calcium/calmodulin-dependent protein kinase type IV

Overview
Namecalcium/calmodulin-dependent protein kinase type IV
Smed IDSMED30011699
Length (bp)1254
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of calcium/calmodulin-dependent protein kinase type IV (SMED30011699) t-SNE clustered cells

Violin plots show distribution of expression levels for calcium/calmodulin-dependent protein kinase type IV (SMED30011699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of calcium/calmodulin-dependent protein kinase type IV (SMED30011699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for calcium/calmodulin-dependent protein kinase type IV (SMED30011699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011699h1SMcG0015831 SmedASXL_019941SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011699h1SMcG0015831 dd_Smed_v4_10731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011699h1SMcG0015831 dd_Smed_v4_10731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011699h1SMcG0015831 dd_Smed_v4_10731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011699h1SMcG0015831 dd_Smed_v4_10731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011699h1SMcG0015831 dd_Smed_v6_10731_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011699h1SMcG0015831 dd_Smed_v4_10731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Match: CAMK4 (calcium/calmodulin dependent protein kinase IV [Source:HGNC Symbol;Acc:HGNC:1464])

HSP 1 Score: 366.311 bits (939), Expect = 6.453e-123
Identity = 168/307 (54.72%), Postives = 234/307 (76.22%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +    ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   31 DYWI-DGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 335          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Match: CAMK4 (calcium/calmodulin dependent protein kinase IV [Source:HGNC Symbol;Acc:HGNC:1464])

HSP 1 Score: 366.311 bits (939), Expect = 6.453e-123
Identity = 168/307 (54.72%), Postives = 234/307 (76.22%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +    ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   31 DYWI-DGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 335          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 280.796 bits (717), Expect = 3.866e-91
Identity = 141/306 (46.08%), Postives = 194/306 (63.40%), Query Frame = 1
Query:  136 EPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            E  +K +E    +G G+   V     K T   FA K I KK  K     I++E+ VL K+ H NI+ L ++YES   +++V++ VSGGELFDRIV +GFY+EKDAS  +R++L AV YLH   I+HRDLKPENLLY SQ EES + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD I  L+  DP+KR T  QA  H W+ G+ A   ++ E+ +     N ++ K + +   T  + HM +L
Sbjct:   17 EDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKL 322          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 280.411 bits (716), Expect = 1.282e-90
Identity = 141/306 (46.08%), Postives = 194/306 (63.40%), Query Frame = 1
Query:  136 EPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            E  +K +E    +G G+   V     K T   FA K I KK  K     I++E+ VL K+ H NI+ L ++YES   +++V++ VSGGELFDRIV +GFY+EKDAS  +R++L AV YLH   I+HRDLKPENLLY SQ EES + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD I  L+  DP+KR T  QA  H W+ G+ A   ++ E+ +     N ++ K + +   T  + HM +L
Sbjct:   17 EDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKL 322          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 276.559 bits (706), Expect = 2.457e-89
Identity = 135/308 (43.83%), Postives = 198/308 (64.29%), Query Frame = 1
Query:  130 KNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            + E     Y+  + +G G+   V     KRT    A K I+K+     +  +++E+ VL K+ HPNI+ L ++YES   ++++++ VSGGELFDRIV +GFY+E+DASR + ++L AV YLH+  I+HRDLKPENLLY S  E+S + ++DFG++K+ +      T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D ++F+ I+K  Y F SP+WD++S +AKD I  L+  DP KR T  QAL H W+ G+ A   ++ ++ ++  + N ++ K K +   T  + HM +L
Sbjct:   12 QAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKL 319          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 267.7 bits (683), Expect = 1.347e-86
Identity = 136/312 (43.59%), Postives = 198/312 (63.46%), Query Frame = 1
Query:  133 NEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIK-FAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIE--HMMRLCN 1047
            N    + Y+  + +G G+   V+    K    + +A K I KK  K   + +++E+ VL KL H NI++L++ Y+    V++V+E V+GGELFDRIV++G Y+E+DAS  +R++L+AV ++H+N ++HRDLKPENLLY +Q+E S + ++DFG++K  ED     T CGTPGY APE+L    YGK VD+WSIGVI YILLCGY PFY+E D  +F  IIKG Y F +P+WD +S +AKD I+ L+  DP  R T   AL+H W+ G  A T  +  T     + + ++R  K +     AI    M+RL +
Sbjct:   15 NATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKT-EDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQLQMLRLSS 325          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 252.292 bits (643), Expect = 1.702e-80
Identity = 133/324 (41.05%), Postives = 203/324 (62.65%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVTTAIEHMM-----RLCNRPEQNQETDI 1077
            F   Y++  ++G G+   V  CV K T ++FAAK+I +KK++ +    ++ E  +  KL HPNI+RL++  +  +  ++V + V+GGELF+ IV+R FYSE DAS C++++L++++Y H N I+HRDLKPENLL  S+ + + +KLADFG+A  + D        GTPGY +PE+L    Y KPVD+W+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AK +I  +L V+P KR+TA+QAL   W+       S++  ++T + LK+FN +RRKLK +I  T      +      L N+ EQ   + I
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFN-ARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTI 330          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 252.292 bits (643), Expect = 1.702e-80
Identity = 133/324 (41.05%), Postives = 203/324 (62.65%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVTTAIEHMM-----RLCNRPEQNQETDI 1077
            F   Y++  ++G G+   V  CV K T ++FAAK+I +KK++ +    ++ E  +  KL HPNI+RL++  +  +  ++V + V+GGELF+ IV+R FYSE DAS C++++L++++Y H N I+HRDLKPENLL  S+ + + +KLADFG+A  + D        GTPGY +PE+L    Y KPVD+W+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AK +I  +L V+P KR+TA+QAL   W+       S++  ++T + LK+FN +RRKLK +I  T      +      L N+ EQ   + I
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFN-ARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTI 330          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 252.292 bits (643), Expect = 1.702e-80
Identity = 133/324 (41.05%), Postives = 203/324 (62.65%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVTTAIEHMM-----RLCNRPEQNQETDI 1077
            F   Y++  ++G G+   V  CV K T ++FAAK+I +KK++ +    ++ E  +  KL HPNI+RL++  +  +  ++V + V+GGELF+ IV+R FYSE DAS C++++L++++Y H N I+HRDLKPENLL  S+ + + +KLADFG+A  + D        GTPGY +PE+L    Y KPVD+W+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AK +I  +L V+P KR+TA+QAL   W+       S++  ++T + LK+FN +RRKLK +I  T      +      L N+ EQ   + I
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFN-ARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTI 330          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 248.825 bits (634), Expect = 7.375e-80
Identity = 127/295 (43.05%), Postives = 194/295 (65.76%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASI 1005
            F   Y++  ++G G+   V  CV K T ++FAAK+I +KK++ +    ++ E  +  KL HPNI+RL++  +  +  ++V + V+GGELF+ IV+R FYSE DAS C++++L++++Y H N I+HRDLKPENLL  S+ + + +KLADFG+A  + D        GTPGY +PE+L    Y KPVD+W+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AK +I  +L V+P KR+TA+QAL   W+       S++  ++T + LK+FN +RRKLK +I
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFN-ARRKLKVAI 301          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 281.182 bits (718), Expect = 3.468e-91
Identity = 140/315 (44.44%), Postives = 203/315 (64.44%), Query Frame = 1
Query:  115 IKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIK-FAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLC 1044
            +K+  K    E+ Y +   +G G+   V     K +  + FA K+I KK  K   + +++E+ VL +LTHPNI++L E YE  + V++V+E V+GGELFDRIV +G Y+EKDAS  +R++L+AV Y+HE  ++HRDLKPENLLY S  ++S + ++DFG++K +ED     T CGTPGY APE+L    YGK VD+WSIGVI+YILLCGY PFY+E D  +F  I+KG + F SP+WD +S +AK  I  L+ V   KR T  QAL H W+ G  A + ++  T ++  + N ++ + K + +  T I  M R+ 
Sbjct:   18 LKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 271.166 bits (692), Expect = 3.934e-87
Identity = 140/330 (42.42%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  115 IKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIK-FAAKVISKKVNK---KLIKSEVGVL---------------LKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLC 1044
            +K+  K    E+ Y +   +G G+   V     K +  + FA K+I KK  K   + +++E+ VL                +LTHPNI++L E YE  + V++V+E V+GGELFDRIV +G Y+EKDAS  +R++L+AV Y+HE  ++HRDLKPENLLY S  ++S + ++DFG++K +ED     T CGTPGY APE+L    YGK VD+WSIGVI+YILLCGY PFY+E D  +F  I+KG + F SP+WD +S +AK  I  L+ V   KR T  QAL H W+ G  A + ++  T ++  + N ++ + K + +  T I  M R+ 
Sbjct:   18 LKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 346          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 271.166 bits (692), Expect = 3.934e-87
Identity = 140/330 (42.42%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  115 IKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIK-FAAKVISKKVNK---KLIKSEVGVL---------------LKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLC 1044
            +K+  K    E+ Y +   +G G+   V     K +  + FA K+I KK  K   + +++E+ VL                +LTHPNI++L E YE  + V++V+E V+GGELFDRIV +G Y+EKDAS  +R++L+AV Y+HE  ++HRDLKPENLLY S  ++S + ++DFG++K +ED     T CGTPGY APE+L    YGK VD+WSIGVI+YILLCGY PFY+E D  +F  I+KG + F SP+WD +S +AK  I  L+ V   KR T  QAL H W+ G  A + ++  T ++  + N ++ + K + +  T I  M R+ 
Sbjct:   18 LKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 346          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089069)

