++     NA       V  TC+    P P+   + W    QQ +    ++T        + T  I  I        DG  Y+C ATN  G+    +  +   F  P IT
Sbjct:   71 EPSRSKLVIYNAIIEDAGIYRCQAT-EASGLTAEASVVLEIYQRLTFRDVESPQEFRHGDTAEVVCDVISSPVPVVVWYRQDREITDQYHSRFQVLPNNNLQIHQVTKADEGVYRCEASVEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGSPEPA---VTWHRKGQQ-LEPSEQYTFDK-KEGGRSTLTIRNIR-----QTDGGAYACKATNKAGSQERELFLKV--FVQPHIT 307          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 73.9442 bits (180), Expect = 1.576e-13
Identity = 72/271 (26.57%), Postives = 115/271 (42.44%), Query Frame = 2
Query:  272 NKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAE----RTLMIFDVP---QITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSN------IIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW-ASSKQQTITTG-----GRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSV 1027
            ++ +T    SR+++     PN+  L+I  V +   G+Y CE       V A+ E       ++ +VP    +    F    D  + +T +CI +G P P V W R G            K  G     + +T+  +   D G YAC A N+ GS+ER+  L V   P IT      N   + G    ++CV + +P+P   DI W  +S  Q+   G     GRF ++      +    +L I   +L DL    + C A + +G    S+
Sbjct:   86 DREITDQYHSRFQV----LPNN-NLQIHQVTKADEGVYRCEAS-----VEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGSPEPAVTWHRKGQQLEPSEQYTFDKKEG---GRSTLTIRNIRQTDGGAYACKATNKAGSQERELFLKVFVQPHIT---QLKNVTAVEGSAAMISCVAEGEPLP---DISWRRASDGQSFMDGVKNRDGRFEVR-----GRHGKSVLTISGVRLTDLG--RFDCEAQSRIGGHQKSM 330          

HSP 2 Score: 49.2914 bits (116), Expect = 7.560e-6
Identity = 64/250 (25.60%), Postives = 99/250 (39.60%), Query Frame = 2
Query:  326 QPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGN-SNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEER--KFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT 1066
            +P+  +L I       AGIY C+    A+ + A+A   L I+        E   +   G    + C     P P+V+W R     ++   +   VL +N + + QVT  D G+Y C A  E   E      A+ V+  PV+++     NA       V  TC+    P P+   + W    QQ +    ++T        + T  I  I        DG  Y+C ATN  G+    +  +   F  P IT
Sbjct:    6 EPSRSKLVIYNAIIEDAGIYRCQAT-EASGLTAEASVVLEIYQRLTFRDVESPQEFRHGDTAEVVCDVISSPVPVVVWYRQDREITDQYHSRFQVLPNNNLQIHQVTKADEGVYRCEASVEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGSPEPA---VTWHRKGQQ-LEPSEQYTFDK-KEGGRSTLTIRNIR-----QTDGGAYACKATNKAGSQERELFLKV--FVQPHIT 242          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000077686.1 (SMESG000077686.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/356 (99.44%), Postives = 355/356 (99.72%), Query Frame = 2
Query:   17 MITCFSVLILLIGYSHEQITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRCG 1084
            MITCF VLILLIGYSHEQITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMP+QGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRCG
Sbjct:    1 MITCFCVLILLIGYSHEQITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPEQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLITGPFRCG 356          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 71.633 bits (174), Expect = 9.401e-13
Identity = 89/317 (28.08%), Postives = 133/317 (41.96%), Query Frame = 2
Query:   89 ISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQP-NSIRLEILTVEETYAGIYACEVMYSANVV-NAKAERTLMIFDVPQITYTEFKNKVDSGKDITLSCIANGIPAPIVLW----RRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITI-TPNGNNAYQ--MLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITT--GGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATN 1000
            I+I V PK    +     I +Y K G  + L C +   P       KK+ +K             +  DL R   G    P +   L I  +     GIY C+     NV  +AK    ++I + P+I     K+ V     ITL+CIA+G P P + W    + I  N+   K  G     NQ TL   +      G Y+C AENE G +++   ++V  AP I + TPN N  Y   ++G  +  +CV+ + P    ++IKW  ++     +    RF I    S D  T  +      ++  LD   Y C A N
Sbjct: 1188 ITILVAPKASDSKM----IKIYTKEGEKLTLNCKIDGFPTPT----KKWSWKS------------SILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCD---GTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVG----ENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTV-FAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTP---PAEIKWFKNEIDIYKSLPKDRFKI----SLDGSTLTLF-----EVKHLDSGIYKCLAIN 1464          

