Alpha-galactosidase

Overview
NameAlpha-galactosidase
Smed IDSMED30011695
Length (bp)1516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-galactosidase (SMED30011695) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-galactosidase (SMED30011695) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011695

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011695SMESG000009913.1 SMESG000009912.1 Contig169GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011695SMESG000009912.1 dd_Smed_v4_606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011695SMESG000009912.1 dd_Smed_v4_606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30011695SMESG000009912.1 dd_Smed_v4_606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011695SMESG000009912.1 dd_Smed_v4_606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30011695SMESG000009912.1 dd_Smed_v4_606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011695SMESG000009912.1 dd_Smed_v6_606_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 337.806 bits (865), Expect = 2.147e-111
Identity = 175/396 (44.19%), Postives = 239/396 (60.35%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            ++L   ++   LDNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPL MS DLR IS++++++L N  ++ INQD LG QG  +  E+  ++V+ R LS   + +   +    +   Y  +L    F+    Y  +D +S   ++   L    NF    NP+ + M
Sbjct:    7 LLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYS--GDIISGLRDETNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 337.806 bits (865), Expect = 2.147e-111
Identity = 175/396 (44.19%), Postives = 239/396 (60.35%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            ++L   ++   LDNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPL MS DLR IS++++++L N  ++ INQD LG QG  +  E+  ++V+ R LS   + +   +    +   Y  +L    F+    Y  +D +S   ++   L    NF    NP+ + M
Sbjct:    7 LLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYS--GDIISGLRDETNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: NAGA (alpha-N-acetylgalactosaminidase [Source:HGNC Symbol;Acc:HGNC:7631])

HSP 1 Score: 337.806 bits (865), Expect = 2.147e-111
Identity = 175/396 (44.19%), Postives = 239/396 (60.35%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            ++L   ++   LDNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPL MS DLR IS++++++L N  ++ INQD LG QG  +  E+  ++V+ R LS   + +   +    +   Y  +L    F+    Y  +D +S   ++   L    NF    NP+ + M
Sbjct:    7 LLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYS--GDIISGLRDETNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: GLA (galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4296])

HSP 1 Score: 333.954 bits (855), Expect = 1.193e-109
Identity = 173/389 (44.47%), Postives = 227/389 (58.35%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNP-STQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLK----DFGFSIVKKYIVKDAFSMKSNMTV-DLTTSINFHSNPTSIDMIVVD 1381
            LDNGL+RTP MGW+ WERF C  DC + P  CISE L +  A  M   G+  AGYEY+ IDDCW+   R  +G L  DP RFP+G+  L+  +HS GLK GIY D G KTC G+PGS  +   D  TF  W VD +K DGCY +       GY   S  LN T R IV+SC WP Y       P+ T++ Q  CN WR + DIDDSW S+  I+++   N  +    A PG WNDPDML+IGN GL++NQQ  QM +WAI AAPLFMSNDLR+IS ++  LL +K+++AINQD LGKQGY L + D  +VW R LS     VA++N         +T+       G +      +     +K  +   + T+ +  H NPT   ++ ++
Sbjct:   32 LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ-KPNYTEIRQ-YCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLE 418          
BLAST of Alpha-galactosidase vs. Ensembl Human
Match: GLA (galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4296])

HSP 1 Score: 313.538 bits (802), Expect = 3.450e-101
Identity = 173/430 (40.23%), Postives = 227/430 (52.79%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECIS-----------------------------------------ENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNP-STQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLK----DFGFSIVKKYIVKDAFSMKSNMTV-DLTTSINFHSNPTSIDMIVVD 1381
            LDNGL+RTP MGW+ WERF C  DC + P  CIS                                         E L +  A  M   G+  AGYEY+ IDDCW+   R  +G L  DP RFP+G+  L+  +HS GLK GIY D G KTC G+PGS  +   D  TF  W VD +K DGCY +       GY   S  LN T R IV+SC WP Y       P+ T++ Q  CN WR + DIDDSW S+  I+++   N  +    A PG WNDPDML+IGN GL++NQQ  QM +WAI AAPLFMSNDLR+IS ++  LL +K+++AINQD LGKQGY L + D  +VW R LS     VA++N         +T+       G +      +     +K  +   + T+ +  H NPT   ++ ++
Sbjct:   32 LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISWSFALVAQAGVQCHDLGSPQPPPPRFKQFSCLILASSWNYSEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ-KPNYTEIRQY-CNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLE 459          
BLAST of Alpha-galactosidase vs. Ensembl Celegans
Match: gana-1 (Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q21801])

HSP 1 Score: 293.123 bits (749), Expect = 6.304e-94
Identity = 162/374 (43.32%), Postives = 212/374 (56.68%), Query Frame = 2
Query:  203 VLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT--KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRT-----VVAVLNVG--NAIKDVYFTLKDFGFSIVKKYIVKDAFS 1297
            +LF    + CLDNGL RTPPMGWM+W  F C  DCVK+P+ CI+E L    A  +   G+   GY+ + IDDCW    R   G L+ +  RFP+GM  L+  +H  GLKFGIYEDYGTKTCGGYPGS  H K D  TF  W+VDY+KLDGC  + +  P GY  +   LN T RPI++SCSWPAY       P L    L+   CN WR +DDI+ SW S++ II+Y+    +K      PG W+DPDML+IGN G+  +    Q  +W I++APL MSNDLR I     ++L NK  + INQD LG  G  +     + V+ + ++ S+        A LN       K +   L   G +    Y V D +S
Sbjct:    7 LLFCVGAF-CLDNGLGRTPPMGWMSWTAFYCEIDCVKHPTGCINEQLYKDMADQLVSGGYDKVGYKSVHIDDCWSEMERDSHGILVANKTRFPSGMKALAKYMHDRGLKFGIYEDYGTKTCGGYPGSYKHEKVDAQTFAAWDVDYLKLDGCNIDQAMMPIGYPLFEKELNETGRPIMYSCSWPAYLIDH---PELVNYNLIGKYCNTWRNFDDINSSWKSIISIISYYDKMQDKHIPTHGPGKWHDPDMLVIGNKGITLDMSISQFTVWCIWSAPLIMSNDLRIIGDSFKDVLKNKEAIKINQDPLGIMGRLIKNSTDIGVYVKQITPSKGDKKSFAFAYLNRNEKEGYKRIEIQLASIGLTDPAGYYVHDIWS 376          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG7997 (gene:FBgn0034117 transcript:FBtr0087172)

HSP 1 Score: 372.859 bits (956), Expect = 2.030e-125
Identity = 179/372 (48.12%), Postives = 240/372 (64.52%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKD-GSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDL---------SRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTV 1318
            LDNGL+  PPMGWM+WERFRC TDC  YP ECISE L    A  +   G++ AGYEY++IDDCWL K+R  D   L+PD  RFPNG+  LS  IH+ GLKFG+Y+DYGT TC GYPG + H+K D  TF  W+VDY+KLDGCY+N S    GY E+   LN T RP+V+SCSWPAY +     P    L Q  CNLWR +DDI+DS  S++ II+Y   N ++      PGHWNDPDML++GN GL+Y+Q ++QM +WAI AAPL MSNDL  +  +   +L N+ ++A++QD LG QG  +  R+ ++VW+R +         S +   V+  + G   + + FT+K+ G +  K Y V+D +   S + V
Sbjct:   24 LDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKLFQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQGLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFGRLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQ-HCNLWRNWDDIEDSLESLMQIIDYFAKNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEIKAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGAPYR-IPFTVKELGLTNPKGYNVQDLYDASSKLGV 393          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG7997 (gene:FBgn0034117 transcript:FBtr0087171)

HSP 1 Score: 372.859 bits (956), Expect = 2.030e-125
Identity = 179/372 (48.12%), Postives = 240/372 (64.52%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKD-GSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDL---------SRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTV 1318
            LDNGL+  PPMGWM+WERFRC TDC  YP ECISE L    A  +   G++ AGYEY++IDDCWL K+R  D   L+PD  RFPNG+  LS  IH+ GLKFG+Y+DYGT TC GYPG + H+K D  TF  W+VDY+KLDGCY+N S    GY E+   LN T RP+V+SCSWPAY +     P    L Q  CNLWR +DDI+DS  S++ II+Y   N ++      PGHWNDPDML++GN GL+Y+Q ++QM +WAI AAPL MSNDL  +  +   +L N+ ++A++QD LG QG  +  R+ ++VW+R +         S +   V+  + G   + + FT+K+ G +  K Y V+D +   S + V
Sbjct:   24 LDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKLFQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQGLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFGRLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQ-HCNLWRNWDDIEDSLESLMQIIDYFAKNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEIKAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGAPYR-IPFTVKELGLTNPKGYNVQDLYDASSKLGV 393          
BLAST of Alpha-galactosidase vs. Ensembl Fly
Match: CG5731 (gene:FBgn0032192 transcript:FBtr0079959)