HSP 1 Score: 271.166 bits (692), Expect = 3.934e-87
Identity = 140/330 (42.42%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  115 IKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIK-FAAKVISKKVNK---KLIKSEVGVL---------------LKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLC 1044
            +K+  K    E+ Y +   +G G+   V     K +  + FA K+I KK  K   + +++E+ VL                +LTHPNI++L E YE  + V++V+E V+GGELFDRIV +G Y+EKDAS  +R++L+AV Y+HE  ++HRDLKPENLLY S  ++S + ++DFG++K +ED     T CGTPGY APE+L    YGK VD+WSIGVI+YILLCGY PFY+E D  +F  I+KG + F SP+WD +S +AK  I  L+ V   KR T  QAL H W+ G  A + ++  T ++  + N ++ + K + +  T I  M R+ 
Sbjct:   18 LKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 346          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333673)

HSP 1 Score: 252.677 bits (644), Expect = 5.961e-79
Identity = 129/299 (43.14%), Postives = 198/299 (66.22%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHT-MTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWV--KGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVT 1014
            F   Y+I  ++G G+   V  CV+K T  +FAAK+I +KK+  +    ++ E  +  KL HPNI+RL++  +     ++V + V+GGELF+ IV+R FYSE DAS C++++L++V++ H+N ++HRDLKPENLL  S+ + + +KLADFG+A  ++ D        GTPGY +PE+L    YGK VD+W+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AK++I+++L V+P+KR+TA +AL H W+  +   A     +ET + LK+FN +RRKLK +I  T
Sbjct:   10 FSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFN-ARRKLKGAILTT 307          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Match: si:ch73-60h1.1 (si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-152])

HSP 1 Score: 373.629 bits (958), Expect = 1.450e-126
Identity = 175/361 (48.48%), Postives = 259/361 (71.75%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQE-ESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMR-------LCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTEQIS 1161
            EYW+  S ++   E +Y +  ++G G+T  V  C  K+T+  +A KV+ K ++KK++++E+GVLL+L+HPNIIRL E++E+ T++ ++LE V+GGELFDRIV RG+YSE+DA+  ++++L+AV+YLHEN ++HRDLKPENLLY     ++ LK+ADFG++KI+++ V   TVCGTPGYCAPEIL G +YG  VD+WS+GVI YILLCG+EPF++++ +Q M+  I+   Y F SPWWD VSLNAKD+++KL+V+DPHKRLT  QAL H WV G+ A+ S ++ TQ KL+EFN +RRKLKA++    A   M          C  P  ++ +  S I   N++ +  E ++  M + +EQ++
Sbjct:   12 EYWVDGSRRDATVEDFYNMGPELGRGATSVVLRCEEKQTEKPYAVKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSIDAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDQRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVNKLIVLDPHKRLTVKQALEHPWVLGKAARFSHMDTTQRKLQEFN-ARRKLKAAMKAVVATSRMHEGSRRRTDSCEMPNTDKTSCQSSIQKENTTNSSREPIS--MKEGSEQVA 369          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:ZFIN;Acc:ZDB-GENE-050417-76])

HSP 1 Score: 370.163 bits (949), Expect = 3.109e-126
Identity = 175/334 (52.40%), Postives = 243/334 (72.75%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYE-SQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINS 1101
            EYWI D  K E    +YE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+  ++ +VLE V+GGELFDR+V +G+YSE+DA+  V+++L+AV+YLHEN ++HRDLKPENLLY  S  ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+GVITYILLCG+EPF++++ +Q MFK I+   Y F SPWWDNVSLNAKD++ KL+V DP KRLT  QAL H WV G+    + ++  Q KL EFN +RRKLKA++    A+    RL +           G CS +S
Sbjct:   14 EYWI-DGSKKETLADFYELESELGRGATSVVYRCRQKGTQKHYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYSERDAADAVKQVLEAVAYLHENGVVHRDLKPENLLYATSAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTQQALQHPWVTGKAVNFTHMDTAQKKLLEFN-ARRKLKAAV---KAVVASSRLGSAGSHGNPDGNKGDCSSSS 342          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:ZFIN;Acc:ZDB-GENE-050417-76])

HSP 1 Score: 370.163 bits (949), Expect = 3.109e-126
Identity = 175/334 (52.40%), Postives = 243/334 (72.75%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYE-SQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINS 1101
            EYWI D  K E    +YE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+  ++ +VLE V+GGELFDR+V +G+YSE+DA+  V+++L+AV+YLHEN ++HRDLKPENLLY  S  ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+GVITYILLCG+EPF++++ +Q MFK I+   Y F SPWWDNVSLNAKD++ KL+V DP KRLT  QAL H WV G+    + ++  Q KL EFN +RRKLKA++    A+    RL +           G CS +S
Sbjct:   14 EYWI-DGSKKETLADFYELESELGRGATSVVYRCRQKGTQKHYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYSERDAADAVKQVLEAVAYLHENGVVHRDLKPENLLYATSAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTQQALQHPWVTGKAVNFTHMDTAQKKLLEFN-ARRKLKAAV---KAVVASSRLGSAGSHGNPDGNKGDCSSSS 342          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Match: BX571983.2 (pep chromosome:GRCz11:CHR_ALT_CTG11_1_7:14705740:14752446:1 gene:ENSDARG00000115622.1 transcript:ENSDART00000188432.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571983.2)

HSP 1 Score: 289.271 bits (739), Expect = 7.525e-96
Identity = 132/244 (54.10%), Postives = 187/244 (76.64%), Query Frame = 1
Query:  142 FEKYYEILNKI-----GNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQE-ESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKL 852
            FE    IL +I       G+T  V  C  K+T+  +A KV+ K ++KK++++E+GVLL+L+HPNIIRL E++E+ T++ ++LE V+GGELFDRIV RG+YSE+DA+  ++++L+AV+YLHEN ++HRDLKPENLLY     ++ LK+ADFG++KI+++ V   TVCGTPGYCAPEIL G +YG  VD+WS+GVI YILLCG+EPF++++ +Q M+  I+   Y F SPWWD VSLNAKD++S L
Sbjct:   19 FETEITILTQIFFISTTRGATSVVLRCEEKQTEKPYAVKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSIDAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDQRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVSSL 262          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 283.493 bits (724), Expect = 4.589e-92
Identity = 147/343 (42.86%), Postives = 212/343 (61.81%), Query Frame = 1
Query:   97 EMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATF 1113
            E E  W K   K    ++ Y+    +G G+   V+    K+T    A K I KK     +  I++E+ VL ++ H NI+ L +++ES + +++V++ VSGGELFDRIV +GFY+E+DAS+ +R++L AV YLH+  I+HRDLKPENLLY S EE SN+ ++DFG++KI +      T CGTPGY APE+L    Y K VD WSIGVI+YILLCGY PFY+E D ++F+ I+K  Y F SP+WD++S +AKD IS L+  DP  R T  QAL H W+ G+ A   ++ E+ +   + N ++ K K +   T  + HM RL         T + G   I S++ +
Sbjct:    5 EDENGWKK---KTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIENEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIHESVSAQIKKNFAKSKWKQAFNATAVVRHMRRL------QLSTSLEGPSQITSTSPY 338          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 375.941 bits (964), Expect = 2.691e-128
Identity = 177/336 (52.68%), Postives = 247/336 (73.51%), Query Frame = 1
Query:   82 SIFSFEMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI-------FVTTAIEHMMRLCNRPEQN 1062
            S+      EYWI  S K+     YYE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MFK I+   Y F SPWWD+VSLNAKD++ KL+V DP KRLT  QAL H WV G+ A  + ++  Q KL+EFN +RRKLKA++        + +A  H     N+P +N
Sbjct:    9 SVSGSAAPEYWIDGSNKDT-LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHMDNAQKKLQEFN-ARRKLKAAVKAVVASSRLGSAGSHSSHDSNKPSRN 342          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 375.17 bits (962), Expect = 6.600e-128
Identity = 176/328 (53.66%), Postives = 245/328 (74.70%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI-------FVTTAIEHMMRLCNRPEQN 1062
            EYWI  S K+     YYE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MFK I+   Y F SPWWD+VSLNAKD++ KL+V DP KRLT  QAL H WV G+ A  + ++  Q KL+EFN +RRKLKA++        + +A  H     N+P +N
Sbjct:   21 EYWIDGSNKDT-LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHMDNAQKKLQEFN-ARRKLKAAVKAVVASSRLGSAGSHSSHDSNKPSRN 346          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 375.17 bits (962), Expect = 1.478e-127
Identity = 176/328 (53.66%), Postives = 245/328 (74.70%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI-------FVTTAIEHMMRLCNRPEQN 1062
            EYWI  S K+     YYE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MFK I+   Y F SPWWD+VSLNAKD++ KL+V DP KRLT  QAL H WV G+ A  + ++  Q KL+EFN +RRKLKA++        + +A  H     N+P +N
Sbjct:    8 EYWIDGSNKDT-LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHMDNAQKKLQEFN-ARRKLKAAVKAVVASSRLGSAGSHSSHDSNKPSRN 333          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 375.17 bits (962), Expect = 1.478e-127
Identity = 176/328 (53.66%), Postives = 245/328 (74.70%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI-------FVTTAIEHMMRLCNRPEQN 1062
            EYWI  S K+     YYE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MFK I+   Y F SPWWD+VSLNAKD++ KL+V DP KRLT  QAL H WV G+ A  + ++  Q KL+EFN +RRKLKA++        + +A  H     N+P +N
Sbjct:    8 EYWIDGSNKDT-LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHMDNAQKKLQEFN-ARRKLKAAVKAVVASSRLGSAGSHSSHDSNKPSRN 333          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 375.555 bits (963), Expect = 2.351e-127
Identity = 176/328 (53.66%), Postives = 245/328 (74.70%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI-------FVTTAIEHMMRLCNRPEQN 1062
            EYWI  S K+     YYE+ +++G G+T  VY C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MFK I+   Y F SPWWD+VSLNAKD++ KL+V DP KRLT  QAL H WV G+ A  + ++  Q KL+EFN +RRKLKA++        + +A  H     N+P +N
Sbjct:   38 EYWIDGSNKDT-LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHMDNAQKKLQEFN-ARRKLKAAVKAVVASSRLGSAGSHSSHDSNKPSRN 363          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 369.007 bits (946), Expect = 2.765e-124
Identity = 169/307 (55.05%), Postives = 235/307 (76.55%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +P   ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   27 DYWI-DGSNRDPLGDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 369.007 bits (946), Expect = 2.765e-124
Identity = 169/307 (55.05%), Postives = 235/307 (76.55%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +P   ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   27 DYWI-DGSNRDPLGDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 369.007 bits (946), Expect = 2.765e-124
Identity = 169/307 (55.05%), Postives = 235/307 (76.55%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +P   ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   27 DYWI-DGSNRDPLGDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 283.108 bits (723), Expect = 8.726e-92
Identity = 145/319 (45.45%), Postives = 199/319 (62.38%), Query Frame = 1
Query:   97 EMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            E    W K +   E  +K +E    +G G+   V     K T   FA K I KK  K     I++E+ VL K+ H NI+ L ++YES   +++V++ VSGGELFDRIV +GFY+EKDAS  +R++L AV YLH   I+HRDLKPENLLY SQ EES + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD I  L+  DP+KR T  QA  H W+ G+ A + ++ E+ +     N ++ K + +   T  + HM RL
Sbjct:    7 ESSSSWKKQA---EDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRRL 322          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 279.256 bits (713), Expect = 6.905e-91
Identity = 137/318 (43.08%), Postives = 204/318 (64.15%), Query Frame = 1
Query:  130 KNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQET 1071
            + E     YEI  K+G+G+   V     + +    A K I KK     + L+++E+ VL +++HPNI+ L +V+ES + +++ +E V+GGELFDRI+ RG Y+EKDAS  V ++L AVSYLH   I+HRDLKPENLLY +  E+S + ++DFG++KI   ++   T CGTPGY APE+L    YGK VD+W++GVI+YILLCGY PFY+E D ++F  I++  Y F SP+WD++S +AKD I  LL  DP KR T  QAL H+W+ G+ A    +  + ++  + N +R   K +   T+ + H+ +L   PE  + +
Sbjct:    7 QTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNM-LGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRDILGSVSEQIQKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEAS 323          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Match: sp|P13234|KCC4_RAT (Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus OX=10116 GN=Camk4 PE=1 SV=3)

