Heterogeneous nuclear ribonucleoprotein A2

Overview
NameHeterogeneous nuclear ribonucleoprotein A2
Smed IDSMED30011690
Length (bp)1614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein A2 (SMED30011690) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein A2 (SMED30011690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein A2 (SMED30011690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein A2 (SMED30011690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011690SMESG000050993.1 SMESG000050994.1 SmedASXL_005760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011690SMESG000050993.1 SMESG000050994.1 SmedASXL_005760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011690SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011690SMESG000050993.1 SMESG000050994.1 Contig34181uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011690SMESG000050993.1 SMESG000050994.1 Contig34181newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 211.075 bits (536), Expect = 4.903e-63
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 211.075 bits (536), Expect = 4.903e-63
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 210.305 bits (534), Expect = 1.305e-62
Identity = 104/188 (55.32%), Postives = 137/188 (72.87%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 201          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 210.305 bits (534), Expect = 1.305e-62
Identity = 104/188 (55.32%), Postives = 137/188 (72.87%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 201          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 206.453 bits (524), Expect = 3.550e-62
Identity = 103/179 (57.54%), Postives = 133/179 (74.30%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR    + +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMR-DPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 192          

HSP 2 Score: 69.707 bits (169), Expect = 1.095e-12
Identity = 31/82 (37.80%), Postives = 52/82 (63.41%), Query Frame = 2
Query:  398 KKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEA 643
            +KLF+G L  E   + LR+Y+ ++G +T+C ++    +  SRGFGFVT+     VD  +  +PH ID +  E K+A+++EE+
Sbjct:   21 RKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREES 102          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 177.948 bits (450), Expect = 7.657e-51
Identity = 82/176 (46.59%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            E  RK+F+GGL+  TT+D ++  + Q+GE+ D++VMR      +SRGFGFVT+     VDAA   RPHIID +TV+ KRA+PRD+ N +ES+++ K+L+V  ++++   D L +YF ++G +T+ EII  + T + RGFGFVT+DD+D VD+ +L K H ++  RC+V+K LSK+E
Sbjct:   20 ENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR-DPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 177.948 bits (450), Expect = 7.657e-51
Identity = 82/176 (46.59%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            E  RK+F+GGL+  TT+D ++  + Q+GE+ D++VMR      +SRGFGFVT+     VDAA   RPHIID +TV+ KRA+PRD+ N +ES+++ K+L+V  ++++   D L +YF ++G +T+ EII  + T + RGFGFVT+DD+D VD+ +L K H ++  RC+V+K LSK+E
Sbjct:   20 ENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR-DPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 177.948 bits (450), Expect = 7.855e-51
Identity = 82/176 (46.59%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            E  RK+F+GGL+  TT+D ++  + Q+GE+ D++VMR      +SRGFGFVT+     VDAA   RPHIID +TV+ KRA+PRD+ N +ES+++ K+L+V  ++++   D L +YF ++G +T+ EII  + T + RGFGFVT+DD+D VD+ +L K H ++  RC+V+K LSK+E
Sbjct:   20 ENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR-DPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 177.948 bits (450), Expect = 7.855e-51
Identity = 82/176 (46.59%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            E  RK+F+GGL+  TT+D ++  + Q+GE+ D++VMR      +SRGFGFVT+     VDAA   RPHIID +TV+ KRA+PRD+ N +ES+++ K+L+V  ++++   D L +YF ++G +T+ EII  + T + RGFGFVT+DD+D VD+ +L K H ++  RC+V+K LSK+E
Sbjct:   20 ENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR-DPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 156.377 bits (394), Expect = 3.243e-43
Identity = 74/171 (43.27%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  170 LKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIG 682
            ++  + Q+GE+ D++VMR      +SRGFGFVT+     VDAA   RPHIID +TV+ KRA+PRD+ N +ES+++ K+L+V  ++++   D L +YF ++G +T+ EII  + T + RGFGFVT+DD+D VD+ +L K H ++  RC+V+K LSK+E    +      T G
Sbjct:    1 MREFYSQFGEITDIIVMR-DPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRETRG 170          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085299)

HSP 1 Score: 201.445 bits (511), Expect = 1.797e-59
Identity = 98/183 (53.55%), Postives = 129/183 (70.49%), Query Frame = 2
Query:   89 RNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKE 637
            ++D+    E  RKLFIGGL + TT++ LK+HFE+WG +VDVVVM+   +  +SRGFGF+TY    M+D AQ SRPH ID R VE KRA+PR + +S  +  TVKKLFVGALK +     +RDYF  FGNI +  I+  +ETG+ RGF FV +DDYDPVDK++L K H ++ K  +VKKAL K+
Sbjct:   15 QDDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMK-DPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0310621)

HSP 1 Score: 202.216 bits (513), Expect = 1.996e-59
Identity = 98/176 (55.68%), Postives = 128/176 (72.73%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            EQ RKLFIGGL + TT+D LK+HFE+WG +VDVVVM+   K  +SRGFGF+TY    M+D AQ +RPH ID RTVE KRA+PR E +S  +  TVKKLFVG L+ +   + LR+YF  FG I    I++ ++TG+ RGF F+ +DDYDPVDKI+L K H I NK  +VKKA++K++
Sbjct:   21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMK-DPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195          

HSP 2 Score: 63.1586 bits (152), Expect = 2.068e-10
Identity = 31/95 (32.63%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  395 VKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            ++KLF+G L      D L+ +F ++GNI +  ++   +T  SRGFGF+TY     +D     +PH ID +  E K+A+ ++E  S  A  ++  +
Sbjct:   23 LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKL 117          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0300590)

HSP 1 Score: 202.216 bits (513), Expect = 1.996e-59
Identity = 98/176 (55.68%), Postives = 128/176 (72.73%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            EQ RKLFIGGL + TT+D LK+HFE+WG +VDVVVM+   K  +SRGFGF+TY    M+D AQ +RPH ID RTVE KRA+PR E +S  +  TVKKLFVG L+ +   + LR+YF  FG I    I++ ++TG+ RGF F+ +DDYDPVDKI+L K H I NK  +VKKA++K++
Sbjct:   21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMK-DPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195          