HSP 1 Score: 369.777 bits (948), Expect = 3.789e-124
Identity = 180/398 (45.23%), Postives = 243/398 (61.06%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSR-----SRTVVAVLN--VGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMI 1372
            ++L +++   CLDNGL++TPPMGW++WERFRC TDCV  P  CISE L  +    +  +G++S GYEYI IDDCWL K R+ DG L+ D  RFPNG+  LS  IHS GLKFGIYEDYG  TC GYPG + + ++D   F  W VDY+KLDGCY+ P     GY+ +   LN T + +V+SCSWP Y     I P+ +  +Q+ CNLWR YDDI DSW SV  II+Y+  N +  +  A PGHWNDPDMLIIGN GL+Y Q + Q  +W+I AAPL MS DLR I  +   +L N+ I+A++QD LG QG  +++   +++W R +           +A +N        D+  TLK+ G      Y V+D +       +   T I    NP+ + M+
Sbjct:    7 IILLSSTFGKCLDNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVADGYASVGYEYINIDDCWLEKHRSHDGKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCAGYPGIIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYSCSWPVYQIYAGIQPNYSA-IQTHCNLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIGNFGLSYEQAKTQFAIWSILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHKGIEIWSRPIGPLYQNFYSYAIAFVNRRTDGTPSDISVTLKELGLINFSGYRVEDLYENVDYGVLYPNTKIKVKVNPSGVVML 403          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 355.525 bits (911), Expect = 3.167e-118
Identity = 187/394 (47.46%), Postives = 240/394 (60.91%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            + L  +S    LDNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPLFMSNDLR ISS +  +L NK +++INQD LG QG  L  E+  +QV++R LS+  + +   +  + +   Y T LK  G+     + V D FS +    +  +T      NP+ + M
Sbjct:    7 LFLAFSSAALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASALVFFSRRSDMPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 355.525 bits (911), Expect = 3.167e-118
Identity = 187/394 (47.46%), Postives = 240/394 (60.91%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            + L  +S    LDNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPLFMSNDLR ISS +  +L NK +++INQD LG QG  L  E+  +QV++R LS+  + +   +  + +   Y T LK  G+     + V D FS +    +  +T      NP+ + M
Sbjct:    7 LFLAFSSAALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASALVFFSRRSDMPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 345.895 bits (886), Expect = 8.624e-115
Identity = 180/377 (47.75%), Postives = 231/377 (61.27%), Query Frame = 2
Query:  251 RTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++   N +     AAPG WNDPDMLIIG+  L+ +Q R QM +W+I AAPLFMSNDLR ISS +  +L NK +++INQD LG QG  L  E+  +QV++R LS+  + +   +  + +   Y T LK  G+     + V D FS +    +  +T      NP+ + M
Sbjct:    2 RTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIGDFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKSGIQVFQRPLSKGASALVFFSRRSDMPYRYTTSLKTLGYQ-PGVFEVFDVFSEQRLPELKDSTQFTVSINPSGVVM 375          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: gla (galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041010-207])

HSP 1 Score: 332.413 bits (851), Expect = 1.574e-109
Identity = 174/391 (44.50%), Postives = 228/391 (58.31%), Query Frame = 2
Query:  227 SCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQ-PQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-----LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVVD 1381
            + LDNGL+ TP MGW+ WERF C TDC   P  CI E L +  A  M   G+  AGYE++ IDDCW ++ R   G L  DP RFP+G+  L+  +HS GLK GIY D GTKTC GYPGSL +   D  TF  W VD +K DGC+     Q  +GY   S  LN T R IV+SC WP Y + ++  P   + ++ +CN WR Y D+ D WTSV  I+++           A PG WNDPDMLIIGN GL+ +QQ+ QM +WAI AAPL MSNDLR+I  K+ ELL NK I+AINQD LGKQGY + + D+ ++W R LS +R  VAV+N         FT     +  +     K  + +   + K     +L + +    NPT   ++ V+
Sbjct:   19 AALDNGLALTPTMGWLHWERFMCNTDCDADPQNCIREELFMQMADVMVKEGWKDAGYEFVCIDDCWPSQQRDAQGRLQADPKRFPSGIKKLADYVHSKGLKLGIYADVGTKTCAGYPGSLGYYDIDAKTFADWGVDLLKFDGCFMPDWHQLGEGYINMSSALNQTGRSIVYSCEWPLY-EWQHQQPDY-EAIRKTCNHWRNYGDVYDQWTSVKSILDWTAEKQKIVVPVAGPGGWNDPDMLIIGNFGLSRDQQQTQMALWAIMAAPLLMSNDLRDICPKAKELLQNKQIIAINQDPLGKQGYRILKADSFELWERPLSGNRLAVAVMNRQEIGGPRRFTISVAIMPSWKLCNPKCNVTQIMPTYKEMGVQNLLSEVVVQVNPTGTTLLTVN 407          
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 243.047 bits (619), Expect = 3.604e-77
Identity = 120/228 (52.63%), Postives = 145/228 (63.60%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINY 877
            + L  +S    LDNGL RTPPMGW+ WERFRC  DC   P  CISE L +  A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+ +L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN S Q QGY   S  LN T RPI +SCSWPAY     + P +   LL   CNLWR YDDI DSW SV+GI+++
Sbjct:    7 LFLAFSSAALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSEDGWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGGYPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAY--QGGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDW 232          
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Match: naga (N-acetylgalactosaminidase, alpha- [Source:NCBI gene;Acc:779501])

HSP 1 Score: 358.607 bits (919), Expect = 1.332e-119
Identity = 184/385 (47.79%), Postives = 236/385 (61.30%), Query Frame = 2
Query:  230 CLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVG-NAIKDVYFTLKDFGFSIVKK----YIVKDAFSMKSNMTVDLTTSINFHSNPTSI 1363
            CLDNGL RTPPMGWMTW+R+RC  DC   P  CI ENLI S A  M  +G+   GY Y+ IDDCW  K R  +G L PDP RFP+GM  L+  +H+ GLK GIY D G  TCGGYPG +L+ IK D  TF  WEVD +K DGCYSN + +  GY + S  LN T RPI++SCSWPAY     + P +    L S CN+WR Y DI DSW SVL II ++  N +     A PG WNDPDMLI G+ GL+Y Q + Q+ +WAI AAP  MSNDLR IS  + +LL N+ ++ INQD++GKQG  +    +++VW+R+L   +  VAVLN G + +   Y T    G   V +    Y + + F  +       +T I+   NPT +
Sbjct:   18 CLDNGLVRTPPMGWMTWQRYRCNIDCKSDPDNCIGENLIKSMADKMADSGWRDLGYVYVCIDDCWSRKQRDSNGRLEPDPERFPSGMKALADYVHAKGLKLGIYSDMGNYTCGGYPGTTLDTIKIDADTFASWEVDMLKFDGCYSNSTEKALGYPKMSEALNATGRPILYSCSWPAY--EGGLPPKVNYTQLGSICNMWRNYGDIQDSWDSVLDIIEWYAKNQDVLQPAAGPGRWNDPDMLITGDFGLSYEQSKSQLAIWAILAAPFIMSNDLRTISQDAKDLLQNRLLIYINQDSMGKQGNLILRFGSLEVWKRELMNGQYAVAVLNKGTDGLPKPYST--SLGLLNVTQCTDGYKLYNVFEKEYLGIFKSSTGIDMRVNPTGV 398          
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Match: gla (galactosidase alpha [Source:NCBI gene;Acc:100145767])

HSP 1 Score: 317.775 bits (813), Expect = 8.937e-104
Identity = 157/326 (48.16%), Postives = 200/326 (61.35%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLN 1207
            L NGL+ TPPMGW+ WERF C T+C + P  CISE L +  A  M   G+  AGY+Y+ IDDCWL   R +   L  DP+RFP G+  L+  +HS GL  GIYED G+KTC G+PGS  +   D  TF +W VD +K DGCY     + + GY + S  LN T R IV SC WP Y   R I       +   CN WR + DI DSW SV  +++       +    A PG WNDPDML+IGN GL++NQQ  QM +W+I AAPL MSNDLR+I ++S  LL +KN+++INQD LG QGY +F+ D  +VW R L +    VAV N
Sbjct:   22 LQNGLALTPPMGWLHWERFLCETNCERNPKNCISEQLFMDMADKMVSEGWLDAGYQYLCIDDCWLAPERDEKNRLQADPVRFPGGIKKLADYVHSRGLLLGIYEDVGSKTCEGFPGSQGYYDIDAQTFAEWGVDLLKFDGCYYGTLDKLEDGYRQMSMALNRTGRKIVLSCEWPLY--ERGIKKINYSEVAEYCNSWRNFGDITDSWGSVKAVMDLSSAVQEEIVPVAGPGSWNDPDMLVIGNFGLSWNQQVTQMALWSIMAAPLMMSNDLRDIPAESKALLQDKNVISINQDPLGAQGYRVFKADYFEVWERPLIKGSLAVAVTN 345          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 328.946 bits (842), Expect = 4.467e-108
Identity = 167/385 (43.38%), Postives = 237/385 (61.56%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIK-DVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            L+NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDML+IGN GL++++ R QM +W + AAPL MS DLR IS +++++L N  ++ INQD LG QG   L  +  ++V++R LS   + +   +    +    + +L +  +   + Y  ++ F+   ++   L T +NF    NP+ + M
Sbjct:   18 LENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVFFSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFT--GDIFSGLQTEVNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Gla (galactosidase, alpha [Source:MGI Symbol;Acc:MGI:1347344])