HSP 1 Score: 372.474 bits (955), Expect = 1.196e-124
Identity = 170/307 (55.37%), Postives = 236/307 (76.87%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D  K +P   ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   27 DYWI-DGSKRDPLSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Match: sp|P08414|KCC4_MOUSE (Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus OX=10090 GN=Camk4 PE=1 SV=2)

HSP 1 Score: 368.237 bits (944), Expect = 4.002e-123
Identity = 169/307 (55.05%), Postives = 234/307 (76.22%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +P   ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA   V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   27 DYWI-DGSNRDPLGDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDARDAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 331          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Match: sp|Q16566|KCC4_HUMAN (Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 3.099e-122
Identity = 168/307 (54.72%), Postives = 234/307 (76.22%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            +YWI D    +    ++E+ +++G G+T  VY C +K T   +A KV+ K V+KK++++E+GVLL+L+HPNII+L E++E+ T++ +VLE V+GGELFDRIV +G+YSE+DA+  V+++L+AV+YLHEN I+HRDLKPENLLY +   ++ LK+ADFG++KI+E  V   TVCGTPGYCAPEIL G +YG  VD+WS+G+ITYILLCG+EPFY+E+ +Q MF+ I+   Y F SPWWD VSLNAKD++ KL+V+DP KRLT  QAL H WV G+ A    ++  Q KL+EFN +RRKLKA++    A
Sbjct:   31 DYWI-DGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFN-ARRKLKAAVKAVVA 335          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Match: sp|Q8BW96|KCC1D_MOUSE (Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 6.104e-91
Identity = 145/319 (45.45%), Postives = 199/319 (62.38%), Query Frame = 1
Query:   97 EMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            E    W K +   E  +K +E    +G G+   V     K T   FA K I KK  K     I++E+ VL K+ H NI+ L ++YES   +++V++ VSGGELFDRIV +GFY+EKDAS  +R++L AV YLH   I+HRDLKPENLLY SQ EES + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD I  L+  DP+KR T  QA  H W+ G+ A + ++ E+ +     N ++ K + +   T  + HM RL
Sbjct:    7 ESSSSWKKQA---EDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRRL 322          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Match: sp|O70150|KCC1B_RAT (Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 4.106e-90
Identity = 137/318 (43.08%), Postives = 204/318 (64.15%), Query Frame = 1
Query:  130 KNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQET 1071
            + E     YEI  K+G+G+   V     + +    A K I KK     + L+++E+ VL +++HPNI+ L +V+ES + +++ +E V+GGELFDRI+ RG Y+EKDAS  V ++L AVSYLH   I+HRDLKPENLLY +  E+S + ++DFG++KI   ++   T CGTPGY APE+L    YGK VD+W++GVI+YILLCGY PFY+E D ++F  I++  Y F SP+WD++S +AKD I  LL  DP KR T  QAL H+W+ G+ A    +  + ++  + N +R   K +   T+ + H+ +L   PE  + +
Sbjct:    7 QTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNM-LGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAALDRDILGSVSEQIQKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEAS 323          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Match: A0A267GGV5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011758g1 PE=3 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 9.919e-139
Identity = 186/316 (58.86%), Postives = 251/316 (79.43%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNR 1050
            +YW+K+SIK+ PFE  YE+ +++G G+T  VY C    ++ K+A K+I KKV+KK++ +E+GVLL ++HPNIIRL E++E+A+ ++MVLE+V+GGELFDRIVSRG YSEKDA+ CV+++LQA+ YLHE DIIHRDLKPENLLYES+ +++ LK+ADFG++KI+ DDV T+TVCGTPGYCAPE+LL   YG PVD+WS+GVITYILLCGYEPFY E ++ M++ I++G Y F SPWWD +S NAKD++S+L+++DP KRLTA+QAL H WV G  AK   L+  Q KLKEFN ++RKL+A+     AI     L  +
Sbjct:    4 DYWVKESIKDTPFESVYELGSELGRGATSIVYECRLIGSNQKWAVKIIQKKVDKKIVSTEIGVLLSVSHPNIIRLKELFETASHIYMVLEHVTGGELFDRIVSRGSYSEKDAAICVQQLLQALKYLHEKDIIHRDLKPENLLYESESDDACLKVADFGLSKIVSDDVQTLTVCGTPGYCAPEVLLSRDYGTPVDMWSVGVITYILLCGYEPFYAENESDMYRRILRGQYEFDSPWWDEISRNAKDLVSRLMLLDPAKRLTASQALRHPWVTGLAAKEDRLDGAQVKLKEFN-AKRKLRAATDAVIAIHRTAALVQQ 318          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Match: A0A1S3I026 (calcium/calmodulin-dependent protein kinase type IV OS=Lingula unguis OX=7574 GN=LOC106159758 PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.703e-130
Identity = 179/310 (57.74%), Postives = 244/310 (78.71%), Query Frame = 1
Query:   97 EMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYE-SQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAI 1023
            +M++YWI+DSIK++ FE YY I+ ++G G+T  VY C +K     +A K+++KKV+KK++++E GVLLKL H N+IRL E+YE+ T +++VLE V+GGELFDRIV+RG YSEKDA+ CV++ML AV +LH+ND+ HRDLKPENLLY+ S +ES LK+ADFG++KI E ++   TVCGTPGYCAPE+L G  Y   VD+WS+GVITYILLCGYEPFY + + +M+K IIKG Y F +PWWD+VS NAKD++ +LL VDP +RLT++QAL H W+KG   K+  +EE Q KLK+FN ++RKL+A+  V  A+
Sbjct:    5 KMQDYWIEDSIKDKKFEDYYNIVKELGKGATSVVYRCEQKGLAQPWAVKILTKKVDKKIVRTECGVLLKLKHSNVIRLKEIYETPTQIYLVLELVTGGELFDRIVTRGCYSEKDAANCVKQMLDAVKFLHQNDVAHRDLKPENLLYQDSSDESLLKVADFGLSKICESNIQMSTVCGTPGYCAPEVLQGNPYSTAVDMWSVGVITYILLCGYEPFYCDNEKEMYKKIIKGDYMFDAPWWDDVSENAKDLVRQLLKVDPAERLTSSQALEHPWLKG-ACKSQHMEEAQCKLKQFN-AKRKLRAATAVVMAM 312          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Match: A0A1I8GDJ9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 1.827e-126
Identity = 177/316 (56.01%), Postives = 240/316 (75.95%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNR 1050
            +YW+K+SIK+ PFE  YE+ +++G G+T  VY C    ++ K+A K+I KKV+KK++ +E+GVLL ++HPNIIRL E++E+A+ ++MVLE+V+GGELFDRIVSRG YSEKDA+ CV+++LQA+ YLHE DIIHRDLKPENLLYES+ +++ LK+ADFG++KI+ DDV T+TVCGTPGYCAPE+LL   YG PVD+WS+GVITYIL              M++ I++G Y F SPWWD +S NAKD++S+L+++DP KRLTA+QAL H WV G  AK   L+  Q KLKEFN ++RKL+A+     AI     L  +
Sbjct:    4 DYWVKESIKDTPFESVYELGSELGRGATSIVYECRLIGSNQKWAVKIIQKKVDKKIVSTEIGVLLSVSHPNIIRLKELFETASHIYMVLEHVTGGELFDRIVSRGSYSEKDAAICVQQLLQALKYLHEKDIIHRDLKPENLLYESESDDACLKVADFGLSKIVSDDVQTLTVCGTPGYCAPEVLLSRDYGTPVDMWSVGVITYIL-------------DMYRRILRGQYEFDSPWWDEISRNAKDLVSRLMLLDPAKRLTASQALRHPWVTGLAAKEDRLDGAQVKLKEFN-AKRKLRAATDAVIAIHRTAALVQQ 305          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Match: A0A1I8J5Y5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 2.141e-126
Identity = 169/319 (52.98%), Postives = 240/319 (75.24%), Query Frame = 1
Query:  103 EEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPE 1056
            +E+W+K+SIK+ PF+  Y++ +++G G+T  V+ C ++ T+ K+A KVI KKV+KK++ +E+G+LL ++HPNIIRL E++E++T +H VLEYV+GGELFDRIVSRG YSE+DA++CVR++L+A+ YLHE DIIHRDLKPENLLYE++ +++ LK+ADFG++KI+  DV T TVCGTPGYCAPE+LLG  YG PVD+W +GVI YIL             +M++ I++  Y F SPWWD +S NA+D++S L+ +DP KRLTA QAL H WV G+ AKT  L+  Q+KLKEFN+ R+    ++    A+ H +   +R E
Sbjct:    3 KEFWLKESIKDVPFDSVYDLCSELGRGATSVVFACQKRGTNEKWAVKVIQKKVDKKIVATEIGILLTISHPNIIRLKELFETSTHIHTVLEYVTGGELFDRIVSRGNYSEQDAAQCVRQLLEALKYLHEKDIIHRDLKPENLLYENERDDACLKIADFGLSKIISQDVQTATVCGTPGYCAPEVLLGKGYGTPVDMWGLGVIAYIL-------------EMYRKILRAQYEFDSPWWDGISRNARDLVSGLMQLDPAKRLTAAQALQHPWVSGQAAKTEPLQAVQSKLKEFNAKRKLKNRNVLNNAAVPHNLLTSSRLE 308          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Match: A0A1I8GVX7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 2.268e-126
Identity = 169/299 (56.52%), Postives = 235/299 (78.60%), Query Frame = 1
Query:  103 EEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLK 996
            +E+W+K+SIK+ PF+  Y++ +++G G+T  V+ C ++ T+ K+A KVI KKV+KK++ +E+G+LL ++HPNIIRL E++E++T +H VLEYV+GGELFDRIVSRG YSE+DA++CVR++L+A+ YLHE DIIHRDLKPENLLYE++ +++ LK+ADFG++KI+  DV T TVCGTPGYCAPE+LLG  YG P+            LCGYEPFY E D++M++ I++  Y F SPWWD +S NA+D++S L+ +DP KRLTA QAL H WV G+ AKT  L+  Q+KLKEFN ++RKLK
Sbjct:    3 KEFWLKESIKDVPFDSVYDLCSELGRGATSVVFACQKRGTNEKWAVKVIQKKVDKKIVATEIGILLTISHPNIIRLKELFETSTHIHTVLEYVTGGELFDRIVSRGNYSEQDAAQCVRQLLEALKYLHEKDIIHRDLKPENLLYENERDDACLKIADFGLSKIISQDVQTATVCGTPGYCAPEVLLGKGYGTPL----FSPTASPRLCGYEPFYAENDSEMYRKILRAQYEFDSPWWDGISRNARDLVSGLMQLDPAKRLTAAQALQHPWVSGQAAKTEPLQAVQSKLKEFN-AKRKLK 296          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV-like [Source:NCBI gene;Acc:103036728])