HSP 2 Score: 68.9366 bits (167), Expect = 5.542e-12
Identity = 64/231 (27.71%), Postives = 101/231 (43.72%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFK--NKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSN---QVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQM---LGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
            +L +L  +E+  GIY C  + S  +   K   T+ I   P I +      ++V  G ++ L C++ G P P + WR+ G   +  +    VL S+    +T++     DAG Y C AEN  G  +  F + V++ P  T+ P G   Y++   +G  V L C+V   P P+   I W       I     +  + + ++ Q     L I   Q  D     YSC A N  G
Sbjct: 1718 QLHLLNAQESDIGIYKC--LVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR----VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP--TLDPGGKRYYKVERTVGGTVVLECLVSGIPTPA---ITWLKDG-IPINRLPSYRYRIIGNSKQ-----LEIIAMQASDAG--RYSCVAKNTFG 1929          

HSP 3 Score: 58.5362 bits (140), Expect = 1.175e-8
Identity = 59/237 (24.89%), Postives = 100/237 (42.19%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTE---------FKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQ--DAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQ---TITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALG 1009
             L + +  ET AG Y C       +      +T + FDV Q+TY           +K +   G  + L C+ +GIP P + W + G   N + +    +  N   L  +  Q  DAG Y+C A+N +G  E    +++   P I      N     +G  ++L C     P P+ +  K  +S      +      +  + L S +++   +L +Y A+    D   Y C+A+NA+G
Sbjct: 1810 HLTVNSTMETDAGRYQC-------IAENTHGQTDISFDV-QVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQ---MLTLYSAK--RTDSGLYQCNASNAIG 2033          

HSP 4 Score: 56.9954 bits (136), Expect = 2.920e-8
Identity = 60/247 (24.29%), Postives = 97/247 (39.27%), Query Frame = 2
Query:  341 RLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVD-SGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT-ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW----ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            +++I  V+   +G   C+   SA +   + +  L    +P+I   +   ++   G   T+ C ANG+P P + W   G    I  N  +      + ++++     G + C A N  GS  + F L +   P I     N + +Y   G  + + C V+  P P    +KW    A      I  G R+ I      +Q+   I++     L   D   Y C A N  G    SV  R S    P I
Sbjct:  689 QIKISNVKPQDSGELICKAKNSAGIDEVRIK--LSYISLPKILSLDLAKEIPLEGDQQTVRCSANGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNNAGSSRKSFNLDIGFGPRIKDFVTNIDGSY---GENITIRCQVEGHPPPR---VKWLRGIAGGYNIPIALGDRYFI------NQDNSLIIK----GLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKI 917          

HSP 5 Score: 56.225 bits (134), Expect = 5.653e-8
Identity = 72/320 (22.50%), Postives = 128/320 (40.00%), Query Frame = 2
Query:   83 VSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKA-ERTLMIFDVPQITYTEFKNKVD--SGKDITLSCIANGI--PAPIVLWRRIG-----GNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGT 1012
            + ++I  PP     +  N  I   +K G+ + L C     P     F+K     G+S     ++    +    R  + Q +Q     L + + + T +G+Y C    ++N +     E ++ +   P+   +  + KV+  + +  +L C   G+  P   + W R G     G S  I   G      ++T+  V   DAG Y C+A+NE       F + V   P             +    VQ++C     P P+   + W   +Q+ +    R+    +   +     +++I   Q DD D  TY+C+ATN  GT
Sbjct: 1935 MDVTIGAPPSIDRNRILNEYI---IKVGDELRLPCPANGSPNPNIAFFKD----GNSLDMFDLSPNKDASYKKRLLVSQERQ----MLTLYSAKRTDSGLYQCN---ASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT-----RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPT---LLWYRQEQEILADKERYPKFDILRGNS----VMQITNIQPDDAD--TYACTATNGGGT 2226          