HSP 2 Score: 63.1586 bits (152), Expect = 2.068e-10
Identity = 31/95 (32.63%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  395 VKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            ++KLF+G L      D L+ +F ++GNI +  ++   +T  SRGFGF+TY     +D     +PH ID +  E K+A+ ++E  S  A  ++  +
Sbjct:   23 LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKL 117          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0334495)

HSP 1 Score: 202.216 bits (513), Expect = 1.996e-59
Identity = 98/176 (55.68%), Postives = 128/176 (72.73%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            EQ RKLFIGGL + TT+D LK+HFE+WG +VDVVVM+   K  +SRGFGF+TY    M+D AQ +RPH ID RTVE KRA+PR E +S  +  TVKKLFVG L+ +   + LR+YF  FG I    I++ ++TG+ RGF F+ +DDYDPVDKI+L K H I NK  +VKKA++K++
Sbjct:   21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMK-DPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195          

HSP 2 Score: 63.1586 bits (152), Expect = 2.068e-10
Identity = 31/95 (32.63%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  395 VKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            ++KLF+G L      D L+ +F ++GNI +  ++   +T  SRGFGF+TY     +D     +PH ID +  E K+A+ ++E  S  A  ++  +
Sbjct:   23 LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKL 117          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Hrb87F (gene:FBgn0004237 transcript:FBtr0082851)

HSP 1 Score: 202.216 bits (513), Expect = 1.996e-59
Identity = 98/176 (55.68%), Postives = 128/176 (72.73%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            EQ RKLFIGGL + TT+D LK+HFE+WG +VDVVVM+   K  +SRGFGF+TY    M+D AQ +RPH ID RTVE KRA+PR E +S  +  TVKKLFVG L+ +   + LR+YF  FG I    I++ ++TG+ RGF F+ +DDYDPVDKI+L K H I NK  +VKKA++K++
Sbjct:   21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMK-DPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195          

HSP 2 Score: 63.1586 bits (152), Expect = 2.068e-10
Identity = 31/95 (32.63%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  395 VKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            ++KLF+G L      D L+ +F ++GNI +  ++   +T  SRGFGF+TY     +D     +PH ID +  E K+A+ ++E  S  A  ++  +
Sbjct:   23 LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKL 117          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 200.29 bits (508), Expect = 2.612e-60
Identity = 98/184 (53.26%), Postives = 131/184 (71.20%), Query Frame = 2
Query:   98 NDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            + +  EQ RKLFIGGLSF TTED+L++HFEQWG+L D VVMR    N +SRGFGFVTY     VDAA  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF  +G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I++  CEV+KAL K+E +S
Sbjct:    5 DSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMR-DPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQS 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 201.06 bits (510), Expect = 1.136e-59
Identity = 98/184 (53.26%), Postives = 131/184 (71.20%), Query Frame = 2
Query:   98 NDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            + +  EQ RKLFIGGLSF TTED+L++HFEQWG+L D VVMR    N +SRGFGFVTY     VDAA  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF  +G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I++  CEV+KAL K+E +S
Sbjct:    5 DSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMR-DPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQS 187          

HSP 2 Score: 72.0182 bits (175), Expect = 2.522e-13
Identity = 35/105 (33.33%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  365 EANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            E+  ++    ++KLF+G L  E   D LR +F ++G +T+C ++       SRGFGFVTY     VD  +  +PH +D +  E K+A+S+E++    A  ++  I
Sbjct:    2 ESRDSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKI 106          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 200.675 bits (509), Expect = 2.723e-59
Identity = 98/184 (53.26%), Postives = 131/184 (71.20%), Query Frame = 2
Query:   98 NDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            + +  EQ RKLFIGGLSF TTED+L++HFEQWG+L D VVMR    N +SRGFGFVTY     VDAA  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF  +G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I++  CEV+KAL K+E +S
Sbjct:    4 DSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMR-DPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQS 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1a [Source:ZFIN;Acc:ZDB-GENE-040426-1546])

HSP 1 Score: 200.29 bits (508), Expect = 1.466e-58
Identity = 96/187 (51.34%), Postives = 131/187 (70.05%), Query Frame = 2
Query:   80 MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            MS      R  EQ RKLFIGGLSF TT+++L++HFEQWG L D VVMR      +SRGFGFVTY     VDAA  +RPH +D R VE KRA+ R++++   +H TVKK+FVG +K++   + LR+YFG+FG I E  I+T + + + RGF F+T+DD+D VD+I++ K H ++   CEV+KALS+EE
Sbjct:    1 MSKEQQTPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMR-DPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPGAHSTVKKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIVIQKYHTVNGHNCEVRKALSREE 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1b (heterogeneous nuclear ribonucleoprotein A1b [Source:ZFIN;Acc:ZDB-GENE-030912-14])

HSP 1 Score: 196.052 bits (497), Expect = 8.806e-57
Identity = 95/179 (53.07%), Postives = 127/179 (70.95%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            R  EQ RKLFIGGLSF TT+D+L++HFEQWG L D VVM+      +SRGFGFVTY   D V+A+  +RPH +D R VE KRA+ R++++   +H TVKK+FVG +K +   + LRDYF +FG I   EI+   +TG  RGF FVT+DD+D VD+I++ K H ++   CEV+KALSK+E
Sbjct:    8 REPEQLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMK-DPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDSSKPFAHTTVKKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNKRGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQE 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 211.46 bits (537), Expect = 2.577e-63
Identity = 103/185 (55.68%), Postives = 137/185 (74.05%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLK 655
            +R  EQFRKLFIGGLSF TTED+L++++EQWG+L D VVMR      +SRGFGFVT+   D VDA+ A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LR+YF  +G I   EIIT +++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALSK+E + ++
Sbjct:    2 EREKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 212.231 bits (539), Expect = 3.078e-63
Identity = 103/185 (55.68%), Postives = 137/185 (74.05%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLK 655
            +R  EQFRKLFIGGLSF TTED+L++++EQWG+L D VVMR      +SRGFGFVT+   D VDA+ A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LR+YF  +G I   EIIT +++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALSK+E + ++
Sbjct:    2 EREKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 211.846 bits (538), Expect = 3.753e-63
Identity = 103/185 (55.68%), Postives = 137/185 (74.05%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLK 655
            +R  EQFRKLFIGGLSF TTED+L++++EQWG+L D VVMR      +SRGFGFVT+   D VDA+ A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LR+YF  +G I   EIIT +++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALSK+E + ++
Sbjct:    2 EREKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 210.305 bits (534), Expect = 8.162e-63
Identity = 103/185 (55.68%), Postives = 138/185 (74.59%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLK 655
            +R  EQFRKLFIGGLSF TTED+L++++EQWG+L D VVMR    + +SRGFGFVT+   D VDA+ A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LR+YF  +G I   EIIT +++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALSK+E + ++
Sbjct:    2 EREKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMR-DPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQ 185          