HSP 1 Score: 322.398 bits (825), Expect = 1.669e-105
Identity = 160/338 (47.34%), Postives = 210/338 (62.13%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNV 1210
            +V ++      LDNGL+RTP MGW+ WERF C  DC + P  CISE L +  A  M  +G+  AGY+Y+ IDDCW+   R   G L  DP RFP+G+ +L+  +HS GLK GIY D G KTC G+PGS      D  TF  W VD +K DGC+ +     + GY   +  LN T R IV+SC WP Y    +  P+ T  +Q  CN WR +DD+ DSW S+  I+++  +   +    A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPL MSNDLR ISS++  LL NK+++AINQD LGKQGY   + + ++VW R LS     VAV N+
Sbjct:   21 LVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQEEPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVVSLENGYKYMALALNRTGRSIVYSCEWPLYLRPFH-KPNYTD-IQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRNL 356          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Gla (galactosidase, alpha [Source:MGI Symbol;Acc:MGI:1347344])

HSP 1 Score: 322.398 bits (825), Expect = 1.958e-105
Identity = 160/338 (47.34%), Postives = 210/338 (62.13%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNV 1210
            +V ++      LDNGL+RTP MGW+ WERF C  DC + P  CISE L +  A  M  +G+  AGY+Y+ IDDCW+   R   G L  DP RFP+G+ +L+  +HS GLK GIY D G KTC G+PGS      D  TF  W VD +K DGC+ +     + GY   +  LN T R IV+SC WP Y    +  P+ T  +Q  CN WR +DD+ DSW S+  I+++  +   +    A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPL MSNDLR ISS++  LL NK+++AINQD LGKQGY   + + ++VW R LS     VAV N+
Sbjct:   23 LVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQEEPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVVSLENGYKYMALALNRTGRSIVYSCEWPLYLRPFH-KPNYTD-IQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRNL 358          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 253.832 bits (647), Expect = 2.237e-81
Identity = 121/239 (50.63%), Postives = 155/239 (64.85%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDM 943
            L+NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG +L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDM
Sbjct:    2 LENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDM 237          
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Match: Naga (N-acetyl galactosaminidase, alpha [Source:MGI Symbol;Acc:MGI:1261422])