HSP 6 Score: 53.1434 bits (126), Expect = 4.425e-7
Identity = 78/301 (25.91%), Postives = 118/301 (39.20%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKI-GQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNK--VDSGKDITLSCIANGIPAPIVLWRRIGGNSNII-----------KNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVI---TITPNGN---NAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNAL 1006
            G  +VLEC V  +P    I W K          +PIN+ L SY   RY+I G  KQ     LEI+ ++ + AG Y+C    +   +    + T  I   P I      N+  +  G ++ L C ANG P P + + + G + ++            K   V      +TL      D+GLY C A N  G +  ++++ V   P      + P  N   N  + L C    T +  ADP    + I W       +++GG   I    +         RI    +   D   Y C A N +
Sbjct: 1864 GGTVVLECLVSGIPTPA-ITWLK--------DGIPINR-LPSY---RYRIIGNSKQ-----LEIIAMQASDAGRYSCVAKNTFGQMEIFMDVT--IGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLEC----TLMGVADP---PAKITW-ERHGVPLSSGGSIRISPDGT---------RITVENVKQYDAGEYKCHAQNEV 2127          

HSP 7 Score: 52.7582 bits (125), Expect = 5.772e-7
Identity = 66/282 (23.40%), Postives = 113/282 (40.07%), Query Frame = 2
Query:  164 GNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKV--DSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKW-ASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATN 1000
            G N+ + C V   P    + W +    G     +PI  G       RY I Q    NS+ ++ L++E+  A  Y C+       V    +  +     P+I +T+ K  V   + K + +  +    P  ++ W + G    I  +  ++   N + +  V  +D  +Y C A+N+ G+ +    L V   P+I I           G ++ L C  K DP P    I+W    +  T+  G R  I    S        L +Y   + +    T++C+ATN
Sbjct:  832 GENITIRCQVEGHPPP-RVKWLRGIAGG---YNIPIALG------DRYFINQD---NSLIIKGLSMEDQSA--YICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNG--KEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPII-IGDFKTFIDAKDGDVIVLQCQTKGDPKPK---IEWRKGGRPLTMEPGLRIVISPDGSQ-------LTVY--SITEEHAGTFTCTATN 1083          

HSP 8 Score: 52.7582 bits (125), Expect = 5.871e-7
Identity = 52/227 (22.91%), Postives = 98/227 (43.17%), Query Frame = 2
Query:   80 DVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQ-GNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIGQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKVDSGKDIT--LSCIANGIPAPIVLWRR----IGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVI 739
            + S+ +  PP EF        +N +  +  +  LECT+  +      I W+++         VP++ G  S  +S         P+  R+ +  V++  AG Y C      + ++      + +F  P+    +   K+++ ++ T  +SC   G P P +LW R    I  +        ++  ++ + ++ +   DA  YAC A N  G+ E+KF +SV   P I
Sbjct: 2038 EYSVRVRTPP-EFDTSNVEPKVNWFTNQTRS--LECTLMGVADPPAKITWERH--------GVPLSSG-GSIRIS---------PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVF--NVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI 2241          

HSP 9 Score: 51.6026 bits (122), Expect = 1.359e-6
Identity = 57/229 (24.89%), Postives = 91/229 (39.74%), Query Frame = 2
Query:  344 LEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQITYTEFKNKV---DSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTL--SQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTG 1015
            L +  V+   +GIY C  +     +N     TL++   P I        V   +   D+ ++C + G PAP  LW +   NS +I    V + +   TL   +V   D  +Y C+  NE G +++ F ++V   P I           + G    L C V   P P    I+W  +  +TI +        L++  Q  F         +D      Y+C ATN  G+ 
Sbjct: 1445 LTLFEVKHLDSGIYKCLAINIGESLNF----TLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYK--DNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQ---IRW--TYMETINSP-----LLLSNNSQLHF-------MNVDKSHITRYTCIATNEAGSA 1650          