HSP 2 Score: 60.8474 bits (146), Expect = 2.026e-9
Identity = 29/88 (32.95%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAES 385
            +KLF+GG+   T E  L+ +FE++G++  + ++    ++GK RGFGFVT+ D D VD     + H I+    E ++A+ + E    ++
Sbjct:  100 KKLFVGGIKEDTEEHHLREYFEEYGKIESIEII-TDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQN 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: psd3 (pleckstrin and Sec7 domain containing 3 [Source:Xenbase;Acc:XB-GENE-6467528])

HSP 1 Score: 203.756 bits (517), Expect = 2.995e-60
Identity = 97/189 (51.32%), Postives = 138/189 (73.02%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSL 652
            ++++  +  EQ RKLFIGGLSF TT+++L+ HFEQWG L D VVMR    + +SRGFGFVTY   D VDAA ++RPH +D R VE KRA+ R++++   +H+TVKK+FVG +K++     LR+YF ++G I   EI+T R +G+ RGF FVT++D+D VDKI++ K H ++N  CEV+KALSK+E  S+
Sbjct:    2 HKSEAPKEPEQLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMR-DPNSKRSRGFGFVTYSSTDEVDAAMSARPHKVDGRVVEPKRAVSREDSSRPGAHLTVKKIFVGGIKEDTEEHHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFEDHDSVDKIVIQKYHTVNNHNCEVRKALSKQEMASV 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 211.46 bits (537), Expect = 8.301e-64
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 211.46 bits (537), Expect = 8.301e-64
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 211.46 bits (537), Expect = 8.301e-64
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 211.075 bits (536), Expect = 3.366e-63
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 211.075 bits (536), Expect = 3.366e-63
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q9TTV2|ROA2_SAGOE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus OX=9490 GN=HNRNPA2B1 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.097e-63
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFQTTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFAEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q2HJ60|ROA2_BOVIN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus OX=9913 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.355e-62
Identity = 104/189 (55.03%), Postives = 138/189 (73.02%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            +R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:    2 EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 189          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q5RBU8|ROA2_PONAB (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii OX=9601 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.438e-62
Identity = 104/188 (55.32%), Postives = 137/188 (72.87%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKHHTINGHNAEVRKALSRQEMQEVQSSRS 201          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|O88569|ROA2_MOUSE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus OX=10090 GN=Hnrnpa2b1 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 6.269e-62
Identity = 104/188 (55.32%), Postives = 137/188 (72.87%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 201          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|P22626|ROA2_HUMAN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 6.269e-62
Identity = 104/188 (55.32%), Postives = 137/188 (72.87%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKES 667
            R  EQFRKLFIGGLSF TTE++L++++EQWG+L D VVMR      +SRGFGFVT+     VDAA A+RPH ID R VE KRA+ R+E+    +H+TVKKLFVG +K++     LRDYF  +G I   EIIT R++G+ RGFGFVT+DD+DPVDKI+L K H I+    EV+KALS++E + +++  S
Sbjct:   15 REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASK-RSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRS 201          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183Q034 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS19970 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 6.064e-87
Identity = 126/193 (65.28%), Postives = 162/193 (83.94%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+ +TTE  LK  + QWGE+VDVVVM+  G+  +SRGFGF+TYK+P+MVDAAQA+RPH ID +TVE KRAMPR+++NS ESHMTV KLFVG LKK+V  ++LR+YF ++GNITECE++ W+E+GESRGFGFVT+DDYDPVDK +L KPH+I + R +VKKALSKE+  ++K K+
Sbjct:    5 NSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMK-DGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          

HSP 2 Score: 65.4698 bits (158), Expect = 1.897e-8
Identity = 32/107 (29.91%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            R+  N+       +KLF+G L        L+D++ ++G I +  ++    T  SRGFGF+TY + + VD     +PH ID K  E K+A+ +E++ S ++  +++ +
Sbjct:    4 RNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKL 110          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183JHD4 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2108 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 9.060e-87
Identity = 126/193 (65.28%), Postives = 162/193 (83.94%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+ +TTE  LK  + QWGE+VDVVVM+  G+  +SRGFGF+TYK+P+MVDAAQA+RPH ID +TVE KRAMPR+++NS ESHMTV KLFVG LKK+V  ++LR+YF ++GNITECE++ W+E+GESRGFGFVT+DDYDPVDK +L KPH+I + R +VKKALSKE+  ++K K+
Sbjct:    5 NSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMK-DGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          

HSP 2 Score: 65.0846 bits (157), Expect = 3.860e-8
Identity = 36/109 (33.03%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGK 685
            R+  N+       +KLF+G L        L+D++ ++G I +  ++    T  SRGFGF+TY + + VD     +PH ID K  E K+A+ +E++ S    ES  T+ K
Sbjct:    4 RNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNS---PESHMTVTK 109          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: C1L9G6 (Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.217e-86
Identity = 126/193 (65.28%), Postives = 162/193 (83.94%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+ +TTE  LK  + QWGE+VDVVVM+  G+  +SRGFGF+TYK+P+MVDAAQA+RPH ID +TVE KRAMPR+++NS ESHMTV KLFVG LKK+V  ++LR+YF ++GNITECE++ W+E+GESRGFGFVT+DDYDPVDK +L KPH+I + R +VKKALSKE+  ++K K+
Sbjct:    5 NSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMK-DGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          