HSP 1 Score: 254.988 bits (650), Expect = 3.486e-81
Identity = 121/240 (50.42%), Postives = 156/240 (65.00%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDML 946
            L+NGL RTPPMGW+ WERFRC  DCV+ P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG +L+ ++ D  TF +W+VD +KLDGC+S+   + +GY + +  LN T RPI FSCSWPAY     + P +    +   CNLWR Y DI DSW SVL I+++   + +     A PGHWNDPDM+
Sbjct:   18 LENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMV 254          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q90744|NAGAB_CHICK (Alpha-N-acetylgalactosaminidase OS=Gallus gallus OX=9031 GN=NAGA PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 9.600e-118
Identity = 181/385 (47.01%), Postives = 241/385 (62.60%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDT-VQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            L+NGL+RTPPMGW+ WERFRC  +C + P +CISE L +  A  +  +G+   GY+YI IDDCW  K R  +G L+PDP RFP G+  L+  +H+ GLK  IY D G  TCGGYPG +L+ ++QD  TF +W VD +KLDGCYS+   Q QGY + +  LN T RPIV+SCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+++   N +    +A PGHWNDPDMLIIGN GL+Y Q R QM +W I AAPL MS DLR IS  + ++L N+ ++ INQD LG QG  + +  + ++V+ R LS++ + +   +    +   Y T L   GF +   Y V+D +S K  +   L T  NF    NP+ + M
Sbjct:    1 LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLDIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNSTGRPIVYSCSWPAYQG--GLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGK--IISGLKTGDNFTVIINPSGVVM 381          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|P17050|NAGAB_HUMAN (Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX=9606 GN=NAGA PE=1 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 1.031e-110
Identity = 175/396 (44.19%), Postives = 239/396 (60.35%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHS--NPTSIDM 1369
            ++L   ++   LDNGL +TPPMGW+ WERFRC  +C + P  CISE L +  A  M  +G+   GY Y+ IDDCW+   R   G L+PDP RFP+G+ +L+  +HSLGLK GIY D G  TC GYPG+ L+ + QD  TF +W+VD +KLDGC+S P  + QGY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR YDDI DSW SVL I+N+   + +     A PGHWNDPDML+IGN GL+  Q R QM +W + AAPL MS DLR IS++++++L N  ++ INQD LG QG  +  E+  ++V+ R LS   + +   +    +   Y  +L    F+    Y  +D +S   ++   L    NF    NP+ + M
Sbjct:    7 LLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIG-GRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAY--EGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYS--GDIISGLRDETNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q58DH9|NAGAB_BOVIN (Alpha-N-acetylgalactosaminidase OS=Bos taurus OX=9913 GN=NAGA PE=2 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.083e-110
Identity = 170/389 (43.70%), Postives = 236/389 (60.67%), Query Frame = 2
Query:  215 TSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
             S+   L+NGL R PPMGW+ WERFRC  DC + P  CISE L +  A  +  +G+   GY Y+ IDDCW+    AK G+L+PD  RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ + QD  TF +W+VD +KLDGCYS P  + +GY + +  LN T RPI FSCSWPAY     + P +   LL   CNLWR +DDI DSW SVL ++++   + +     A PGHWNDPDML+IGN GL++ Q + QM +W + AAPLFMS DLR IS++++++L N  ++ INQD LG QG   L E+  ++V+ R L+   + +   +    +   Y  +L    FS    Y  +D ++      +   T+     NP+ + M
Sbjct:   12 ASQVLVLENGLLRKPPMGWLAWERFRCNIDCSEDPKNCISEQLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDAK-GNLVPDRKRFPHGIAFLADYAHSLGLKLGIYEDLGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCYSTPQERAEGYPKMAAALNATGRPIAFSCSWPAYEG--GLPPKVNYTLLADICNLWRNFDDIQDSWRSVLSVLDWFVTHQDVLQPIAGPGHWNDPDMLLIGNFGLSFEQAQAQMALWTVLAAPLFMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRILKEKSHIEVYLRPLASEASAIVFFSRRMDMPYHYHSSLARLNFSSSVVYEAQDVYTGDIISGLQDKTNFTVIINPSGVVM 397          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|Q66H12|NAGAB_RAT (Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus OX=10116 GN=Naga PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 4.241e-110
Identity = 158/327 (48.32%), Postives = 218/327 (66.67%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGS-LNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFE-RDTVQVWRRDLSRSRTVVAVLN 1207
            L+NGL RTPPMGW+ WERFRC  +C + P  CISE L +  A  +  +G+   GY Y+ IDDCW+   R   G LIPDP RFP+G+ +L+   HSLGLK GIYED G  TC GYPG+ L+ ++ D ATF +W+VD +KLDGCYS P  + +GY + +  LN T RPI FSCSWPAY        + T++   +CNLWR Y DI DSW SVL I+++   + +     + PGHWNDPDML+IGN GL++++ R QM +W + AAPLFMS DLR IS +++++L N  ++ INQD LG QG  +F+ +  ++V++R+LS   + +   +
Sbjct:   18 LENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIG-GRDATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAATFAEWKVDMLKLDGCYSTPKERAEGYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEV-AGTCNLWRNYKDIQDSWKSVLSILDWFVKHQDILQPVSGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLFMSTDLRTISPQNIDILQNPLLIKINQDPLGIQGRLIFKSKSHIEVFKRNLSDDASALVFFS 342          
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Match: sp|P06280|AGAL_HUMAN (Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 5.730e-109
Identity = 173/389 (44.47%), Postives = 227/389 (58.35%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNP-STQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLK----DFGFSIVKKYIVKDAFSMKSNMTV-DLTTSINFHSNPTSIDMIVVD 1381
            LDNGL+RTP MGW+ WERF C  DC + P  CISE L +  A  M   G+  AGYEY+ IDDCW+   R  +G L  DP RFP+G+  L+  +HS GLK GIY D G KTC G+PGS  +   D  TF  W VD +K DGCY +       GY   S  LN T R IV+SC WP Y       P+ T++ Q  CN WR + DIDDSW S+  I+++   N  +    A PG WNDPDML+IGN GL++NQQ  QM +WAI AAPLFMSNDLR+IS ++  LL +K+++AINQD LGKQGY L + D  +VW R LS     VA++N         +T+       G +      +     +K  +   + T+ +  H NPT   ++ ++
Sbjct:   32 LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQ-KPNYTEIRQ-YCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLE 418          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: V5GMA3 (Alpha-galactosidase (Fragment) OS=Anoplophora glabripennis OX=217634 GN=NAGAB PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.390e-131
Identity = 180/327 (55.05%), Postives = 238/327 (72.78%), Query Frame = 2
Query:  200 VVLFTTSRY-SCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLS 1177
            ++LF ++ Y   LDNGL+ TPPMGWM W+RFRC TDCV YP ECISE L  + A ++  +G+  AGYEYI+IDDCW +K R  D  L PDP RFPNG+  L+  IH  GLKFGIY DYGTKTC GYPGS++H++ D  TF +W VDY+KLDGCY++ ST  +GYA+  HYLN T RPIV+SCSWPAY +   I  + TKL + +CNLWR +DDIDD+W++V  I+N+   N ++ + ++ PGHWNDPDMLIIGN GL+Y Q + QM +WAI AAPL MS DLR+I  +   +LLNK+I++INQD LG QG  +  ++ + +W + ++
Sbjct:    8 LILFCSTTYVQSLDNGLALTPPMGWMHWQRFRCLTDCVAYPDECISEKLFRTMADHLVCDGYLEAGYEYIIIDDCWASKQRDNDSRLQPDPERFPNGIKALADYIHDKGLKFGIYGDYGTKTCAGYPGSIDHLELDAQTFAEWGVDYLKLDGCYADQSTMEEGYAKMGHYLNATGRPIVYSCSWPAYQEPLGIKSNYTKLAE-TCNLWRNWDDIDDAWSNVTNILNWFSKNQDRLAKFSGPGHWNDPDMLIIGNFGLSYEQSKAQMAIWAIMAAPLIMSVDLRSIEPQFKNILLNKDIISINQDPLGIQGRLVLTKNKIDIWTKPVT 333          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: K1PB46 (Alpha-galactosidase OS=Crassostrea gigas OX=29159 GN=CGI_10011661 PE=3 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 9.669e-131
Identity = 195/395 (49.37%), Postives = 254/395 (64.30%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGN--AIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 1378
            V +        LDNGL  TPPMGW+TWERFRC  DC + P  CISE+LI + A  M  NG+  AGYEY++IDDCWL   R  +G L+PDP RFP+G+  LS  +HS  LKFGIY+D+GTKTCGG+PGS  +++ D  TF  W VDY+K DGC SN    P GY     +LN T R I +SC WP Y  V  +     K ++ +CNLWR Y D+ DSW+SVL I+N+   N   F+ +A PG WNDPDM+I+GN GL+Y ++RVQM MWAI AAPL MSNDLR+I S S  LLLN+N++AINQD LG QG  L +++ +Q+W RDLS +RT VA LN  +    + + F+L D   +    Y   +AF MK+N+ V     +    NP  I++ + 
Sbjct:   35 VAILAVRGLHGLDNGLGLTPPMGWLTWERFRCNMDCDRDPDNCISEHLIKAMADIMAANGYRDAGYEYVIIDDCWLGPERDTNGRLVPDPNRFPSGIKNLSAYVHSKNLKFGIYQDFGTKTCGGFPGSEFYMQTDAETFADWGVDYLKFDGCNSNLYDFPSGYEAMGFFLNKTGRSIFYSCEWPFYKIVSGLQVDFAK-VRKTCNLWRNYYDVQDSWSSVLDIVNFWGSNSKIFTKYAGPGGWNDPDMIILGNFGLSYEEERVQMAMWAILAAPLIMSNDLRHIRSSSKALLLNRNLIAINQDKLGIQGILLQKQNGIQIWSRDLSFNRTAVAFLNENSDGMPRFLSFSLVDLKLT-SSTYNFTEAFDMKTNILVTRQRPLKIKVNPHGINLYIA 427          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: A0A2P8ZLY1 (Alpha-galactosidase OS=Blattella germanica OX=6973 GN=NAGA PE=3 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 5.243e-129
Identity = 182/387 (47.03%), Postives = 249/387 (64.34%), Query Frame = 2
Query:  227 SCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRS-----RTVVAVLN--VGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKS-NMTVDLTTSINFHSNPTSI 1363
            + LDNGL+ TPPMGW+ WERFRC TDC  YP ECISE L    A  M   G+++AGYEY++IDDCWL   R  +G L PDP RFPNG+  L+  +HSLGLKFGIYEDYGT TC GYPG L H++ D  TF +W+VDY+KLDGCY+ P     GY  + +YLN T RP+++SCSWP Y +   I P+  +LL+  CNLWR Y DIDDS+  V  I++Y   N ++ +  A PGHWNDPDMLIIGN GL+++Q + QM +WAI AAPL MS +LR++  ++  +L N  ++A+NQD LG QG  +F  + ++VW R +S          VA++N  +          L + G +    Y+ +D F  ++ + T+   +++    NPT +
Sbjct:   17 AALDNGLALTPPMGWLAWERFRCITDCEGYPDECISEQLFRRTADLMVSEGYAAAGYEYVIIDDCWLAPERDSEGKLQPDPYRFPNGIKALADYVHSLGLKFGIYEDYGTYTCAGYPGVLGHLEVDANTFAEWDVDYVKLDGCYAEPEDMNDGYPAFGNYLNQTGRPMIYSCSWPVYQEQSGIPPNF-ELLKRYCNLWRNYGDIDDSFEDVKSIMDYFAENQDRIAEHAGPGHWNDPDMLIIGNYGLSFDQSKTQMAIWAILAAPLLMSTELRDVKPEAKAILQNAAVIAVNQDVLGIQGRRVFSANEIEVWTRPISPQVGDNYSYAVAIVNRRIDGYPYPTSTLLSNIGLTNPNGYVFEDLFDAEAPSQTLTPDSTLQVRVNPTGV 402          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: A0A433TK94 (Alpha-galactosidase OS=Elysia chlorotica OX=188477 GN=EGW08_010296 PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 9.798e-128
Identity = 187/387 (48.32%), Postives = 246/387 (63.57%), Query Frame = 2
Query:  230 CLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFE-RDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT--LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVVD 1381
             LDNGL+RTPPMGW++WERFRC TDC   P  CISE L   QA  M   G+  AGYEY+ IDDCW    R KDG L+ DP RFP+G+  LS  +HS GLK GIYED+G+KTC GYPGS  +++ D  TF +WEVD +K DGC S+P   P GY   S +LN+T  PI+FSC WP Y  +  +  S  + +  +CN+WR Y D++DSW S++ IIN +  +   FS  A PG +NDPDML++G+ GL+Y QQ+ Q GMWA+FAAPL MSNDL +I + +  LLLNKNI+AINQD LG Q   LFE   ++ VW + L+     + +LNV N      +T    D GF+    Y+ ++AF  K      L      + +PTSI +++ D
Sbjct:   18 ALDNGLARTPPMGWLSWERFRCNTDCKNDPEHCISEQLYKRQADLMVSEGYRDAGYEYVNIDDCWPAMERDKDGRLVADPERFPSGIRALSRYMHSKGLKLGIYEDFGSKTCAGYPGSEFYMQIDANTFAEWEVDSLKFDGCNSDPKDMPYGYPAMSFFLNITGHPIMFSCEWPLYEIMHKLPVSDYRTIAKTCNIWRNYVDVEDSWDSIVDIINMYGKDEGNFSAAAGPGGFNDPDMLVVGDYGLSYYQQKAQFGMWALFAAPLMMSNDLSSIGADAKALLLNKNIIAINQDPLGNQAIRLFEVPGSLSVWVKKLASGGLAIGILNVNNQGTPQKYTTAFSDLGFTNKNGYVAREAFENKLLGKYALDEKFTIYVDPTSIYIMIAD 404          
BLAST of Alpha-galactosidase vs. TrEMBL
Match: E9HCU1 (Alpha-galactosidase OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_309434 PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 2.075e-127
Identity = 189/387 (48.84%), Postives = 250/387 (64.60%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDL-----SRSRTVVAVLN--VGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMI 1372
            L+NGL+RTPPMGW+ WERFRC TDC   P  CISE L +  A  M   G+ SAGY  I +DDCWL+ +R++ G L  D  RFP+G+  L+  +HS GL+FG+YEDYGT TCGGYPG LNH++ D  TF +W VDY+KLDGCY++PS   +GY E+   LNLT RP+V+SCSWP Y   + I P+ T  + + CNLWR +DDIDDSW SV  II+Y+  N +     A PGHWNDPDMLIIGN GL+++Q R QM MWA+ A+PLFMS DLR I  +   +LLNKN++AINQD LG QG  ++++  V++W + +     + S   V  LN         V   L+D G + +  Y V++ F  K+        S+    NP+ + MI
Sbjct:   19 LENGLARTPPMGWLAWERFRCNTDCKNDPENCISEKLFMKMADIMVSEGYLSAGYNIISLDDCWLDHNRSESGQLQADASRFPSGIKALADYVHSKGLQFGMYEDYGTLTCGGYPGILNHLETDAKTFAEWGVDYVKLDGCYADPSEMDKGYPEFGTLLNLTGRPMVYSCSWPDYQLDKGIKPNYT-FIGTVCNLWRNFDDIDDSWVSVSSIIDYYGDNQDTLIPVAGPGHWNDPDMLIIGNFGLSFDQSRAQMAMWAVLASPLFMSVDLRTIRPEMKAILLNKNVIAINQDPLGVQGRRIYKKSGVEIWIKSVEPISGADSSAAVVFLNQRTDGTPTRVSVILRDIGLTSLFGYNVEELFDGKNLGVYRPDDSLTVTVNPSGVVMI 404          
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Match: NAGA (alpha-N-acetylgalactosaminidase-like [Source:NCBI gene;Acc:103035758])