HSP 10 Score: 50.0618 bits (118), Expect = 4.136e-6
Identity = 68/282 (24.11%), Postives = 115/282 (40.78%), Query Frame = 2
Query:   68 QITPDVSISIEVPPKEFLKQFANGTINMYVKRGNNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKI--GQGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI---TYTEFKNKVDSGKDITLSC-IANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVIT--ITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRF 889
            Q +  V + I  PPK       +   ++ V+ G  ++L C V     +G   ++ + Y        P N  ++S  L  Y+    QG       L I  V + ++G+Y C     A     +   TL +   P+I   T TE    +++   + + C I  GIP P++ W R G   + +KN      S     + +  +D G   C A+N  G +   F ++V   P ++  I+  G+      G  V + C V+  P P+ +  K   S Q  +    RF
Sbjct: 2510 QDSKSVDVVIISPPK-----IESPKKSIMVRVGEQVLLPCIV-----EGTRPFRIHWY-------TPGNNQISSTILGEYQFLSEQG-------LIIDRVRKDHSGVYRCVANNDAGYQEIRI--TLEVLVQPKIFRPTETETTGVLNTV--LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDE-----GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF 2758          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.658e-11
Identity = 48/192 (25.00%), Postives = 83/192 (43.23%), Query Frame = 2
Query:  500 GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTIT-TGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVT-FRSSQFPNPLITG 1069
            G+++ + C A+G P P++ W+RI  N  I +  G +L  N +        D G Y C A  +   E  K+       P     P+   +Y   G   +L+C +K+ P P+ ++IKW    +Q +  T  +   +           IL + P    D     Y+CS +   G+  +++   R S+ P  +I G
Sbjct:  364 GENMQMECRADGNPEPLITWQRISSNEVIAR--GSILLRNDIQAD-----DFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSV--SYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGD-----YNCSVSTKYGSDMATIILLRKSETPMLMIVG 541          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.806e-11
Identity = 48/192 (25.00%), Postives = 83/192 (43.23%), Query Frame = 2
Query:  500 GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTIT-TGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVT-FRSSQFPNPLITG 1069
            G+++ + C A+G P P++ W+RI  N  I +  G +L  N +        D G Y C A  +   E  K+       P     P+   +Y   G   +L+C +K+ P P+ ++IKW    +Q +  T  +   +           IL + P    D     Y+CS +   G+  +++   R S+ P  +I G
Sbjct:  367 GENMQMECRADGNPEPLITWQRISSNEVIAR--GSILLRNDIQAD-----DFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSV--SYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGD-----YNCSVSTKYGSDMATIILLRKSETPMLMIVG 544          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000071657.1 (SMESG000071657.1)