HSP 2 Score: 65.0846 bits (157), Expect = 4.225e-8
Identity = 36/109 (33.03%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGK 685
            R+  N+       +KLF+G L        L+D++ ++G I +  ++    T  SRGFGF+TY + + VD     +PH ID K  E K+A+ +E++ S    ES  T+ K
Sbjct:    4 RNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNS---PESHMTVTK 109          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183VJF7 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS141 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.393e-86
Identity = 127/193 (65.80%), Postives = 163/193 (84.46%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+ +TTE  LK  + QWGE+VDVVVM+  G+  +SRGFGF+TYK+P+MVDAAQA+RPH ID +TVE KRAMPR+++NS ESHMTV KLFVG LKK+V  ++LR+YF ++GNITECE+++W+ETGESRGFGFVT+DDYDPVDK +L KPH+I + R +VKKALSKE+  ++K K+
Sbjct:    5 NSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMK-DGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTQEELREYFSKYGNITECEVVSWKETGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          

HSP 2 Score: 65.855 bits (159), Expect = 6.477e-8
Identity = 32/107 (29.91%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            R+  N+       +KLF+G L        L+D++ ++G I +  ++    T  SRGFGF+TY + + VD     +PH ID K  E K+A+ +E++ S ++  +++ +
Sbjct:    4 RNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKL 110          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: Q86ER1 (Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003498 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.281e-85
Identity = 126/193 (65.28%), Postives = 162/193 (83.94%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+ +TTE  LK  + QWGE+VDVVVM+  G+  +SRGFGF+TYK+P+MVDAAQA+RPH ID +TVE KRAMPR+++NS ESHMTV KLFVG LKK+V  ++LR+YF ++GNITECE++ W+E+GESRGFGFVT+DDYDPVDK +L KPH+I + R +VKKALSKE+  ++K K+
Sbjct:    5 NSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMK-DGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQINTMKKKQ 196          

HSP 2 Score: 65.855 bits (159), Expect = 5.838e-8
Identity = 32/107 (29.91%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            R+  N+       +KLF+G L        L+D++ ++G I +  ++    T  SRGFGF+TY + + VD     +PH ID K  E K+A+ +E++ S ++  +++ +
Sbjct:    4 RNSENNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKL 110          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:103035058])

HSP 1 Score: 200.675 bits (509), Expect = 4.136e-59
Identity = 98/184 (53.26%), Postives = 132/184 (71.74%), Query Frame = 2
Query:   98 NDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            + +  EQ RKLFIGGLSF TTED+L++HFEQWG+L D VVMR  G N +SRGFGFVTY     VDAA  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF  +G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I++  CEV+KAL K+E ++
Sbjct:    5 DSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPG-NKRSRGFGFVTYSCVSEVDAAMGARPHKVDGRIVEPKRAVSREDSNRPGAHLTVKKIFVGGIKEDTEEYHIREYFEHYGKIESIDIMEERPTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQA 187          

HSP 2 Score: 69.707 bits (169), Expect = 1.679e-12
Identity = 35/105 (33.33%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  365 EANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            E + ++    ++KLF+G L  E   D LR +F ++G +T+C ++       SRGFGFVTY     VD  +  +PH +D +  E K+A+S+E++    A  ++  I
Sbjct:    2 EGHDSKEPEQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPGNKRSRGFGFVTYSCVSEVDAAMGARPHKVDGRIVEPKRAVSREDSNRPGAHLTVKKI 106          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 195.667 bits (496), Expect = 4.414e-57
Identity = 95/182 (52.20%), Postives = 131/182 (71.98%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            R  EQ RKLFIGGLSF TT+D+L+++FEQWG L D VVM+    + +SRGFGFVTY + + VDAA  +RPH +D R VE KRA+ R+++N   +HMTVKK+FVG +K++     LRDYF +FG I   EI+  R +G+ RGF FVT+ D+D VD+I++ K H I+    EV+KALS++E ++
Sbjct:    8 RGPEQLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMK-DPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQN 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 195.667 bits (496), Expect = 4.414e-57
Identity = 95/182 (52.20%), Postives = 131/182 (71.98%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            R  EQ RKLFIGGLSF TT+D+L+++FEQWG L D VVM+    + +SRGFGFVTY + + VDAA  +RPH +D R VE KRA+ R+++N   +HMTVKK+FVG +K++     LRDYF +FG I   EI+  R +G+ RGF FVT+ D+D VD+I++ K H I+    EV+KALS++E ++
Sbjct:    8 RGPEQLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMK-DPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQN 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: ENSAMXT00000025677.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:39015044:39015955:-1 gene:ENSAMXG00000024951.2 transcript:ENSAMXT00000025677.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 5.128e-49
Identity = 83/178 (46.63%), Postives = 123/178 (69.10%), Query Frame = 2
Query:  116 QFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            Q  KLF+GGL+  TT++ L+ HFEQ+G+L D VV++   +  +SR FGFVTY  P+  DAA ++RPH++D   VE KRA+ R++A   E+   VKK+FVG LK ++    L + F +FG++ + E+I  ++TG+ RGFGFV +DD D  DK ++LK H I+  + EVKKAL+K+E +S
Sbjct:    4 QLCKLFVGGLNVQTTDEGLRKHFEQYGQLTDCVVVQ-NQQLKRSRCFGFVTYTSPEEADAAMSARPHVLDGNNVEIKRAVAREDAGKPEALAKVKKIFVGGLKDDIEDSHLIECFSQFGSVEKAEVIMDKDTGKKRGFGFVYFDDNDSADKAVVLKFHTINGHKVEVKKALTKQEMQS 180          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: ENSAMXT00000047970.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13999011:14001608:-1 gene:ENSAMXG00000037730.1 transcript:ENSAMXT00000047970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 5.291e-45
Identity = 83/178 (46.63%), Postives = 126/178 (70.79%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEAR 646
            +Q  KLF+GGL+  TT + L++HFEQ+G+L D VV++   +  +SR FGFVTY   +  DAA A+RPH++D + VE KRA+ R++A   E+   VKK+FVG LK+++  ++L +YF +FG I + E+IT ++TG+ RGFGFV ++D D  DK ++LK H I   + EVKKAL+++E +
Sbjct:   13 DQLCKLFVGGLNVQTTNEGLRAHFEQYGKLTDCVVVQ-NEQLQRSRCFGFVTYSSAEEADAAMAARPHVVDGKNVELKRAVAREDAGRPEALAKVKKIFVGGLKEDIEENELNEYFSQFGVIEKSEVITDKDTGKKRGFGFVHFEDNDSADKAVVLKFHTIKGHKVEVKKALTRQEIQ 189          