HSP 1 Score: 379.407 bits (973), Expect = 2.399e-128
Identity = 171/335 (51.04%), Postives = 248/335 (74.03%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQE-ESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMR-------LCNRPEQNQETDISG 1083
            EYW++ S ++   E++Y +  ++G G+T  V+ C  K+T+  +AAKV+ K ++KK++++E+GVLL+L+HPNIIRL E++E+ T++ ++LE V+GGELFDRIV RG+YSE+DA+  ++++L+AV+YLHEN ++HRDLKPENLLY     ++ LK+ADFG++KI+++ V   TVCGTPGYCAPEIL G +YG  VD+WS+GVI YILLCG+EPF++ + +Q M+  I+   Y F SPWWD VSLNAKD++SKL+V+DPHKRL+  QAL H WV G+ A+ S ++ TQ KL+EFN +RRKLKA++    A   M          C  P  ++ +  SG
Sbjct:   12 EYWVEGSRRDASMEEFYTMGPELGRGATSVVFRCEEKQTEKPYAAKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEISLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSIDAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVSKLIVLDPHKRLSVQQALEHPWVLGKAARFSHMDTTQRKLQEFN-ARRKLKAAMKAVVATSRMHEGSKRRTDSCEMPSSDKPSQPSG 345          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Match: camk4 (calcium/calmodulin dependent protein kinase IV [Source:NCBI gene;Acc:103044753])

HSP 1 Score: 363.999 bits (933), Expect = 7.581e-124
Identity = 167/307 (54.40%), Postives = 234/307 (76.22%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYE-SQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTA 1020
            EYWI DS K E    +YE+  ++G G+T  V+ C +K T   +A K++ K V+KK++++E+GVLL+L+HPNII+L E++E+  ++ +VLE V+GGELFDR+V +G+YSE+DA+  ++++L+AV+YLHE+ ++HRDLKPENLLY  S  ++ LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+GVITYILLCG+EPF++++ +Q MFK I+   Y F SPWWDNVSLNAKD++ KL+V DP KRLT  QAL H WV G+    + ++  Q KL EFN +RRKLKA++    A
Sbjct:   16 EYWIDDS-KRETLADFYELECELGRGATSVVFRCRQKGTQKPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPLEISLVLELVTGGELFDRVVEKGYYSERDAADAIKQVLEAVAYLHEHGVVHRDLKPENLLYATSAPDAPLKIADFGLSKIIDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTLQALQHPWVTGKATNFTHMDTAQKKLLEFN-ARRKLKAAVKAVVA 320          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV-like [Source:NCBI gene;Acc:103036728])