HSP 1 Score: 342.813 bits (878), Expect = 1.118e-113
Identity = 177/381 (46.46%), Postives = 227/381 (59.58%), Query Frame = 2
Query:  236 DNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            DNGL+RTPPMGWM+WERFRC  DC   P  CISE L    A  +  +G+   GYEY++IDDCW   SR   G L+PDP+RFPNG+  L+  +H LGLK GIY D GT TC GYPG +L  I+ D  TF +W+VD +K DGC SN   Q QGY   S  LN T RPIV++CSWP Y     + PS+   LL   CNLWR Y DI+DSW SVL I+++   + +     + PG WNDPDMLIIGN GL+  Q + QM +WAI AAPL MSNDLR +SS++  +L NK ++AINQD LG QG   L +   ++V+ R LS+S + +  L+    +   Y +           Y   D F  +        T      NP+ + M
Sbjct:   19 DNGLARTPPMGWMSWERFRCNIDCRNDPKNCISEALYKDMAERLVEDGWLKLGYEYLIIDDCWSFTSRDSRGRLMPDPVRFPNGIPKLAHYVHQLGLKLGIYADMGTHTCAGYPGTTLEQIQTDAQTFAEWQVDMLKFDGCNSNAEEQQQGYPLMSKALNATGRPIVYACSWPVYRG--GLPPSVNYTLLGEICNLWRNYYDIEDSWDSVLNIVDWFFQSQDYLQPASGPGRWNDPDMLIIGNFGLSLEQSKAQMALWAIMAAPLIMSNDLRTLSSEARNILQNKAVIAINQDPLGIQGRRILKDEGHIEVFWRPLSKSASALVFLSRRTDMPYRYHSTLSLLNYTTGSYTAYDVFKDEIVFLPSEKTHFTITINPSGVVM 397          
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Match: naga (alpha-N-acetylgalactosaminidase-like [Source:NCBI gene;Acc:103026015])

HSP 1 Score: 337.421 bits (864), Expect = 4.104e-111
Identity = 183/397 (46.10%), Postives = 235/397 (59.19%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFT-LKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 1378
            ++ F+ + ++ LDNGL RTPPMGW+ WERFRC  DC   P  CISE+L    A  +  +G+   GY Y+ IDDCW +K R   G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  TF  W +D +KLDGCYSN + Q  GY   +  LN T RPI +SCSWPAY     + P++   LL   CNLWR Y DI DSW SVL I+++   + +     A PG WNDPDMLIIG+ GL+ +Q R QM +WAI AAPLFMSNDLR ++S +  +L NK  +AINQD LG QG  L  E+  + V+ R LS   + +   +    +   Y T LK   ++    Y + D F  KS   V   T      NPT + M  V
Sbjct:    9 LLAFSATTFA-LDNGLMRTPPMGWLAWERFRCDIDCDNDPKNCISESLFKDMADRLAEDGWRELGYVYVNIDDCWSSKQRDAQGRLQPDPKRFPGGIANLARYVHDRGLKLGIYGDLGTYTCGGYPGTTLDKIEIDAQTFADWGIDMLKLDGCYSNATDQEMGYPLMTKALNATGRPIGYSCSWPAY--QGGLPPAVNYTLLGEICNLWRNYGDIQDSWDSVLNIVDWFTDHQDILQPAAGPGQWNDPDMLIIGDYGLSTDQSRSQMALWAIMAAPLFMSNDLRTLNSGARAILQNKGAIAINQDPLGIQGRRLIKEKSGIDVFWRPLSNGASALVFFSRRTDMPYRYQTSLKALNYT-PGTYKLYDVFLEKSLPEVKDATDFVVSVNPTGVVMWYV 401          
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Match: naga (N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:ZDB-GENE-051113-256])

HSP 1 Score: 348.206 bits (892), Expect = 2.136e-116
Identity = 178/383 (46.48%), Postives = 234/383 (61.10%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLT-KLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLF-ERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVY-FTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            +DNGL RTPPMGW+ WERFRC  DC   P  CISE L  + A  +  +G+   GY Y+ IDDCW+++ R   G L  DP RFP+G+  L+  +H+ GLK GIYED GT TCGGYPG +L  ++ D  TF +WEVD +KLDGCYSN S + +GY   S  LN T RPI +SCSWPAY     + P +    L   CNLWR YDDI+DSW SV  I+++   +       AAPG WNDPDMLI+G+ GL+Y+Q R QM +WA+ AAP FMSNDLR++S+ + ELL N+ ++ INQD LG QG  +  E+  ++VW R+L+     +A  +    +   Y  TL   G     +Y V D FS K   T+          NP+  +M
Sbjct:   19 MDNGLMRTPPMGWLAWERFRCNVDCKNDPDNCISERLFKAMADRLAEDGWRELGYVYVNIDDCWMSRQRDARGRLQADPERFPSGIKALADYVHARGLKLGIYEDLGTLTCGGYPGTTLADVQTDATTFAEWEVDMLKLDGCYSNSSEKAEGYPSMSRALNATGRPIAYSCSWPAYEG--GLPPKVNYTQLGDICNLWRNYDDIEDSWDSV-SIMDWWGDHQEVLIPAAAPGRWNDPDMLIVGDFGLSYDQSRAQMAIWAVLAAPYFMSNDLRSMSAAARELLQNRLLIQINQDPLGHQGRRIIKEKSHIEVWSRNLTDGAWALAFASRRVDMPYPYSATLAALGAPAGSQYWVIDVFSGKQIGTLKSEEKFTVSINPSGAEM 398          
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Match: gla (galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041010-207])

HSP 1 Score: 308.916 bits (790), Expect = 1.124e-100
Identity = 154/329 (46.81%), Postives = 202/329 (61.40%), Query Frame = 2
Query:  227 SCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGC-YSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFE-RDTVQVWRRDLSRSRTVVAVLN 1207
              LDNGL+ TPPMGW+ WERF C T C   P  CISE L +  A  M   G+  AGYEY+ IDDCW +  R   G L  DP RFP+G+  L+  +H+ GLK GIY D G  TC GYP S    + D  TF +W VD +K DGC   N S   +GY   S  LN T RP+V+SC WP Y     I P+ T+ ++  CN WR   D++DSW SV  + ++   + +     A PG WNDPDML+IGN GL+++QQ  QM +WAI AAPL MSNDLRN+   S  +LLN + +A+NQD LG+QG  + + ++ V +WRR+L+     VA++N
Sbjct:   32 GALDNGLALTPPMGWLHWERFMCNTYCRSDPDNCISEKLFMEMADIMATEGWLDAGYEYVCIDDCWPSAKRDARGRLQADPERFPSGIKALADYVHARGLKLGIYSDVGPTTCAGYPASYGSYELDARTFAEWGVDLLKFDGCNLQNISVLVEGYTNMSIALNGTGRPMVYSCEWPLYSWGEYIKPNYTQ-VRRYCNQWRNSADVEDSWESVRSLADWAANHQSLIVPVAGPGGWNDPDMLVIGNFGLSHSQQVTQMALWAIMAAPLIMSNDLRNLDGFSRNVLLNPHAIAVNQDPLGRQGTLVAKLKNNVDMWRRELAGGGMAVALVN 359          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO37440 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR2])