HSP 2 Score: 67.781 bits (164), Expect = 6.667e-12
Identity = 41/140 (29.29%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  377 AESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSNGGMMGFMGDMR-----NEINNRYDNFG 781
            AE+   + KLFVG L  +   + LR +F ++G +T+C ++   +   SR FGFVTY   +  D  +  +PH +D K  E+K+A+++E+A   +A   +  I                 F+G ++     NE+N  +  FG
Sbjct:    9 AETMDQLCKLFVGGLNVQTTNEGLRAHFEQYGKLTDCVVVQNEQLQRSRCFGFVTYSSAEEADAAMAARPHVVDGKNVELKRAVAREDAGRPEALAKVKKI-----------------FVGGLKEDIEENELNEYFSQFG 131          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 5.460e-61
Identity = 95/183 (51.91%), Postives = 134/183 (73.22%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            DR  EQFRKLF+GGLSF TTE+ L+ +FEQWG L D VVM+   ++ +SRGFGFVT+     VDAA ++RPH ID R VE KRA+ R+++    +H++VKK+FVG +K +   + LRDYF ++G I   E++T RE+G+ RGF FVT++D+DPVDKI++ K H I+   CE++KAL K+E ++
Sbjct:    4 DREPEQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMK-DTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQN 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 190.274 bits (482), Expect = 1.065e-57
Identity = 92/176 (52.27%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            EQ RKLFIGGLSF TTED+++ HFEQWG L D VVMR      +SRGFGFVTY  P+ VDAA  +RPH +D R VE KRA+ R+++    +H+ VKK+FVG ++ +     LR+YF  +G++   E++  R TG+ RGFGFVT+ D+D VDK+++ K H I+  + EV+KALSK+E
Sbjct:    6 EQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMR-DPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQE 180          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 189.889 bits (481), Expect = 5.325e-57
Identity = 91/187 (48.66%), Postives = 131/187 (70.05%), Query Frame = 2
Query:  104 RSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            +  EQ RKLFIGGLSF TTE++L+ ++EQWG +VD VVM+    + +SRGFGF+TY   + V++A  +RPH +D R VE KRA+PRD++      +TVKKLFVG +K       LRDYF +FG +   +++T ++TG+ RGF FVT+DDYDPVD+I+  K H I+  + EV+KALS+ E  +++  +
Sbjct:    8 KEPEQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMK-DPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPG-IQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMETMQMNQ 192          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 190.274 bits (482), Expect = 9.205e-56
Identity = 93/180 (51.67%), Postives = 125/180 (69.44%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSL 652
            EQ RKLFIGGLSF TTE++++ HFEQWG L D VVMR      +SRGFGFVTY   + VDAA   RPH +D R VE KRA+ R+++    +H+ VKK+FVG +K     D LRDYF  +G +   +++  R++G+ RGFGFVT+ D+D VDK+++ K H I+  + EV+KALSK+E  SL
Sbjct:   30 EQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMR-DPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSL 208          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 80.4925 bits (197), Expect = 4.318e-17
Identity = 35/54 (64.81%), Postives = 41/54 (75.93%), Query Frame = -2
Query: 1398 KSAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 1559
            + +HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:  181 RPSHYHVLWDDNRFSADELQVLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 234          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 129.028 bits (323), Expect = 1.638e-32
Identity = 69/188 (36.70%), Postives = 120/188 (63.83%), Query Frame = 2
Query:  110 SEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYID--NKRCEVKKALSKEEARSLKAKES 667
            S++  K+FIGGL++ TTED L+ +F ++G + D+ +M+     G+SRGFGF++++ P  VD    ++ HI+D + ++ KRA+PRDE +         K+FVG +  +V   +  ++F ++G I + +++  ++TG+SRGFGFVTYD  D VD++   K  +ID  +++ E+K+A    E R ++ K S
Sbjct:  155 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMK-DPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDEQDK------TGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNK--FIDFKDRKIEIKRA----EPRHMQQKSS 328          

HSP 2 Score: 68.5514 bits (166), Expect = 9.752e-13
Identity = 31/94 (32.98%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            ++E + A+      K+F+G L  +   D+LR+YFG++G +T+ +I+    TG SRGFGF++++    VD+++  + H +D K  + K+A+ ++E
Sbjct:  146 KEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDE 238          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 62.3882 bits (150), Expect = 6.875e-11
Identity = 46/182 (25.27%), Postives = 85/182 (46.70%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAA-QASRPHIIDERTVETKRAMPRDEANSAESHM-------TVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKIL-LLKPHYIDNK 604
            N+   +  +E+   +F+G LS+   ++ LK  FE  G ++   V+   G + +SRG+G+V +++    + A Q  +   ID R +    +  +   N+  +             LF+G L      D + + F + G +    I T  ET + +GFG+V + + +   K L  L+  YIDN+
Sbjct:  156 NKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTD-RSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNR 336          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 61.6178 bits (148), Expect = 1.346e-10
Identity = 44/146 (30.14%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTY-KDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYD 556
            R L++G L    TED LK +F+  G + ++ +M    KN K+  + FV Y +  D   A Q      I+   V+   A    +++S ++      LFVG L   V  + LR+ F  F +     ++   +TG SRG+GFV++   D
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMI--DKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTF----NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 214          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 54.6842 bits (130), Expect = 2.038e-8
Identity = 52/212 (24.53%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTY-KDPDMVDAAQASRPHIIDERTVETKRAMPRDE-----ANSAESHMTVK-------KLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDK--------ILLLKPHYID-NKRCEVKKALSKEEARSLKAKESM 670
            + +   +  L++  ++  TT++  +  F ++G +V   + +    +GK +GFGFV Y K  D V A +A     ++   +   RA  ++E         E++   K        LFV  L   V  + L + F  +G IT  +++   E G+S+GFGFV +   +   K        I+  KP Y+   +R +V+++   + A+ ++A+  M
Sbjct:  212 EETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEK--DADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRT-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRS---QLAQQIQARNQM 417          