HSP 1 Score: 360.533 bits (924), Expect = 6.065e-121
Identity = 164/310 (52.90%), Postives = 232/310 (74.84%), Query Frame = 1
Query:  181 GSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQE-ESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMR-------LCNRPEQNQETDISG 1083
            G+T  V+ C  K+T+  +AAKV+ K ++KK++++E+GVLL+L+HPNIIRL E++E+ T++ ++LE V+GGELFDRIV RG+YSE+DA+  ++++L+AV+YLHEN ++HRDLKPENLLY     ++ LK+ADFG++KI+++ V   TVCGTPGYCAPEIL G +YG  VD+WS+GVI YILLCG+EPF++ + +Q M+  I+   Y F SPWWD VSLNAKD++SKL+V+DPHKRL+  QAL H WV G+ A+ S ++ TQ KL+EFN +RRKLKA++    A   M          C  P  ++ +  SG
Sbjct:   41 GATSVVFRCEEKQTEKPYAAKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEISLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSIDAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVSKLIVLDPHKRLSVQQALEHPWVLGKAARFSHMDTTQRKLQEFN-ARRKLKAAMKAVVATSRMHEGSKRRTDSCEMPSSDKPSQPSG 349          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 286.189 bits (731), Expect = 5.422e-93
Identity = 137/305 (44.92%), Postives = 205/305 (67.21%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKI--LEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
             +K +E+   +G G+   V     + T   +A K I KK     +  I++E+ VL K+ H NI+ L ++YES   ++++++ VSGGELFDRIV RGFY+E+DAS  ++++L AV+YLH   I+HRDLKPENLLY +Q+ES + ++DFG++K+    +D+ + T CGTPGY APE+L    Y K VD WSIGVI+YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD IS L++ +P KR T +QAL H W+ G+ A   ++ E+ ++  + N ++ K + +   T  I HM RL
Sbjct:   20 IKKIFELKEILGTGAFSEVVLAQERSTGKMYAVKCIPKKALRGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYYNQDESKIMISDFGLSKMEGAANDIMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAGDTALRKNIHESVSRQMKKNFAKAKWRQAFNATAVIRHMKRL 323          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 280.026 bits (715), Expect = 7.214e-91
Identity = 134/292 (45.89%), Postives = 198/292 (67.81%), Query Frame = 1
Query:  181 GSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKI--LEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            G+   V     + T   +A K I KK     +  I++E+ VL K+ H NI+ L ++YES   ++++++ VSGGELFDRIV RGFY+E+DAS  ++++L AV+YLH   I+HRDLKPENLLY +Q+ES + ++DFG++K+    +D+ + T CGTPGY APE+L    Y K VD WSIGVI+YILLCGY PFY+E D+++F+ I+K  Y F SP+WD++S +AKD IS L++ +P KR T +QAL H W+ G+ A   ++ E+ ++  + N ++ K + +   T  I HM RL
Sbjct:   16 GAFSEVVLAQERSTGKMYAVKCIPKKALRGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYYNQDESKIMISDFGLSKMEGAANDIMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAGDTALRKNIHESVSRQMKKNFAKAKWRQAFNATAVIRHMKRL 306          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.973 bits (624), Expect = 4.754e-78
Identity = 124/299 (41.47%), Postives = 192/299 (64.21%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKK----VNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHT-MTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVT 1014
            F   Y++  ++G G+   V  CV+  T  +FAAK+I+ K     + + ++ E  +   L H NI+RL+E        ++V + V+GGELF+ IV+R +YSE DAS C++++L++V + H++ I+HRDLKPENLL  S+ + + +KLADFG+A  ++ D        GTPGY +PE+L    YGKPVD+W+ GVI YILL GY PF++E  +++++ I  G Y F SP WD V+  AK++I+++L ++P KR+TA +AL H W+       S +  +ET   L++FN +RRKLK +I  T
Sbjct:   10 FTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRSTVASCMHRQETVECLRKFN-ARRKLKGAILTT 307          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.409 bits (581), Expect = 3.952e-73
Identity = 116/255 (45.49%), Postives = 165/255 (64.71%), Query Frame = 1
Query:  178 NGSTCTVYCCVRKRTDIKFAAKVISK---KVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYV----SGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCA---PEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVW 909
             G+   V     + T    A K I+K   +     +++EV VL ++ H NII L ++YE+ + ++++++ V     GGELFDRIV RGFY+E+DAS  +R++L+AVS+LH   ++HRDLKPENLLY S E+ S + ++DFG++K+        T CGTPGY A   PE+L    Y + VD WSIGVI+YILLCGY PFY+E D+++F  I+K  Y F SP+WD++S +AKD I  L+  D  +R T  QAL H W
Sbjct:    1 RGAFSEVVLAEERSTGRHVAIKCIAKTALRGKDNTVENEVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLSKVEAPGSVMSTACGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCGYPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 3.442e-67
Identity = 124/280 (44.29%), Postives = 175/280 (62.50%), Query Frame = 1
Query:  145 EKYYEILNKIGNGSTCTVYCCVR--------KRTDIKFAAKVISKKV---NKKLIKSEVGVLLKL-THPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE--SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYN-EKDN-QMFKNIIKGIYSFSSPWWDNVSLN---AKDIISKLLVVDPHKRLTANQALNHVWVKGEGA 927
            E  YEI   IG+G+  TV  C R           +   A K+I K      +++++SEV +  +L  HPN++RL E  ES +D ++VLE V GG+LFD I     ++E+ A+  V ++ +A+ YLH N+I+HRD+KPENLL +   +  + LKLAD G+A  +   ++T  VCGTP Y APEIL    YG  VD+W+ GVITYILLCG+ PF + E+D  ++F+ I  G Y F SP+WD++S     AKD++S+LLVVD  +R TA QAL+H WV   GA
Sbjct:  360 ESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTGPIYT--VCGTPTYVAPEILAETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSDGGA 637          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 204.142 bits (518), Expect = 1.018e-62
Identity = 101/216 (46.76%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  379 VSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHT-MTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVT 1014
            V+GGELF+ IV+R +YSE DAS  ++++L+AV + H+  I+HRDLKPENLL  S+ + + +KLADFG+A  ++ +        GTPGY +PE+L    YGKPVD+W+ GVI YILL GY PF++E  +++++ I  G Y F SP WD V+  AK +I+++L ++P KR+TA++AL H W+       S +  +ET   LK+FN +RRKLK +I  T
Sbjct:    1 VTGGELFEDIVAREYYSEADASTGIQQILEAVLHCHQLGIVHRDLKPENLLLASKTKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKSLINQMLTINPAKRITASEALTHPWIFQRSTVASCMHRQETVECLKKFN-ARRKLKGAILTT 215          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 199.134 bits (505), Expect = 1.513e-61
Identity = 106/264 (40.15%), Postives = 156/264 (59.09%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKL-THPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY--ESQEESNLKLADFGIAKILE-DDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ---MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWV 912
            F   YE+   IG GS      C+ K T++++A KVI  K +K+    E+ +LL+   HPN+I L +VY+    V++V E + GGEL D+I+ + F+SE++AS  ++ + + V YLH   ++HRDLKP N+LY  ES    +L++ DFG AK L  ++   MT C T  + APE+L    Y    D+WS+GV+ Y +L G+ PF N  D+    +   I  G +  S   WD VS  AKD++ K+L VDPH+R TA Q L H W+
Sbjct:    8 FSDGYELREDIGVGSYSVCKRCIHKTTNMEYAVKVIIDK-SKRDPSEEIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWDTVSEAAKDLVKKMLHVDPHQRFTAAQVLRHPWI 270          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 209.534 bits (532), Expect = 1.080e-63
Identity = 125/339 (36.87%), Postives = 192/339 (56.64%), Query Frame = 1
Query:  172 IGNGSTCTVYCCVRKRTDIKFAAKVISKK------VNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY-ESQEESNLKLADFGIAKIL--EDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIY--SFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTEQ 1155
            +G GS   V    +  T+   A K++ KK      V  +++  E+ +L KL+HPNI+   + +ES    ++V +  +GGELFDRI+SRG ++E DA   + ++L AV Y+H  +++HRDLKPEN+LY +  E S L +ADFGIAK L  E+D+      G+ GY APE+L    +GKP D+WSIGVITY LLCGY PF  E      +      Y  +F  P+WDN+S++ K  I K L ++P  R TA + L+  W+  +  +TS++      +K+  S R+KL+ +I +      + RL N      + D + I   + + +  +G+ H + DL  Q
Sbjct:   53 LGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDL-IYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNI---LPDVKKGFSLRKKLRDAIEIVKLNNRIKRLRNMYSLGDDGD-NDIEENSLNESLLDGVTHSLDDLRLQ 386          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 203.371 bits (516), Expect = 2.886e-61
Identity = 119/297 (40.07%), Postives = 166/297 (55.89%), Query Frame = 1
Query:  145 EKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKK------VNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY-ESQEESNLKLADFGIAKILEDDVHTM-TVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIY--SFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI 1005
            +K Y     +G G+   V       T    A K++ KK      V  + +  E+ +L +L HPNI+   + +ES    +++ +   GGELFDRI+ +G ++E+DA R + E+L AV Y+H  +I+HRDLKPENLLY +  +ES L +ADFGIAK L+ D   +    G+ GY APE+L    +GKP D+WSIGVITY LLCGY  F  E+          G Y   F  P+WD+VS  AK  I K L +DP KR TA + L   W+     KT +L      LKE   +R+K + S+
Sbjct:   34 KKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWIICTELKTHNL---LPGLKEGLDARQKFRNSV 327          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 190.274 bits (482), Expect = 8.154e-55
Identity = 108/263 (41.06%), Postives = 157/263 (59.70%), Query Frame = 1
Query:  154 YEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKK-----LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKP-VDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYS---FSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVK 915
            Y+I+  +G GS   V       T  K A K+I+KKV  K      I+ E+  L  L HP+II+LY+V +S  ++ MV+EY +G ELFD IV R   SE++A R  ++++ AV Y H + I+HRDLKPENLL +  E  N+K+ADFG++ I+ D     T CG+P Y APE++ G  Y  P VD+WS GVI Y++LC   PF +E    +FKNI  G+Y+   F SP        A  +I ++L+V+P  R++ ++ +   W K
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLD--EHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSP-------GAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 191.045 bits (484), Expect = 2.738e-54
Identity = 103/275 (37.45%), Postives = 149/275 (54.18%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVS-------------YGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWD-NVSLNAKDIISKLLVVDPHKRLTANQALNHVWVK 915
            F+ +  I   +G G+  TV   + + T   FA K+ISK+    N   +  E+ VL KL HP I+RL   YE     +MV+E+VSGG+L D + + G   E       R++L A+ Y+H   I HRDLKP+N+L E  +   +K+ DFG+AK+  +     T CGT  Y APE++ G               Y   VD+WS+G + Y++L G+ PF     +Q++K I +G Y    P  D  +S  A+D I  LL VDP+ R TA +ALNH W+K
Sbjct:  194 FKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSY-HEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIK 467          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 182.57 bits (462), Expect = 6.760e-53
Identity = 103/297 (34.68%), Postives = 161/297 (54.21%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVN-----KKLIKSEVGVLLKLTHPNIIRLYEVY-----ESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY-----------------ESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFK-NIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTS-SLE 945
            F+KY  +  ++G G    V     K+T  + A K+   + N      K  + E  +L+++ HPNI+ L + +     +S    ++VLE +  GELF+RIV +    + ++    +++L  + YLHE +IIHRD+KPEN+L                  E + +  +K+ADFG+AK   +   T T+CGTP Y APE+L    Y   VDLWS GVI Y+ LCG+ PF ++      K  I++  Y+F SP+WD +  +   +IS LLV++P +R   ++ALNH W      ++S SLE
Sbjct:  197 FDKYL-LGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLE 492          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 363.999 bits (933), Expect = 5.035e-125
Identity = 166/311 (53.38%), Postives = 233/311 (74.92%), Query Frame = 1
Query:  109 YWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQ-EESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMR 1038
            Y+ +D  + EP E +Y+I  ++G G++  V  C +K T+ +FA K++ K V+KK+I++E G+L ++ HPNII + E++E+ T + MVLE V+GGELFDR+V +G+Y EKDA+  ++ +L+AV +LH+NDI+HRDLKPENLLY ++ E+S LK+ADFG++KIL  +V T TVCGTPGYCAPE+L G SY   VD+W+IGVI YILLCG+EPFY+E D QMF+ I+K  Y F SPWWD+VS  AKD++ +L+  D +KRLTA QAL+H WVKGE A+   +E T+ KLKEFN ++RKLK  +    A E+  +
Sbjct:    3 YFFEDLSRKEPIEDFYDIGKELGRGASSVVKLCRQKGTNKEFAVKIMKKTVDKKIIQTETGILFRINHPNIIHMKELFETHTHLFMVLELVTGGELFDRVVEKGYYCEKDAADAIKMILEAVGHLHKNDIVHRDLKPENLLYANEREDSPLKIADFGLSKILPQEVMTSTVCGTPGYCAPEVLKGESYDTGVDMWAIGVIAYILLCGFEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPWVKGENARREDMERTRKKLKEFN-AKRKLKGGMLGVMAAENFAK 312          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 253.832 bits (647), Expect = 4.208e-82
Identity = 129/295 (43.73%), Postives = 188/295 (63.73%), Query Frame = 1
Query:  133 NEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI 1005
            ++   K Y++   +G G+   V     K T   FA K ISKK  K   + +++E+ +L K+ H NII L +++++ + +++V++ V GGELFDRIV +G Y+E+DAS  V+++L+A  YLH   I+HRDLKPENLLY S  E+S + ++DFG++KI        T CGTPGY APE+L    YGK VD WSIGVITYILLCGY PFY++ D  +F  I++  Y F SP+WD +S +AKD I  L+ +DP  R T  QAL+H W+ G  A T  +  + ++  + N  ++K K  +
Sbjct:   10 DDKITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEALTRDIHASVSEQIKKNFYKQKWKVCV 304          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 253.832 bits (647), Expect = 6.809e-80
Identity = 140/351 (39.89%), Postives = 214/351 (60.97%), Query Frame = 1
Query:  142 FEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKK------VNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNL-KLADFGIA-KILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQ--NQETDISGICSINSSATFTEGMNHEMLDLTEQI 1158
            F + YE+  ++G G+  TV  C  + T I++A K++  K      V+K  ++ E  +   L HPN++RL+    S     +V + V+GGELF+ IV+R +YSE DAS C++++L +V + HEN I+HRDLKPENLL  S+E   + KLADFG+A ++  + +      GTPGY +PE+L    YGKPVDLW+ GVI YILL GY PF++E+  +++  I  G Y + SP WD V+ +AKD+I K+L VD  KR+TA +AL H W+       S +  ++T + LK FN +RRKL+ +I  T    H     +R ++  + E  I+ I   ++ +T T+    E++ LT+Q+
Sbjct:   13 FNEKYELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDVHK--VEREARICRHLRHPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGERLGWYGFAGTPGYLSPEVLKKDPYGKPVDLWACGVILYILLVGYPPFWDEEQQKLYSQIKAGTYDYPSPEWDTVTADAKDLIDKMLTVDAPKRITAAEALKHPWIVNRERIASKVHRQQTLDGLKRFN-ARRKLRGAIHATILATHNFSSGSRHKKKGSDEDSIATIIEEDTESTKTQ-REQEIIRLTQQL 359          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Match: EDO30537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0H5])