HSP 1 Score: 375.941 bits (964), Expect = 4.073e-127
Identity = 192/400 (48.00%), Postives = 244/400 (61.00%), Query Frame = 2
Query:  200 VVLFTTSRYS------CLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKD--VYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMI 1372
             VLF  + YS       LDNGL+ TPPMGWM WERFRC  DC   P+ CISE+L +  A  M  +G+  AGYE+I IDDC+ NK R K+G+L  +  RFP+G   L+  IH  GLK G+Y DYG  TC GYPGS  +I+QD  TF  W  DY+KLDGCYS+P T  +GY E+   LN T RPIV+SC WP+Y   RN+T + T + + +CN WR YDDI DSW SV+ I++Y   N + F   A PGHWNDPD LIIGN GL+ +Q R QM +WAI A+PL MS DLR+I  +  E+LLNK ++A+NQD LGK G  ++  +D  +VW R LS     V +LN  +      V  +    GF  V     +D FS K         S   H NPT + M+
Sbjct:    5 AVLFCIALYSFVRTGYALDNGLALTPPMGWMDWERFRCNIDCEHDPNNCISEHLFMEIADRMAEDGYRGAGYEFISIDDCYTNKKRDKNGNLQLNTTRFPSGPHALAQYIHGKGLKLGVYADYGVLTCAGYPGSYYYIEQDAKTFASWGADYLKLDGCYSDPKTMNKGYPEFRRALNATGRPIVYSCEWPSYMIGRNLTVNYTDIAE-NCNTWRNYDDIQDSWASVMHIVDYFAANQDTFIAAAGPGHWNDPDELIIGNFGLSDDQSRAQMALWAIMASPLIMSTDLRSIKPRHKEILLNKEVIAVNQDKLGKMGRQWIKSKDNTEVWARPLSDGSVAVVLLNRRDDGMPYLVEASFDKIGFQ-VHAATARDLFSHKH--LGSFINSFAAHVNPTGVVMV 400          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO42026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L8])

HSP 1 Score: 348.977 bits (894), Expect = 7.343e-117
Identity = 174/389 (44.73%), Postives = 241/389 (61.95%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFE-----RDTVQVWRRDLSRSRTVVAVLN--VGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 1378
            +D+GL+ TPPMGWM WERFRC  DC   P ECI E L ++ A  M  +G+  AGY+Y+ IDDCW +K R  +G L  DP RFP+G+  L+  +HS GLK GIY DYGT TC  YPGS++ +++D+ TF  W+VDY+K+DGC+++PS    GY   S YLN T RPI+FSCSWP Y  ++   P   K +   C+LWR Y DI+DSW  V  I++++  N       A PGHWNDPD LIIGN GL+  Q + QM +WAI AAPLFMSNDLR I   + ++LLN  ++A+NQD LGKQG+ +++         +VW R L      V + N  V  A++ +    KD+G    K+  V+D + +  ++ V  T+  +    P  + M+ +
Sbjct:    1 MDDGLALTPPMGWMAWERFRCNVDCDNDPDECIHERLFMAMADEMMCDGYLEAGYKYVCIDDCWTSKDRGPNGELQADPNRFPSGIKELAKYVHSKGLKLGIYADYGTMTCERYPGSIDRLEKDMRTFASWDVDYLKMDGCFADPSKMDTGYPLASKYLNATGRPIMFSCSWPFYQVLKGQKPDY-KNIAKHCHLWRNYIDIEDSWEWVTKIVDHYAENQEVLIPVAGPGHWNDPDQLIIGNFGLSPEQSKSQMALWAILAAPLFMSNDLRKIPQFAKDVLLNTEVIAVNQDPLGKQGWRVWKGQNGWEKYTEVWARHLVNGNVAVVLFNRRVDKAVQ-ISTWFKDYGMG--KQAAVRDLY-LHQDLGV-FTSGYSAKVYPNGVVMVKI 383          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO30461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0R0])

HSP 1 Score: 120.168 bits (300), Expect = 8.665e-32
Identity = 67/166 (40.36%), Postives = 92/166 (55.42%), Query Frame = 2
Query:  809 CNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLN-KNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMK 1303
            CNLWR YDDI DSW SVL IINY+  + +     A PGHWNDPD LIIG++ L  +Q + QM +W+I A            S+K    L   + I+A+NQD LGK G   F  + +QVW R L+     VAV+NV ++   V  + ++ G        V+D F+ +
Sbjct:   10 CNLWRNYDDIQDSWGSVLSIINYYGDSQDDLVPVAGPGHWNDPDQLIIGDS-LTVDQAKAQMAIWSIMA------------SNKQCYFLFPCREIIAVNQDKLGKMGSRRFMNNAIQVWSRPLADGSVAVAVINVASSAHTVPVSFEEIGLR-ASTASVRDLFAFQ 161          
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Match: EDO28386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6L9])

HSP 1 Score: 76.6406 bits (187), Expect = 1.376e-17
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 2
Query:  611 TFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAY 757
            TF KW VDY+KLDGCYS+P T   GY + +  LN+T RPIVFSCSWPAY
Sbjct:    3 TFAKWGVDYLKLDGCYSDPKTYDTGYPKVTTALNVTGRPIVFSCSWPAY 51          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: naga (alpha-N-acetylgalactosaminidase [Source:NCBI gene;Acc:101155483])

HSP 1 Score: 335.88 bits (860), Expect = 1.332e-110
Identity = 182/388 (46.91%), Postives = 228/388 (58.76%), Query Frame = 2
Query:  230 CLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQ--SSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 1378
             L+NGL RTPPMGW+ WERFRC  DC   P  CISENL +  A  +  +G+   GY Y+ IDDCW +  R ++G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  T   WEVD  K DGCYSN + Q QGY   S  LN T RPI +SCSWPAY   R   P      Q    CNLWR YDDI DSW SVL II++   N +     A PG WNDPDMLIIG+ GL+ +Q R QM +W+I AAPLFMSNDLR ISS +  +L NK  + INQD +G  G   L E+  ++V+ R LS + + +   +    +   Y  +L+   F+    Y + D F+ K     D +T      NPT + M  V
Sbjct:   18 ALNNGLMRTPPMGWLAWERFRCDIDCQNDPKNCISENLFMDMADRLSEDGWRELGYVYVNIDDCWSSMERDENGRLQPDPKRFPGGIRKLARYMHDRGLKLGIYGDMGTHTCGGYPGTTLDKIEIDAQTIADWEVDMFKFDGCYSNATEQEQGYPLMSKALNATGRPIGYSCSWPAY---RGGLPPKVNYTQLGEICNLWRNYDDIQDSWDSVLNIIDWFFDNQDALQPAAGPGRWNDPDMLIIGDFGLSLDQSRSQMALWSIMAAPLFMSNDLRTISSGARSILQNKIAIGINQDAMGMPGRRILKEKSGIEVFWRPLSNNASALVFFSRRTDMPYRYTSSLRQLNFT-TGSYKIIDVFTGKMASLKD-STDFVVSVNPTGVVMWYV 400          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: naga (alpha-N-acetylgalactosaminidase [Source:NCBI gene;Acc:101155483])

HSP 1 Score: 322.013 bits (824), Expect = 5.814e-105
Identity = 181/409 (44.25%), Postives = 227/409 (55.50%), Query Frame = 2
Query:  233 LDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPG-SLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQ-------------------------GYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQ--SSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQG-YFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYF-TLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDM 1369
            L+NGL RTPPMGW+ WERFRC  DC   P  CISENL +  A  +  +G+   GY Y+ IDDCW +  R ++G L PDP RFP G+  L+  +H  GLK GIY D GT TCGGYPG +L+ I+ D  T   WEVD  K DGCYSN + Q Q                         GY   S  LN T RPI +SCSWPAY   R   P      Q    CNLWR YDDI DSW SVL II++   N +     A PG WNDPDMLIIG+ GL+ +Q R QM +W+I AAPLFMSNDLR ISS +  +L NK  + INQD +G  G   L E+  ++V+ R LS + + +   +    +   Y  +L+   F+    Y + D F+ K     D +T      NPT + M
Sbjct:   19 LNNGLMRTPPMGWLAWERFRCDIDCQNDPKNCISENLFMDMADRLSEDGWRELGYVYVNIDDCWSSMERDENGRLQPDPKRFPGGIRKLARYMHDRGLKLGIYGDMGTHTCGGYPGTTLDKIEIDAQTIADWEVDMFKFDGCYSNATEQEQGMEVLGELGSCFRSLFDCKCILALAGYPLMSKALNATGRPIGYSCSWPAY---RGGLPPKVNYTQLGEICNLWRNYDDIQDSWDSVLNIIDWFFDNQDALQPAAGPGRWNDPDMLIIGDFGLSLDQSRSQMALWSIMAAPLFMSNDLRTISSGARSILQNKIAIGINQDAMGMPGRRILKEKSGIEVFWRPLSNNASALVFFSRRTDMPYRYTSSLRQLNFT-TGSYKIIDVFTGKMASLKD-STDFVVSVNPTGVVM 422          
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Match: gla (galactosidase alpha [Source:NCBI gene;Acc:101169044])