HSP 2 Score: 50.8322 bits (120), Expect = 3.745e-7
Identity = 43/175 (24.57%), Postives = 80/175 (45.71%), Query Frame = 2
Query:  128 LFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMV-DAAQASRPHIIDERTVETKRAMPRDEANSA--ESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDY-DPVDKILLLKPHYIDNKRCEVKKALSKEE 640
            +FI  L       AL   F  +G+++   +     +NGKS+GFGFV +++     +A  A    +++ + +     + R E +S   E+      L+V  +  E   +  ++ F +FG I     +     G+ +GFGFV Y+ + D V  +  L    ++ ++  V +A  K E
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIAT--DENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSAS-LEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNE 299          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 48.521 bits (114), Expect = 1.459e-6
Identity = 42/163 (25.77%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  128 LFIGGLSFVTTEDALKSHF---------------EQWGELVDVVVMRMGGKNG---KSRGFGFVTYKDPDMVDAA-QASRPHIIDERTV----ETKRAMP-RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTY 544
            ++IG LSF TT+D L   F               EQ  ++  + + R+  KN    K++GF ++ +K+ + + A  + S  H+     +    E     P +D+  +   +   + LFVG L  +V  D LR +F   G+I +  + T+ ++G+ +GF F+ +
Sbjct:  127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQ--DITRLSMPRVAAKNSNAMKNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDF 287          

HSP 2 Score: 47.7506 bits (112), Expect = 2.531e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGG--KNGKSRGFGFVTYKD 277
            R LF+G LSF  T+D L+ HF+  G   D+V +RM     +GK +GF F+ +K+
Sbjct:  239 RILFVGNLSFDVTDDLLRKHFQHCG---DIVKIRMATFEDSGKCKGFAFIDFKN 289          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 144.436 bits (363), Expect = 1.053e-40
Identity = 72/174 (41.38%), Postives = 114/174 (65.52%), Query Frame = 2
Query:  125 KLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRF------GNITECEIITWRETGES-RGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKA 625
            K+FIGGL++ TTE+ LK +F QWG +VD V+M+   ++G+SRGFGFVTY+  D V+     + H++D+R +E KR++PRDE+ + E+    +K+FVG L    V +D+++YF         G + + ++   R+  +  RGF FVT+D+ + V+K+  +K H I  K+CEVKKA
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK---RDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKA 171          

HSP 2 Score: 68.5514 bits (166), Expect = 1.326e-13
Identity = 36/95 (37.89%), Postives = 59/95 (62.11%), Query Frame = 2
Query:  401 KLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGK 685
            K+F+G L      + L+DYF ++G I +C I+  +  G SRGFGFVTY+  D V+++L  K H +D++  E K+++ ++E+    A E+MS   K
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDES---GAPEAMSKTRK 90          

HSP 3 Score: 53.5286 bits (127), Expect = 2.384e-8
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQW------GELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPR 361
            RK+F+GGL+  T E+ +K +F         GE++DV + R      + RGF FVT+ + ++V+   A + H I  +  E K+A P+
Sbjct:   89 RKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 137.117 bits (344), Expect = 7.854e-38
Identity = 75/177 (42.37%), Postives = 108/177 (61.02%), Query Frame = 2
Query:  125 KLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLK 655
            K+FIGGLS+ TT + L+ HFE++GEL + VVMR      +SRGFGF+T+KDP  VD    S    +D + ++ K A+P+     A+   T KK+F+G L      +D++ YF +FG ITE  ++  + T   RGFGFVT++  +  DK    + H I+NK+ EVKKA  KE   SL+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMR-DPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAP--AKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKEVMYSLQ 174          

HSP 2 Score: 65.0846 bits (157), Expect = 2.352e-12
Identity = 30/81 (37.04%), Postives = 54/81 (66.67%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRD 364
            +K+FIGGLS  T+E+ +K +F Q+G++ + ++M       + RGFGFVT++  +  D A  ++ H+I+ + VE K+A P++
Sbjct:   89 KKIFIGGLSTNTSEEDMKKYFSQFGKITETMLM-FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 132.109 bits (331), Expect = 1.235e-34
Identity = 73/173 (42.20%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  125 KLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAA-QASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGR-FGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKE 637
            KLF+GGLS+ TT+++LK +F ++GELV V + +M    G+ RGF FV +K     DA      PH++D RT++ K A P  +      H+ VKK+FVG LK E   + +R+YFG+ +  + E E IT   +   RGF FV++D  D VDKI   + H I+  + EVK+AL KE
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDI-KMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGKP----PHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          

HSP 2 Score: 52.373 bits (124), Expect = 1.833e-7
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  371 NSAESHMT----VKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKIL-LLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            +S ++ MT    + KLFVG L  E   + L++YF ++G +   +I     TG  RGF FV +      D +L  + PH +D +  + K A    +   L+ K+
Sbjct:   16 DSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGKPPHLRVKK 118          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 108.997 bits (271), Expect = 1.226e-27
Identity = 69/193 (35.75%), Postives = 108/193 (55.96%), Query Frame = 2
Query:   80 MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASR----PHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRF--GNITECEIITWRE-TGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKE 637
            M NR +N  +  +  KLF+GGL+  TT + L+ +FE +GEL DVVV+       KSRGFG+VT+ D  +       +     H ID + VE KRA+PRD+ NSA SH   KK+FVG L ++   +D+++         + + ++I  +E   + RGF FV  ++ D  D++  +K  ++  K  E KKA  ++
Sbjct:    1 MENRQENTNNDPRA-KLFVGGLNRETTNETLREYFEAYGELTDVVVI-CDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD-NSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190          

HSP 2 Score: 63.929 bits (154), Expect = 6.514e-12
Identity = 34/84 (40.48%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  401 KLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLK----PHYIDNKRCEVKKALSKEE 640
            KLFVG L +E   + LR+YF  +G +T+  +I    T +SRGFG+VT+ DY     +L  K     H ID K  EVK+A+ +++
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 105.145 bits (261), Expect = 1.459e-26
Identity = 56/163 (34.36%), Postives = 87/163 (53.37%), Query Frame = 2
Query:  122 RKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAE--SHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNK 604
            RK+F+GGL+  T    L+ +FE++GE+ D V+M       +SR FGF+T++DP +V      +PH +D + ++ K A+PR         +     K+FVG L       DL DYF  +G +    ++   +T + RGFGFVT++  D V K      H I+ K
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLM-TDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGK 162          