HSP 1 Score: 63.929 bits (154), Expect = 1.658e-10
Identity = 56/189 (29.63%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  500 GKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYSNQVTLSQVTYQDAGLYACYAENE-WGSEERKFALSVSHAPVITITPNGNNAYQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTDQETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLI 1063
            G D+TL+C  +  P   + W+R   N++II + G +LY        +   D G Y C A  E +  + +K  L+    P+I   P+   +   LG  VQ  CV+ + P+ + + I W    ++ I    +++I T    D  +  IL I   Q  D     Y+CS T  LG+ +S V   S   P PLI
Sbjct:  365 GDDVTLTCNTDSNPMANIYWQR-ESNNDIIGH-GTILYR-----KNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRAS---LGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDH-SISILSINNIQASDFG--QYNCSVTTDLGS-ASKVMVLSKTSPIPLI 539          
The following BLAST results are available for this feature:
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN11.452e-1425.55hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
HMCN21.640e-1425.82hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
PXDN3.287e-1427.85peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
PXDN6.394e-1427.85peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
KIRREL38.411e-1428.31kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
him-43.873e-1625.81High Incidence of Males (Increased X chromosome lo... [more]
him-43.908e-1625.81High Incidence of Males (Increased X chromosome lo... [more]
him-44.045e-1625.81High Incidence of Males (Increased X chromosome lo... [more]
pxn-13.970e-925.00Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
unc-899.986e-925.13Muscle M-line assembly protein unc-89 [Source:Uni... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lac1.672e-1827.92gene:FBgn0010238 transcript:FBtr0087933[more]
DIP-alpha1.788e-1727.16gene:FBgn0052791 transcript:FBtr0070588[more]
DIP-alpha1.788e-1727.16gene:FBgn0052791 transcript:FBtr0333795[more]
Ama3.467e-1525.08gene:FBgn0000071 transcript:FBtr0081620[more]
Ama3.467e-1525.08gene:FBgn0000071 transcript:FBtr0081619[more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn29.787e-1625.99hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
pxdn2.609e-1527.85peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn2.657e-1527.85peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn2.889e-1527.85peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn3.168e-1527.85peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps71.766e-1428.89ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps72.010e-1429.52ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps72.161e-1429.52ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps72.240e-1428.20ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps72.335e-1429.52ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cntn16.793e-1425.08contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
Cntn16.793e-1425.08contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
Cntn16.793e-1425.08contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
Hmcn19.985e-1426.65hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn11.008e-1326.65hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26474|LACH_SCHAM9.654e-2029.37Lachesin OS=Schistocerca americana OX=7009 GN=LAC ... [more]
sp|Q24372|LACH_DROME1.676e-1727.92Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac... [more]
sp|Q92154|SMP_COTJA1.232e-1429.31Schwann cell myelin protein OS=Coturnix japonica O... [more]
sp|P15364|AMAL_DROME3.476e-1425.08Protein amalgam OS=Drosophila melanogaster OX=7227... [more]
sp|Q96RW7|HMCN1_HUMAN6.971e-1425.55Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QLU67.003e-6836.29Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A3Q0KLA33.237e-6637.54Putative neurotrimin (HNT) OS=Schistosoma mansoni ... [more]
A0A095BUC03.999e-6538.31Neural cell adhesion molecule 1 OS=Schistosoma hae... [more]
A0A4Z2DHV01.390e-6435.83Neural cell adhesion molecule 1 isoform 1 OS=Schis... [more]
A0A5K4ELZ81.560e-6437.54Putative neurotrimin (HNT) OS=Schistosoma mansoni ... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam1a2.371e-1528.87neural cell adhesion molecule 1a [Source:ZFIN;Acc:... [more]
ncam1b1.983e-1425.88neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
ncam1b8.219e-1424.84neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
KIRREL32.874e-1324.34kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.096e-1324.34kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn3.802e-1223.59peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
ncam1b7.984e-1224.05neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
ENSPMAT00000010567.11.206e-1026.56pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1... [more]
ENSPMAT00000004759.12.179e-1023.53pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 g... [more]
ENSPMAT00000004605.12.842e-1022.86pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320021.150e-1233.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279111.374e-1228.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319421.776e-1124.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274776.445e-1130.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306017.984e-1124.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn23.463e-1426.00hemicentin-1 [Source:NCBI gene;Acc:101165068][more]
ncam1b4.397e-1426.19neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ncam1b6.077e-1425.49neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
zgc:1529041.544e-1326.57neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
zgc:1529041.576e-1326.57neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077686.10.000e+099.44SMESG000077686.1[more]
SMESG000021248.19.401e-1328.08SMESG000021248.1[more]
SMESG000022777.17.658e-1125.00SMESG000022777.1[more]
SMESG000022777.17.806e-1125.00SMESG000022777.1[more]
SMESG000071657.11.658e-1029.63SMESG000071657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011708 ID=SMED30011708|Name=Neural cell adhesion molecule 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1483bp
GATCTTTCAAATTTAAATGATTACCTGTTTCAGTGTCCTTATTTTATTAA
TCGGGTATTCACATGAACAAATTACTCCAGATGTGTCTATATCTATTGAA
GTACCTCCGAAAGAATTTCTTAAACAATTTGCCAACGGCACAATTAATAT
GTACGTGAAAAGAGGAAATAATATGGTTTTGGAATGCACAGTTTTTAATA
TGCCGCAACAGGGAAATATATTTTGGAAAAAATATCCTTACAAAGGTGAC
TCAACTGCAGCTGTTCCTATCAATAAAGGTTTAACTTCATATGATCTATC
AAGGTACAAAATTGGACAAGGTAAACAACCGAATTCAATTAGATTGGAAA
TATTAACCGTCGAGGAAACGTATGCTGGAATTTATGCTTGTGAAGTTATG
TATTCAGCCAATGTTGTCAACGCAAAAGCAGAAAGAACTCTTATGATCTT
TGATGTGCCTCAAATCACTTACACAGAGTTCAAAAATAAAGTCGACTCTG
GCAAAGACATAACGCTGTCGTGTATTGCCAATGGTATTCCAGCTCCTATT
GTTTTGTGGAGAAGAATCGGTGGCAATTCAAATATTATAAAAAATACCGG
CGTTGTTCTTTATAGTAATCAAGTTACTTTGTCCCAAGTTACATACCAAG
ATGCTGGATTATATGCGTGTTATGCGGAAAATGAATGGGGTTCAGAAGAA
AGAAAGTTTGCATTGTCAGTTTCACATGCTCCAGTAATAACCATAACTCC
AAATGGGAATAATGCGTATCAAATGCTGGGCTGTATGGTTCAATTAACGT
GTGTTGTGAAAGCCGATCCAGTTCCTTCTTCAAGTGATATTAAATGGGCT
TCGTCTAAGCAACAAACAATAACAACTGGCGGAAGATTCACTATCAAAAC
ATTAGCATCAACTGACCAGGAAACCTTTTGCATTCTAAGAATTTATCCAG
CTCAATTAGATGATCTTGATGGTGTTACATATTCATGTTCAGCAACTAAT
GCTTTGGGAACTGGCAGTAGTTCTGTGACTTTTAGAAGTTCTCAATTTCC
AAATCCGTTGATCACAGGACCTTTCAGATGTGGAGCGTTAATGTCATATT
TATCTTCATATGCTTTATTAATAAGCCTCATGTTTGTCTTATGTAATTTG
AAATTGCAGTTATTGTAATTATTTGTTCTTTTAAAAGTACCATATCATTT
TTATAATTTTATCATTTCTAATTTGTATAAAATTTCAAGAAAAATATTCT
GTATTTATCCGATTGTAATTCTTCCGAGATTTGTAATTCTTTCTGAATTT
GATAATTCAAAATTTTAGCTGAAAAGTTCTGATTTTTCTGCTAGGTCTAT
TATTCGACATTGTTATTGCGTATTTTGTCTATTTAATTGGGACTTGTTGG
AAAATTTTGGACTTTTAATATTTAAATTAAATATTTTGTTCTTATATACT
TTGTTATACAATAAACCTCAGCTTATGAAAAAA
back to top