HSP 1 Score: 318.931 bits (816), Expect = 4.204e-104
Identity = 160/337 (47.48%), Postives = 204/337 (60.53%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAY-FDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLN 1207
            VV         LDNGL+  P MGW+ WERF C TDC   P  CISE L +  A  M   G+  AGYEY+ IDDCW +  R   G L  DP RFP G+  L+  IHS GLK GIY D G  TC GYPGSL + + D  TF  W+VD +K DGC+   +   +GY   S  LN T R I++SC WP Y + ++   P+ T  ++  CN WR ++DI DSW+S+  I+ +   N       A PG WNDPDML+IGN GL+++QQ+ QM +WAI AAPL MSNDLR+I  +S ELL N+ I+AINQD LG+QGY         VW R L  +R  +A++N
Sbjct:   10 VVGLMCPTAEALDNGLALKPTMGWLHWERFTCNTDCDTDPRNCISEQLYMQMADVMVKEGWKEAGYEYVCIDDCWPSHKRDAKGRLQADPNRFPGGIKKLADYIHSKGLKLGIYADVGKNTCAGYPGSLGYYETDAQTFADWDVDLLKFDGCFMERTLIAEGYMNMSKALNKTGRSILYSCEWPLYEWAIKQ--PNYTA-IREYCNHWRNFNDIFDSWSSLKTILEWTASNQKIIVPAAGPGGWNDPDMLVIGNFGLSHDQQQSQMALWAIMAAPLLMSNDLRDICPRSKELLQNRMIIAINQDPLGQQGYHTARLMDFDVWERPLFGNRLAIAIMN 343          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000009912.1 (SMESG000009912.1)

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 373/373 (100.00%), Postives = 373/373 (100.00%), Query Frame = 2
Query:  263 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVVD 1381
            MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVVD
Sbjct:    1 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVVD 373          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000009913.1 (SMESG000009913.1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 309/385 (80.26%), Postives = 339/385 (88.05%), Query Frame = 2
Query:  230 CL--DNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV 1378
            CL  DNGL+RTPPMGWMTWERFRCTTDC  YP ECISE+LIISQA+N+  NGF SAGYEYIVIDDCWLNKSRAKDGSLIPDP+RFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLN+I QDI TFV+WEVDYIKLDGCYS+ +TQPQGYAEYSHYLNLT RPIVFSCSWPAYFDVRNI  +L  LLQ+SCNLWRMYDDIDDSW+SVLGIINY+K+N N FSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPL MSNDLR+I+  SV+LLLNKNILAINQD LGKQG FLFE++ +QVWRRDLS+SRT +AVLN GN+ +  Y  L D GFSI K+Y V DAF+M +N T+ LTT I F    TSID++ V
Sbjct:   16 CLGSDNGLARTPPMGWMTWERFRCTTDCDAYPKECISEDLIISQAYNLAKNGFLSAGYEYIVIDDCWLNKSRAKDGSLIPDPVRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNYINQDITTFVQWEVDYIKLDGCYSDTTTQPQGYAEYSHYLNLTKRPIVFSCSWPAYFDVRNINSTLASLLQNSCNLWRMYDDIDDSWSSVLGIINYYKINYNNFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLLMSNDLRDINDDSVKLLLNKNILAINQDPLGKQGKFLFEKNLIQVWRRDLSQSRTAIAVLNAGNSDQIFYLYLTDVGFSIDKQYDVSDAFTMSTNRTIGLTTQITFQLPSTSIDILYV 400          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000016280.1 (SMESG000016280.1)

HSP 1 Score: 391.734 bits (1005), Expect = 5.636e-133
Identity = 188/396 (47.47%), Postives = 255/396 (64.39%), Query Frame = 2
Query:  200 VVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLS----RSRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIV 1375
            V+ F   +  CLDN + +TPPMGW++W RFRCT DC   P++CISENLI++ A  M + G+  AGYEY++IDDCWL K RA +GSL+ DP RFP G+ YL+  +H  GLKFGIYED+G KTC GYPGS  H+K D  TF  W VDY+K DGC+S    QP G   +S YLN T R I  +  WP Y  V++++     LL+ + N+ R+++DI+DSW S+L ++N++K N   F++WA PG++NDPDML+IGN  + YNQ+++QM +WAIFA PL MSNDLRNIS  S  +LLNKNI++INQD  G QG F+        W R LS      R  +AVLN+GN     YFT+ +          + + F+ +    V  + S+     PTS  M++
Sbjct:    7 VLSFFLLQCHCLDNEVGQTPPMGWLSWLRFRCTVDCKTLPNDCISENLIMAMADKMAV-GYKDAGYEYVMIDDCWLAKDRAANGSLMSDPERFPRGIKYLADYVHRRGLKFGIYEDFGLKTCAGYPGSFGHLKMDAFTFASWGVDYVKFDGCWSFAFMQPLGIELFSKYLNETGRQIFLNVEWPLYMGVKHMSNERISLLKRTTNMARVFNDIEDSWDSLLSVVNFYKKNDRNFASWARPGYFNDPDMLLIGNKYITYNQEKLQMALWAIFAGPLIMSNDLRNISEASKSILLNKNIISINQDKFGIQGRFIKTIGEQDYWMRPLSPILGHQRVAIAVLNLGNQASTSYFTIDNLNVISSGNLTLLNVFTNELK-NVSSSESLVISMEPTSATMVI 400          
BLAST of Alpha-galactosidase vs. Planmine SMEST
Match: SMESG000016213.1 (SMESG000016213.1)