HSP 2 Score: 58.9214 bits (141), Expect = 2.528e-10
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  398 KKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSK 634
            +K+FVG L     +  L+ YF ++G +T+C ++T   T  SR FGF+T+ D   V  ++  KPH +D K  + K A+ +
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPR 79          

HSP 3 Score: 49.6766 bits (117), Expect = 3.229e-7
Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  125 KLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTV 337
            K+F+GGL+  T++  L+ +F  +G++V V +M +  +  K RGFGFVT++  D V  A     H I+ +TV
Sbjct:   95 KIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLM-VDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000010040.2 (heterogeneous nuclear ribonucleoprotein A1 [Source:NCBI gene;Acc:101174914])

HSP 1 Score: 204.912 bits (520), Expect = 5.501e-61
Identity = 99/185 (53.51%), Postives = 135/185 (72.97%), Query Frame = 2
Query:   95 DNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            D  R  EQ RKLFIGGLSF TT+++L++HFEQWG L D VVMR    + +SRGFGFVTY     VDAA ++RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     LRDYF +FG I   +I+T R TG+ RGF FVT+DD+D VD+I++ K H I++  CEV+KAL+K+E ++
Sbjct:    4 DVPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMR-DPNSKRSRGFGFVTYSSVQEVDAAMSARPHKVDGRVVEPKRAVSREDSNRPGAHITVKKIFVGGIKEDTEESHLRDYFQQFGKIEVIDIMTDRNTGKKRGFAFVTFDDHDSVDRIVIQKYHTINSHNCEVRKALTKQEMQT 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 196.052 bits (497), Expect = 1.428e-57
Identity = 97/194 (50.00%), Postives = 134/194 (69.07%), Query Frame = 2
Query:   92 NDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMS 673
            N + +  EQ RKLFIGGLSF TTE++L++HFEQWG L D VVMR    + +SRGFGFVTY +   VD A  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF ++G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I+   CEV+KALSK+E  ++ +    S
Sbjct:    3 NRDAKEPEQLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMR-DPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTISSNRGRS 195          

HSP 2 Score: 71.633 bits (174), Expect = 3.833e-13
Identity = 35/105 (33.33%), Postives = 61/105 (58.10%), Query Frame = 2
Query:  365 EANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI 679
            E   A+    ++KLF+G L  E   + LR +F ++G++T+C ++    +  SRGFGFVTY +   VD  +  +PH +D +  E K+A+S+E++    A  ++  I
Sbjct:    2 ENRDAKEPEQLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKI 106          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 196.052 bits (497), Expect = 2.176e-57
Identity = 97/194 (50.00%), Postives = 134/194 (69.07%), Query Frame = 2
Query:   92 NDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMS 673
            N + +  EQ RKLFIGGLSF TTE++L++HFEQWG L D VVMR    + +SRGFGFVTY +   VD A  +RPH +D R VE KRA+ R+++N   +H+TVKK+FVG +K++     +R+YF ++G I   +I+  R TG+ RGF FVT+DD+D VDKI+  K H I+   CEV+KALSK+E  ++ +    S
Sbjct:   12 NRDAKEPEQLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMR-DPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTISSNRGRS 204          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000036181.1 (heterogeneous nuclear ribonucleoprotein A0-like [Source:NCBI gene;Acc:101168026])

HSP 1 Score: 160.614 bits (405), Expect = 9.840e-45
Identity = 79/183 (43.17%), Postives = 116/183 (63.39%), Query Frame = 2
Query:  101 DRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            D SS    KLF+GGL   T +D L+ HFEQ+G L+D  V+       +SR FGFVTY  P+  +AA A+ PH ++   VE KRA+P+ + + +E+   VKK+FVG LK ++  DDL DYF +FG +   EI++ +ETG+ RGFGFV + D+   D  + +  H ++  R EVKKA+ K+E ++
Sbjct:    2 DPSSPLTCKLFVGGLKVDTNDDGLRKHFEQFGTLIDCAVVPHKTAQ-RSRCFGFVTYLTPEEANAAMAASPHTVEGNWVEVKRAVPKKQTDESEARDKVKKIFVGGLKNDIQEDDLTDYFSQFGEVENSEIMSEKETGKKRGFGFVHFTDHYAADMAVAVPFHTVNGHRVEVKKAVPKQEMQA 183          

HSP 2 Score: 61.2326 bits (147), Expect = 6.683e-10
Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 2
Query:   89 RNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDE 367
            + D   + ++ +K+F+GGL     ED L  +F Q+GE+ +  +M    + GK RGFGFV + D    D A A   H ++   VE K+A+P+ E
Sbjct:   89 QTDESEARDKVKKIFVGGLKNDIQEDDLTDYFSQFGEVENSEIMSE-KETGKKRGFGFVHFTDHYAADMAVAVPFHTVNGHRVEVKKAVPKQE 180          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000044874.1 (heterogeneous nuclear ribonucleoprotein A0-like [Source:NCBI gene;Acc:101170194])

HSP 1 Score: 159.073 bits (401), Expect = 2.774e-44
Identity = 77/181 (42.54%), Postives = 116/181 (64.09%), Query Frame = 2
Query:  107 SSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARS 649
            +SE+   LF+GGL   T +D L+ HFEQ+G L+D  V+       +SR FGFVTY  P+  +AA A+ PH ++   VE KRA+P+ + + +E+   VKK+FVG LK ++  DDL DYF +FG +   EI++ +ETG+ RGFGFV + D+   D  + +  H ++  R EVKKA+ K+E ++
Sbjct:    3 NSEKKEDLFVGGLKVDTNDDGLRKHFEQFGTLIDCAVVPHKTAQ-RSRCFGFVTYLTPEEANAAMAASPHTVEGNWVEVKRAVPKKQTDESEARDKVKKIFVGGLKNDIQEDDLTDYFSQFGEVENSEIMSEKETGKKRGFGFVHFTDHYAADMAVAVPFHTVNGHRVEVKKAVPKQEMQA 182          