HSP 1 Score: 243.047 bits (619), Expect = 1.041e-75
Identity = 127/305 (41.64%), Postives = 195/305 (63.93%), Query Frame = 1
Query:  124 SIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKKLIKS---EVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILE-DDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL--EETQNKLKEFNSSRRKLKASIFVT 1014
            S  +  F   YE+  ++G G+   V  C+ K + I++AAK+I ++K++ + ++    E  +   L HPNI+RL+         ++V + V+GGELF+ IV+R +YSE DAS C+++++++V + H N+++HRDLKPENLL  S+E+ + +KLADFG+A  +E +        GTPGY +PE+L    YGKPVDLW+ GVI YILL GY PF++E  ++++  I  G Y + SP WD V+  AKD+I+ +L VD  KR+ A +AL H W+       S +  +ET + LK+FN +RRKLK +I  T
Sbjct:    3 STHSRGFHDTYELKEELGKGAFSIVRRCIHKESRIEYAAKIINTRKLSSRDLQKLDREARICRLLKHPNIVRLHASIAEEGYHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIIESVQHCHTNNVVHRDLKPENLLLASKEKNAAVKLADFGLAIEVEIEKTGWYGFAGTPGYLSPEVLKKEPYGKPVDLWACGVILYILLVGYPPFWDEDQHKLYAQIKTGNYDYPSPEWDTVTDEAKDLINMMLTVDQSKRIGAGEALKHPWIVNRERVASKVHRQETLDGLKKFN-ARRKLKGAILTT 306          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 241.121 bits (614), Expect = 1.262e-74
Identity = 122/259 (47.10%), Postives = 170/259 (65.64%), Query Frame = 1
Query:  154 YEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY--ESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFY--NEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVW 909
            Y    K+G+G+   V  C  K T  +FA K+I K+     +K+I  E+ ++ +  HPNI+RL+E Y+SAT++++V+E + GG+LFD I S   ++E  A    R+M +A++YLH+  I+HRDLKPENLL    S  +++LKLADFG+A  +E      TVCGTP Y APEIL    YG  VD+W+ GVITYI+LCG+ PF   N   +++F  I  G + F SP+WD VS +AKD+IS +LVVDP KR TA+Q L H W
Sbjct:  246 YNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDDEIAIMRRCRHPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLA--MEVTAPIFTVCGTPTYVAPEILEENGYGLKVDMWAAGVITYIMLCGFPPFRSPNRDQDELFDLIQSGEFEFLSPYWDPVSDDAKDLISTMLVVDPTKRATADQVLQHRW 502          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV [Source:NCBI gene;Acc:101155594])