HSP 1 Score: 390.578 bits (1002), Expect = 6.662e-133
Identity = 182/348 (52.30%), Postives = 238/348 (68.39%), Query Frame = 2
Query:  263 MGWMTWERFRCTTDCVKYPSECISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRFPNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWEVDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNITPSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHWNDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLLNKNILAINQDTLGKQGYFLFERDTVQVWRRDLSR----SRTVVAVLNVGNAIKDVYFTLKDFGFSIVKKYIVKDAF 1294
            MGW++W R+RCT +C  YP++CISENLI++ A  M    +  AGYEY++IDDCWL K RA +GSL+PDP RFP GM +L+  +HS GLKFGIYEDYGTKTC GYPGSL H+K D  TF  W +DY+K DGC S PSTQP G   +S +LN T RPI  +  WP Y  V +IT S  +LLQ + N+ R++DDI D W S+L +IN++K N N F+ WA PG++NDPDML+IGN  + YNQ+++QM MWAIFA PL MSNDLRNIS  S  +L NKN+++INQD LG QG F+     +  W R LS      +  +A+LN+ N   + +F L++       KY + + F
Sbjct:    1 MGWLSWLRYRCTINCKSYPNDCISENLIMAMADKMSQE-YKEAGYEYVMIDDCWLAKDRAANGSLLPDPGRFPRGMKFLADYVHSKGLKFGIYEDYGTKTCAGYPGSLGHLKMDAVTFASWGIDYVKFDGCNSVPSTQPFGIQMFSKFLNDTGRPIFLNVEWPLYLGVDHITQSQVELLQDTTNMARVFDDIQDDWKSLLNVINFYKNNENNFAAWARPGYFNDPDMLLIGNNYITYNQEKLQMAMWAIFAGPLIMSNDLRNISEASKSILTNKNVISINQDKLGIQGQFITTIGKLDYWVRQLSPVLGFQQVAIAILNLSNKNINDWFALENLNIKGTGKYSLTEVF 347          
The following BLAST results are available for this feature:
BLAST of Alpha-galactosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAGA2.147e-11144.19alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
NAGA2.147e-11144.19alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
NAGA2.147e-11144.19alpha-N-acetylgalactosaminidase [Source:HGNC Symbo... [more]
GLA1.193e-10944.47galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4... [more]
GLA3.450e-10140.23galactosidase alpha [Source:HGNC Symbol;Acc:HGNC:4... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gana-16.304e-9443.32Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG79972.030e-12548.12gene:FBgn0034117 transcript:FBtr0087172[more]
CG79972.030e-12548.12gene:FBgn0034117 transcript:FBtr0087171[more]
CG57313.789e-12445.23gene:FBgn0032192 transcript:FBtr0079959[more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naga3.167e-11847.46N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
naga3.167e-11847.46N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
naga8.624e-11547.75N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
gla1.574e-10944.50galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041... [more]
naga3.604e-7752.63N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naga1.332e-11947.79N-acetylgalactosaminidase, alpha- [Source:NCBI gen... [more]
gla8.937e-10448.16galactosidase alpha [Source:NCBI gene;Acc:10014576... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naga4.467e-10843.38N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
Gla1.669e-10547.34galactosidase, alpha [Source:MGI Symbol;Acc:MGI:13... [more]
Gla1.958e-10547.34galactosidase, alpha [Source:MGI Symbol;Acc:MGI:13... [more]
Naga2.237e-8150.63N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
Naga3.486e-8150.42N-acetyl galactosaminidase, alpha [Source:MGI Symb... [more]
back to top
BLAST of Alpha-galactosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90744|NAGAB_CHICK9.600e-11847.01Alpha-N-acetylgalactosaminidase OS=Gallus gallus O... [more]
sp|P17050|NAGAB_HUMAN1.031e-11044.19Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX... [more]
sp|Q58DH9|NAGAB_BOVIN2.083e-11043.70Alpha-N-acetylgalactosaminidase OS=Bos taurus OX=9... [more]
sp|Q66H12|NAGAB_RAT4.241e-11048.32Alpha-N-acetylgalactosaminidase OS=Rattus norvegic... [more]
sp|P06280|AGAL_HUMAN5.730e-10944.47Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=G... [more]
back to top
BLAST of Alpha-galactosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5GMA31.390e-13155.05Alpha-galactosidase (Fragment) OS=Anoplophora glab... [more]
K1PB469.669e-13149.37Alpha-galactosidase OS=Crassostrea gigas OX=29159 ... [more]
A0A2P8ZLY15.243e-12947.03Alpha-galactosidase OS=Blattella germanica OX=6973... [more]
A0A433TK949.798e-12848.32Alpha-galactosidase OS=Elysia chlorotica OX=188477... [more]
E9HCU12.075e-12748.84Alpha-galactosidase OS=Daphnia pulex OX=6669 GN=DA... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NAGA1.118e-11346.46alpha-N-acetylgalactosaminidase-like [Source:NCBI ... [more]
naga4.104e-11146.10alpha-N-acetylgalactosaminidase-like [Source:NCBI ... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naga2.136e-11646.48N-acetylgalactosaminidase, alpha [Source:ZFIN;Acc:... [more]
gla1.124e-10046.81galactosidase, alpha [Source:ZFIN;Acc:ZDB-GENE-041... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-galactosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO374404.073e-12748.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420267.343e-11744.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304618.665e-3240.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283861.376e-1767.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-galactosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
naga1.332e-11046.91alpha-N-acetylgalactosaminidase [Source:NCBI gene;... [more]
naga5.814e-10544.25alpha-N-acetylgalactosaminidase [Source:NCBI gene;... [more]
gla4.204e-10447.48galactosidase alpha [Source:NCBI gene;Acc:10116904... [more]
back to top
BLAST of Alpha-galactosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000009912.10.000e+0100.00SMESG000009912.1[more]
SMESG000009913.10.000e+080.26SMESG000009913.1[more]
SMESG000016280.15.636e-13347.47SMESG000016280.1[more]
SMESG000016213.16.662e-13352.30SMESG000016213.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011695 ID=SMED30011695|Name=Alpha-galactosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1516bp
AATTTTCAACATGCAAAATTATCTACATATTTCGTCGAAGCGTTTCGGCT
AATGTAAATCTGCGTCATGTGTGAGTGATAAAGGTAAATAATTATTATAA
TCAACTGAAGGTCCGTGTAGCACATGATTTGTTAAGTAAATATAAATTAT
TATTATCAACAACATTATATCATTATCAATGTTATTTATAATTTCGTTGG
TAGTTTTATTCACGACTTCTCGGTATTCATGCCTCGATAATGGCTTGTCA
AGGACTCCGCCCATGGGATGGATGACTTGGGAAAGGTTCCGATGCACGAC
TGATTGCGTCAAGTATCCGAGTGAATGCATCAGTGAAAATTTAATCATAT
CTCAAGCTTTCAATATGAGAATGAACGGGTTTTCCAGTGCAGGATATGAA
TACATTGTCATTGATGATTGTTGGCTGAACAAATCCCGGGCTAAAGACGG
AAGTCTTATTCCAGATCCAATTAGATTTCCAAATGGAATGGTTTACTTGA
GTACAGTCATTCACAGTCTGGGACTAAAATTCGGAATTTATGAAGATTAC
GGAACAAAGACGTGTGGAGGTTATCCTGGAAGCCTGAATCATATTAAACA
GGATATTGCTACATTTGTTAAATGGGAGGTTGATTACATTAAACTTGATG
GCTGCTACAGTAATCCTTCAACACAGCCCCAAGGCTACGCTGAGTACAGC
CACTATCTCAATTTAACTAACCGACCGATTGTATTCTCATGTAGCTGGCC
AGCTTATTTCGACGTACGTAATATTACCCCATCGTTAACTAAACTTCTGC
AGAGCTCCTGCAATCTCTGGCGAATGTATGACGACATCGACGACTCCTGG
ACTTCGGTTCTCGGAATAATAAATTATCATAAACTCAATTTAAACAAATT
TTCTACATGGGCCGCTCCTGGTCATTGGAATGATCCGGATATGCTGATCA
TAGGGAACACGGGACTGAACTATAACCAACAGAGAGTTCAAATGGGAATG
TGGGCAATATTCGCAGCGCCATTGTTTATGTCAAACGATTTGAGAAATAT
TAGCTCGAAGTCTGTGGAATTGTTATTGAACAAAAATATTCTGGCAATTA
ACCAGGATACATTGGGTAAGCAAGGCTATTTTTTGTTTGAGAGAGATACG
GTTCAAGTATGGCGAAGAGATTTATCACGGTCCAGAACTGTGGTTGCCGT
ATTGAATGTAGGCAATGCCATTAAAGATGTTTATTTCACATTGAAAGATT
TCGGATTTTCAATAGTGAAAAAGTACATTGTTAAAGATGCCTTTTCGATG
AAATCTAACATGACAGTTGACTTGACCACGTCCATCAATTTTCATTCCAA
TCCAACGTCCATTGACATGATAGTAGTGGACTAGTAGAATGGAACTCGAT
GTTTTTCTCATGTCTAATTTTTCTCCAATGATTTATTTTTACATTTTGTA
CTTGTGAATTATTGAGACTTTTGATTAGTTTTTTTCATTATAAAATTTTT
TTTAATTAAAAAAAAA
back to top

protein sequence of SMED30011695-orf-1

>SMED30011695-orf-1 ID=SMED30011695-orf-1|Name=SMED30011695-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MLFIISLVVLFTTSRYSCLDNGLSRTPPMGWMTWERFRCTTDCVKYPSEC
ISENLIISQAFNMRMNGFSSAGYEYIVIDDCWLNKSRAKDGSLIPDPIRF
PNGMVYLSTVIHSLGLKFGIYEDYGTKTCGGYPGSLNHIKQDIATFVKWE
VDYIKLDGCYSNPSTQPQGYAEYSHYLNLTNRPIVFSCSWPAYFDVRNIT
PSLTKLLQSSCNLWRMYDDIDDSWTSVLGIINYHKLNLNKFSTWAAPGHW
NDPDMLIIGNTGLNYNQQRVQMGMWAIFAAPLFMSNDLRNISSKSVELLL
NKNILAINQDTLGKQGYFLFERDTVQVWRRDLSRSRTVVAVLNVGNAIKD
VYFTLKDFGFSIVKKYIVKDAFSMKSNMTVDLTTSINFHSNPTSIDMIVV
D*
back to top

protein sequence of SMED30011695-orf-2

>SMED30011695-orf-2 ID=SMED30011695-orf-2|Name=SMED30011695-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MIKFSLMHSLGYLTQSVVHRNLSQVIHPMGGVLDKPLSRHEYREVVNKTT
NEIINNIDNDIMLLIIIIYIYLTNHVLHGPSVDYNNYLPLSLTHDADLH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035373Melibiase/NAGA_C
IPR002241Glyco_hydro_27
IPR013780Glyco_hydro_b
IPR013785Aldolase_TIM
IPR017853Glycoside_hydrolase_SF
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002241Glycoside hydrolase, family 27PRINTSPR00740GLHYDRLASE27coord: 142..159
score: 52.5
coord: 245..264
score: 56.0
coord: 266..287
score: 36.59
coord: 67..82
score: 56.25
coord: 169..187
score: 42.89
coord: 108..129
score: 47.05
coord: 21..40
score: 57.75
IPR002241Glycoside hydrolase, family 27PFAMPF16499Melibiase_2coord: 26..310
e-value: 8.8E-124
score: 412.3
IPR002241Glycoside hydrolase, family 27PANTHERPTHR11452ALPHA-GALACTOSIDASE/ALPHA-N-ACETYLGALACTOSAMINIDASEcoord: 3..398
IPR002241Glycoside hydrolase, family 27CDDcd14792GH27coord: 27..310
e-value: 1.24291E-130
score: 374.199
IPR035373Alpha galactosidase A, C-terminal beta-sandwich domainPFAMPF17450Melibiase_2_Ccoord: 313..393
e-value: 7.3E-12
score: 45.4
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 19..312
e-value: 1.7E-113
score: 381.1
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 313..401
e-value: 1.7E-10
score: 42.8
NoneNo IPR availablePANTHERPTHR11452:SF58coord: 3..398
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.657
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 312..400
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 19..310