protein sequence of SMED30011708-orf-1

>SMED30011708-orf-1 ID=SMED30011708-orf-1|Name=SMED30011708-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=384bp
MITCFSVLILLIGYSHEQITPDVSISIEVPPKEFLKQFANGTINMYVKRG
NNMVLECTVFNMPQQGNIFWKKYPYKGDSTAAVPINKGLTSYDLSRYKIG
QGKQPNSIRLEILTVEETYAGIYACEVMYSANVVNAKAERTLMIFDVPQI
TYTEFKNKVDSGKDITLSCIANGIPAPIVLWRRIGGNSNIIKNTGVVLYS
NQVTLSQVTYQDAGLYACYAENEWGSEERKFALSVSHAPVITITPNGNNA
YQMLGCMVQLTCVVKADPVPSSSDIKWASSKQQTITTGGRFTIKTLASTD
QETFCILRIYPAQLDDLDGVTYSCSATNALGTGSSSVTFRSSQFPNPLIT
GPFRCGALMSYLSSYALLISLMFVLCNLKLQLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 154..236
e-value: 3.1E-6
score: 36.7
coord: 42..145
e-value: 1.1E-4
score: 31.6
coord: 247..342
e-value: 4.3
score: 14.6
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 253..331
e-value: 1.3
score: 5.9
coord: 48..132
e-value: 0.21
score: 13.6
coord: 160..225
e-value: 4.0E-11
score: 52.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 239..343
e-value: 3.9E-11
score: 44.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 148..238
e-value: 4.7E-15
score: 57.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 32..145
e-value: 1.6E-8
score: 36.5
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 11..194
e-value: 2.2E-6
score: 23.7
coord: 187..380
e-value: 2.6E-8
score: 30.1
NoneNo IPR availablePFAMPF13927Ig_3coord: 148..222
e-value: 2.5E-12
score: 47.2
coord: 239..328
e-value: 5.1E-7
score: 30.2
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 48..345
NoneNo IPR availablePANTHERPTHR12231:SF220LACHESINcoord: 48..345
NoneNo IPR availableCDDcd00096Igcoord: 165..231
e-value: 1.72433E-10
score: 54.5556
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.736
NoneNo IPR availableTMHMMTMhelixcoord: 356..378
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 21..143
score: 9.156
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 148..236
score: 13.657
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 239..338
score: 10.19
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 44..135
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 230..338
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 157..245