HSP 1 Score: 374.785 bits (961), Expect = 4.164e-126
Identity = 171/334 (51.20%), Postives = 245/334 (73.35%), Query Frame = 1
Query:  106 EYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQE-ESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQ-MFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINS 1101
            E+W+  S ++   E +Y + +++G G+T  VY C  K+T   +A KV+ K ++KK++++E+GVLL+L+HPNII+L E++E+ TD+ +VLE V+GGELFDRIV RG+YSE+DA+  ++++L+AV+YLHEN ++HRDLKPENLLY     +++LK+ADFG++KI++D V   TVCGTPGYCAPEIL G +YG  VD+WS+GVI YILLCG+EPF++ + +Q M+  I+   Y F SPWWD VSLNAKD++ KL+V+DPHKRL+  +AL H WV G+ A+ S ++ TQ KL+EFN +RRKLKA++    A   M     R   + E   SG    +S
Sbjct:   12 EFWVDGSRRDGTVEDFYTLGSELGRGATSIVYRCEEKQTQKPYAVKVLKKTIDKKIVRTEIGVLLRLSHPNIIQLKEIFETDTDIALVLELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSLDASLKIADFGLSKIIDDQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNAKDLVGKLIVLDPHKRLSVREALQHPWVLGKAARFSHMDTTQRKLQEFN-ARRKLKAAMKAVVATSRMHEGSRRRTDSCEIQGSGTSRQSS 344          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 282.722 bits (722), Expect = 4.201e-91
Identity = 146/356 (41.01%), Postives = 229/356 (64.33%), Query Frame = 1
Query:   97 EMEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKL-IKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHM--MRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTE 1152
            E +  W K +   E  ++ ++++ ++G+G+   V+    ++T  KFA K I KK  + + +++E+ VL ++ H N++ L ++YES T  +++++ VSGGELFDRI+ RG Y+EKDASR ++++LQAVSYLH+N I+HRDLKPEN+LY SQ+E S + ++DFG++K+ +  + + T CGTPGY APE+L    Y K VD WSIGVITYILLCGY PFY E + ++F  I+K  Y F SP+WD++S +AKD I  ++   P  R +  QAL H W+ G+ A+++ +  + +   + N ++ K K +     AI HM  ++L +     ++T I  I  I+ S+  T+   H  LD  E
Sbjct:    5 ESDHMWKKST---ENIQEIFDLMEELGSGAFSEVFMVRERKTGKKFAMKCIKKKKKRDINLENEMAVLRRIKHENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGLSKMTDTGIMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEESETKLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKTPSMRYSTEQALRHPWIIGKTARSNDIYYSVSTQIQKNFAQTKWKQAYNAAVAINHMKKLKLAHTELPLRQTSIPDIKVIDVSSP-TKNRKHLGLDRPE 355          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 279.641 bits (714), Expect = 5.431e-90
Identity = 137/303 (45.21%), Postives = 196/303 (64.69%), Query Frame = 1
Query:  145 EKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLY-ESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            +K ++    +G G+   V     K +   FA K I KK  K     I++E+ VL K+ H NI+ L ++YES   ++++++ VSGGELFDRIV +GFY+EKDAS  +R++L AV+YLH+  I+HRDLKPENLLY   Q+ES + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F +P+WD++S +AKD IS L+  DP KR T  QAL H W+ G+ A   ++ E+ ++    N ++ K + +   T  + HM RL
Sbjct:   22 KKIFDFKEVLGTGAFSEVVLAQEKLSGRMFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHKLGIVHRDLKPENLLYFNPQDESKIMISDFGLSKMEGSGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPAKRFTCEQALRHPWIAGDTALCKNIHESVSRQIRKNFAKSKWRQAFNATAVVRHMRRL 324          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 278.485 bits (711), Expect = 8.486e-90
Identity = 137/303 (45.21%), Postives = 196/303 (64.69%), Query Frame = 1
Query:  145 EKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNK---KLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            +K ++    +G G+   V     K T    A K I KK  K     I++E+ VL K+ H NI+ L ++YES+  ++++++ VSGGELFDRIV +GFY+E DASR +R++L AV+YLH   I+HRDLKPENLLY S  ++S + ++DFG++K+        T CGTPGY APE+L    Y K VD WSIGVI YILLCGY PFY+E D+++F+ I+K  Y F +P+WD++S +AKD IS L+  DP KR T +QAL H W+ G+ A   ++ E+ ++    N ++ K + +   T  I HM RL
Sbjct:   21 KKIFDFKEVLGTGAFSEVVMAREKATGKMVAIKCIPKKALKGKETSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLVSGGELFDRIVEKGFYTEMDASRLIRQVLDAVNYLHSMGIVHRDLKPENLLYFSPHDDSKIMISDFGLSKMEGTGGVMATACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPWIAGDTALCKNIHESVSRQMRKNFAKSKWRQAFNATAVIRHMRRL 323          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 274.633 bits (701), Expect = 9.945e-89
Identity = 136/300 (45.33%), Postives = 195/300 (65.00%), Query Frame = 1
Query:  154 YEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV---NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL 1041
            Y+    +G G+   V     KRT    A K I KK     +  I++E+ VL K+ HPNI+ L +++ES + ++++++ VSGGELFDRI+ +GFY+EKDAS+ ++++L AV YLH+  I+HRDLKPENLLY S  E+S + ++DFG++KI        T CGTPGY APE+L    Y K VD WSIGVI+YILLCGY PFY+E D ++F+ I+K  Y F SP+WD++S +AKD I  L+  D + R T +QAL H W+ G+ A   ++ E+ +   + N ++ K K +   T  I HM RL
Sbjct:   21 YDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKALEGKENSIENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIHESVSAQIKKNFAKSKWKQAFNATAVIRHMRRL 320          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Match: SMESG000042100.1 (SMESG000042100.1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 1
Query:  100 MEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTEQIS 1161
            MEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTEQIS
Sbjct:    1 MEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLTEQIS 354          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Match: SMESG000008997.1 (SMESG000008997.1)

HSP 1 Score: 257.684 bits (657), Expect = 1.945e-80
Identity = 131/315 (41.59%), Postives = 208/315 (66.03%), Query Frame = 1
Query:  133 NEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV----NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHT--MTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWV--KGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVTT-AIEHMMRLCN 1047
            N  F   YE+  ++G G+   V  CV+K ++++FAAK+I+ K     + + ++ E  +   L HPNI+RL++  +     ++V + V+GGELF+ IV+R FYSE DAS C++++L++V+Y H+N+IIHRDLKPENLL  S+ + + +KLADFG+A  ++++     +   GTPGY +PE+L    YGKPVD+W+ GVI YILL GY PF++E  N+++  I  G++ + SP WD V+  AK++I+++L V+P KR+TA +AL H W+  +   A     ++T + LK+FN +RRKLK +I  T  A  +  + C+
Sbjct:    5 NVKFSDLYEMKEELGRGAFSIVKRCVQKASNLEFAAKIINTKRLSSRDMQKLEREARICRLLKHPNIVRLHDSIQDDGFHYLVFDLVTGGELFEDIVAREFYSEADASNCMQQILESVNYCHQNNIIHRDLKPENLLLSSKSKNARVKLADFGLAVEMKENEEASWLGFAGTPGYLSPEVLRKDPYGKPVDVWACGVILYILLVGYPPFWDEDQNRLYAQIKSGLFDYPSPEWDTVTAEAKNLINQMLTVNPTKRITAAEALKHPWIYQREHIASMVHRQQTVDCLKKFN-ARRKLKGAILTTMLATRNFSKFCS 318          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Match: SMESG000008997.1 (SMESG000008997.1)

HSP 1 Score: 256.529 bits (654), Expect = 3.602e-80
Identity = 129/303 (42.57%), Postives = 203/303 (67.00%), Query Frame = 1
Query:  133 NEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKV----NKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIAKILEDDVHT--MTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWV--KGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVT 1014
            N  F   YE+  ++G G+   V  CV+K ++++FAAK+I+ K     + + ++ E  +   L HPNI+RL++  +     ++V + V+GGELF+ IV+R FYSE DAS C++++L++V+Y H+N+IIHRDLKPENLL  S+ + + +KLADFG+A  ++++     +   GTPGY +PE+L    YGKPVD+W+ GVI YILL GY PF++E  N+++  I  G++ + SP WD V+  AK++I+++L V+P KR+TA +AL H W+  +   A     ++T + LK+FN +RRKLK +I  T
Sbjct:    5 NVKFSDLYEMKEELGRGAFSIVKRCVQKASNLEFAAKIINTKRLSSRDMQKLEREARICRLLKHPNIVRLHDSIQDDGFHYLVFDLVTGGELFEDIVAREFYSEADASNCMQQILESVNYCHQNNIIHRDLKPENLLLSSKSKNARVKLADFGLAVEMKENEEASWLGFAGTPGYLSPEVLRKDPYGKPVDVWACGVILYILLVGYPPFWDEDQNRLYAQIKSGLFDYPSPEWDTVTAEAKNLINQMLTVNPTKRITAAEALKHPWIYQREHIASMVHRQQTVDCLKKFN-ARRKLKGAILTT 306          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 248.825 bits (634), Expect = 3.563e-79
Identity = 122/275 (44.36%), Postives = 180/275 (65.45%), Query Frame = 1
Query:  274 IKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEIL---LGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL-EETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL-CNRPEQNQETDIS 1080
            +K+E+ VL KL H NI++L +V ES    ++V+E V+GGELFDRIV +G Y+EKDAS  +R++L+A  Y+HE  ++HRDLKPENLLY S  ++S + ++DFG++K+ + D    T CGTPGY APE+L    G SYGK VD W++GVI YILLCGY PFY+E D ++F+ I +  Y F SP+WD +S +AKD I  L+  +P KR +  ++L H W+    A   ++ E    ++K+   + R+ K +    T +  + RL  N+   + E+ IS
Sbjct:   67 LKNEISVLRKLKHENIVQLLDVLESDDTYYLVMELVTGGELFDRIVEKGSYTEKDASNLIRQVLEATDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAIS 341          
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Match: SMESG000029689.1 (SMESG000029689.1)

HSP 1 Score: 238.424 bits (607), Expect = 1.483e-73
Identity = 123/295 (41.69%), Postives = 194/295 (65.76%), Query Frame = 1
Query:  154 YEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI-SKKVNKK---LIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE-SNLKLADFGIA-KILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWV--KGEGAKTSSLEETQNKLKEFNSSRRKLKASIFVT 1014
            Y+I  ++G G+   V  CV+K T ++FAAK+I +KK+N +    ++ E  +   L HPNI+RL++  +     +M+ + ++GGELF+ IV+R FYSE DAS C++++L++V+Y H ++I+HRDLKPENL+  S+ + + +KLADFG+A ++  D +      GTPGY +PE+L    YGK VD+W+ GVI YILL GY PF++E  ++++  I  G + + SP WD V+  AK +I+ +L ++  KR++A  AL H W+  +   A     +ET + LK+FN +RRKLK +I  T
Sbjct:   13 YDIKEELGRGAFSIVRRCVQKSTSLEFAAKIINTKKLNARDMQKLEREARICRLLKHPNIVRLHDNIQDEGFHYMIFDLITGGELFEDIVAREFYSEADASNCMQQILESVNYCHMHNIVHRDLKPENLILASKTKGAAVKLADFGLAIEVQADALSWYGFAGTPGYLSPEVLRKDPYGKLVDVWACGVILYILLVGYPPFWDEDQSKLYSQIKSGAFDYPSPEWDTVTSEAKHLINSMLQINTSKRISAADALRHPWICQRERVASAFHRQETVDCLKKFN-ARRKLKGAILTT 306          
The following BLAST results are available for this feature:
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK46.453e-12354.72calcium/calmodulin dependent protein kinase IV [So... [more]
CAMK46.453e-12354.72calcium/calmodulin dependent protein kinase IV [So... [more]
CAMK1D3.866e-9146.08calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK1D1.282e-9046.08calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK12.457e-8943.83calcium/calmodulin dependent protein kinase I [Sou... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-11.347e-8643.59Calcium/calmodulin-dependent protein kinase type 1... [more]
unc-431.702e-8041.05Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.702e-8041.05Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.702e-8041.05Calcium/calmodulin-dependent protein kinase type I... [more]
unc-437.375e-8043.05Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI3.468e-9144.44gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI3.934e-8742.42gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI3.934e-8742.42gene:FBgn0016126 transcript:FBtr0089065[more]
CaMKI3.934e-8742.42gene:FBgn0016126 transcript:FBtr0089069[more]
CaMKII5.961e-7943.14gene:FBgn0264607 transcript:FBtr0333673[more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.11.450e-12648.48si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-15... [more]
camk43.109e-12652.40calcium/calmodulin-dependent protein kinase IV [So... [more]
camk43.109e-12652.40calcium/calmodulin-dependent protein kinase IV [So... [more]
BX571983.27.525e-9654.10pep chromosome:GRCz11:CHR_ALT_CTG11_1_7:14705740:1... [more]
camk1a4.589e-9242.86calcium/calmodulin-dependent protein kinase Ia [So... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf22.691e-12852.68forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf26.600e-12853.66forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf21.478e-12753.66forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf21.478e-12753.66forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf22.351e-12753.66forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk42.765e-12455.05calcium/calmodulin-dependent protein kinase IV [So... [more]
Camk42.765e-12455.05calcium/calmodulin-dependent protein kinase IV [So... [more]
Camk42.765e-12455.05calcium/calmodulin-dependent protein kinase IV [So... [more]
Camk1d8.726e-9245.45calcium/calmodulin-dependent protein kinase ID [So... [more]
Pnck6.905e-9143.08pregnancy upregulated non-ubiquitously expressed C... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13234|KCC4_RAT1.196e-12455.37Calcium/calmodulin-dependent protein kinase type I... [more]
sp|P08414|KCC4_MOUSE4.002e-12355.05Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q16566|KCC4_HUMAN3.099e-12254.72Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q8BW96|KCC1D_MOUSE6.104e-9145.45Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|O70150|KCC1B_RAT4.106e-9043.08Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGV59.919e-13958.86Protein kinase domain-containing protein OS=Macros... [more]
A0A1S3I0261.703e-13057.74calcium/calmodulin-dependent protein kinase type I... [more]
A0A1I8GDJ91.827e-12656.01Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8J5Y52.141e-12652.98Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8GVX72.268e-12656.52Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.12.399e-12851.04calcium/calmodulin-dependent protein kinase type I... [more]
camk47.581e-12454.40calcium/calmodulin dependent protein kinase IV [So... [more]
si:ch73-60h1.16.065e-12152.90calcium/calmodulin-dependent protein kinase type I... [more]
camk1db5.422e-9344.92calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db7.214e-9145.89calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008748.14.754e-7841.47pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000003135.13.952e-7345.49pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000010548.13.442e-6744.29pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
camk2a1.018e-6246.76calcium/calmodulin-dependent protein kinase II alp... [more]
RPS6KA31.513e-6140.15ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK21.080e-6336.87Calmodulin-dependent protein kinase; may play a ro... [more]
CMK12.886e-6140.07Calmodulin-dependent protein kinase; may play a ro... [more]
SNF18.154e-5541.06AMP-activated S/T protein kinase; forms a complex ... [more]
RAD532.738e-5437.45DNA damage response protein kinase; required for c... [more]
DUN16.760e-5334.68Cell-cycle checkpoint S/T protein kinase; required... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422765.035e-12553.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362534.208e-8243.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498986.809e-8039.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305371.041e-7541.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424321.262e-7447.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.14.164e-12651.20calcium/calmodulin-dependent protein kinase type I... [more]
camk1gb4.201e-9141.01calcium/calmodulin-dependent protein kinase type 1... [more]
camk1da5.431e-9045.21calcium/calmodulin dependent protein kinase ID [So... [more]
camk1db8.486e-9045.21calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b9.945e-8945.33calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of calcium/calmodulin-dependent protein kinase type IV vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042100.10.000e+0100.00SMESG000042100.1[more]
SMESG000008997.11.945e-8041.59SMESG000008997.1[more]
SMESG000008997.13.602e-8042.57SMESG000008997.1[more]
SMESG000078937.13.563e-7944.36SMESG000078937.1[more]
SMESG000029689.11.483e-7341.69SMESG000029689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011699 ID=SMED30011699|Name=calcium/calmodulin-dependent protein kinase type IV|organism=Schmidtea mediterranea sexual|type=transcript|length=1254bp
ATTTATTTAAAATTTTCATTAATAATTTTATTTGTAAGTTAAACCAAAAT
TTTCGTTTTTTGAAATATTTTAATTAATTTCTCTATTTTCTCATTTGAAA
TGGAAGAATACTGGATTAAAGATAGCATAAAAAATGAACCATTTGAGAAA
TATTACGAGATTTTAAATAAAATTGGAAATGGATCGACATGCACCGTTTA
TTGTTGCGTTAGAAAGCGAACTGACATTAAATTTGCTGCAAAAGTCATTT
CTAAAAAGGTCAACAAAAAATTAATTAAAAGTGAAGTTGGCGTTTTGCTA
AAGTTGACTCATCCAAACATTATACGGTTATATGAAGTTTATGAGTCCGC
TACTGATGTACATATGGTTCTGGAGTACGTTTCTGGAGGAGAGTTATTTG
ACAGGATTGTGTCAAGGGGATTCTACAGTGAGAAAGACGCTTCTCGATGT
GTAAGAGAAATGCTTCAAGCTGTTAGTTATCTGCATGAAAATGACATAAT
TCACAGAGATCTCAAACCGGAAAATCTGCTATACGAAAGTCAAGAAGAAT
CAAATTTAAAATTAGCCGATTTTGGGATTGCAAAGATTTTAGAAGATGAT
GTTCATACTATGACAGTTTGTGGAACTCCTGGCTATTGTGCTCCGGAAAT
CTTGTTAGGGGTTTCATATGGGAAGCCTGTTGATTTATGGAGCATCGGAG
TTATTACTTATATTCTGTTATGCGGTTATGAACCGTTCTACAATGAGAAA
GACAACCAAATGTTCAAAAATATCATTAAAGGAATATATTCATTTTCATC
TCCGTGGTGGGACAATGTTAGTCTGAATGCTAAAGATATCATTAGCAAAT
TATTAGTAGTTGATCCTCACAAGCGTTTGACAGCCAATCAAGCTCTCAAT
CATGTATGGGTTAAGGGTGAAGGGGCTAAAACAAGTTCTCTTGAAGAAAC
ACAGAATAAACTAAAGGAATTTAATAGTTCTAGAAGAAAGTTGAAAGCTT
CAATCTTTGTTACAACCGCAATTGAGCACATGATGCGATTATGCAATAGA
CCGGAACAAAATCAAGAAACTGATATTTCTGGAATCTGTTCTATTAATTC
ATCCGCTACATTTACGGAAGGAATGAATCATGAAATGCTAGATTTGACGG
AACAAATAAGTTGAAGAAATTTTCATTTTACTTAGATATGTTTAAGTTTA
ACTAATCAGTAGAATGTCTATTTTTTATAATTATAATTGTGAGGTGTTTT
AAAT
back to top

protein sequence of SMED30011699-orf-1

>SMED30011699-orf-1 ID=SMED30011699-orf-1|Name=SMED30011699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MEEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVI
SKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELF
DRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEE
SNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIG
VITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISK
LLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKA
SIFVTTAIEHMMRLCNRPEQNQETDISGICSINSSATFTEGMNHEMLDLT
EQIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004683calmodulin-dependent protein kinase activity
GO:0005516calmodulin binding
GO:0009931calcium-dependent protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0002250adaptive immune response
GO:0002376immune system process
GO:0006954inflammatory response
GO:0007616long-term memory
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0035556intracellular signal transduction
GO:0043011myeloid dendritic cell differentiation
GO:0045893positive regulation of transcription, DNA-templated
GO:0046777protein autophosphorylation
Vocabulary: cellular component
TermDefinition
GO:0001650fibrillar center
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 281..301
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 9..267
e-value: 1.3E-26
score: 90.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 96..331
e-value: 2.3E-67
score: 228.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 7..93
e-value: 2.3E-25
score: 90.4
NoneNo IPR availablePANTHERPTHR24349SERINE/THREONINE-PROTEIN KINASEcoord: 2..305
NoneNo IPR availablePANTHERPTHR24349:SF338CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE IVcoord: 2..305
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 19..271
e-value: 8.5E-108
score: 374.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 19..271
e-value: 2.7E-78
score: 263.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 19..271
score: 49.714
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 133..145
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 12..287