HSP 2 Score: 62.7734 bits (151), Expect = 2.023e-10
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query:   89 RNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSA 379
            + D   + ++ +K+F+GGL     ED L  +F Q+GE+ +  +M    + GK RGFGFV + D    D A A   H ++   VE K+A+P+ E  +A
Sbjct:   88 QTDESEARDKVKKIFVGGLKNDIQEDDLTDYFSQFGEVENSEIMSE-KETGKKRGFGFVHFTDHYAADMAVAVPFHTVNGHRVEVKKAVPKQEMQAA 183          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000050993.1 (SMESG000050993.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 272/274 (99.27%), Postives = 274/274 (100.00%), Query Frame = 2
Query:   80 MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSNGGMMGFMGDMRNEINNRYDNFGYQDYDDRFGRYPNQGYSGGPVRGNLSYRNQPYSGRMRRDY 901
            MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIID+RTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSNGGMMGFMGDMRNEINNRYDNFGYQDYDDRFGRYPNQGYSGGP+RGNLSYRNQPYSGRMRRDY
Sbjct:    1 MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDDRTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSNGGMMGFMGDMRNEINNRYDNFGYQDYDDRFGRYPNQGYSGGPMRGNLSYRNQPYSGRMRRDY 274          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000025890.1 (SMESG000025890.1)

HSP 1 Score: 259.61 bits (662), Expect = 3.868e-82
Identity = 120/193 (62.18%), Postives = 153/193 (79.27%), Query Frame = 2
Query:   86 NRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKE 664
            N  +NDR +EQFRKLFIGGL+  T E  L+ ++EQWGELVD VVM+   K G+SRGFGFVTY+DP+MVD AQ +RPH +D + VE KRAMPR+++N+ ESHMTV KLFVG LKK+V  + LR YF  +G IT+CEI+TW+++GESRGFGFVT+DDYDPVDK +L KPH I + R +VKKALSK+E   ++ K+
Sbjct:    5 NTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMK-DNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEIRRKQ 196          

HSP 2 Score: 66.2402 bits (160), Expect = 1.572e-11
Identity = 37/109 (33.94%), Postives = 61/109 (55.96%), Query Frame = 2
Query:  359 RDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGK 685
            R+  N+       +KLF+G L  +     LR Y+ ++G + +  ++   +TG SRGFGFVTY D + VD+    +PH +D K  E K+A+ +E++ +    ES  T+ K
Sbjct:    4 RNTENNDRRTEQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNT---PESHMTVNK 109          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000080165.1 (SMESG000080165.1)

HSP 1 Score: 241.891 bits (616), Expect = 7.599e-75
Identity = 115/197 (58.38%), Postives = 152/197 (77.16%), Query Frame = 2
Query:   95 DNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGK 685
            D +R SEQFRKLFIGGL+  T+E+ L+ +++QWGELVD VVM+    +G+SRGFGFVTYK+  MVD AQ +RPH ID + VE KRAMPR+++   E+HMTV KLFVG LKKE+V  +L DYF  +G + ECEI++W++TG+SRGFGFV +DDYDPVDK +L KPH+I + + +VKKALSKEE   +K K+  S + +
Sbjct:    9 DQERISEQFRKLFIGGLTPNTSEEKLRKYYQQWGELVDAVVMK-DCNSGRSRGFGFVTYKEVFMVDEAQNNRPHEIDGKIVEAKRAMPREDSIHPEAHMTVTKLFVGGLKKEIVNQELVDYFTDYGIVIECEIVSWKDTGKSRGFGFVLFDDYDPVDKAILYKPHFIQSSKIDVKKALSKEEIFEIKRKKQSSHLQR 204          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000081075.1 (SMESG000081075.1)

HSP 1 Score: 205.682 bits (522), Expect = 1.897e-61
Identity = 108/201 (53.73%), Postives = 140/201 (69.65%), Query Frame = 2
Query:  113 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSN 715
            E+ +KLFIGGL   TTE++LK  + QWGE+VDVVVMR   + GKSRGFGFVTY D   VD AQ++RPH +D   V++KRAMP+++  S E H TV +LFVG LK+ VVADDLR YFG +G I +  II     GESRGFGFVT+DD D VDKI++ +PH +D    EVKKAL +++ +S  +K+S + +G    P    SN
Sbjct:    7 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMR-DPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIIN-NSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS-NSKQS-NPVGNKSTPRGGYSN 202          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000050994.1 (SMESG000050994.1)

HSP 1 Score: 164.466 bits (415), Expect = 7.979e-43
Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = -2
Query: 1275 KSAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLXXXXXXXXXXXXXXXXXXSESQILINEFHHDKLFFI 1559
            K AHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLSDDDSSSTTSGHSTRTDTSESQILINEFHHDKLFFI
Sbjct: 1162 KPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLSDDDSSSTTSGHSTRTDTSESQILINEFHHDKLFFI 1256          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA2B14.903e-6355.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B14.903e-6355.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.305e-6255.32heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.305e-6255.32heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B13.550e-6257.54heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-17.657e-5146.59Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-17.657e-5146.59Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-17.855e-5146.59Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-17.855e-5146.59Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-13.243e-4343.27Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hrb98DE1.797e-5953.55gene:FBgn0001215 transcript:FBtr0085299[more]
Hrb87F1.996e-5955.68gene:FBgn0004237 transcript:FBtr0310621[more]
Hrb87F1.996e-5955.68gene:FBgn0004237 transcript:FBtr0300590[more]
Hrb87F1.996e-5955.68gene:FBgn0004237 transcript:FBtr0334495[more]
Hrb87F1.996e-5955.68gene:FBgn0004237 transcript:FBtr0082851[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa32.612e-6053.26heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa31.136e-5953.26heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa32.723e-5953.26heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1a1.466e-5851.34heterogeneous nuclear ribonucleoprotein A1a [Sourc... [more]
hnrnpa1b8.806e-5753.07heterogeneous nuclear ribonucleoprotein A1b [Sourc... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa2b12.577e-6355.68heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b13.078e-6355.68heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b13.753e-6355.68heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b18.162e-6355.68heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
psd32.995e-6051.32pleckstrin and Sec7 domain containing 3 [Source:Xe... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpa2b18.301e-6455.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b18.301e-6455.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b18.301e-6455.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b13.366e-6355.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b13.366e-6355.03heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TTV2|ROA2_SAGOE6.097e-6355.03Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q2HJ60|ROA2_BOVIN2.355e-6255.03Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q5RBU8|ROA2_PONAB3.438e-6255.32Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|O88569|ROA2_MOUSE6.269e-6255.32Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|P22626|ROA2_HUMAN6.269e-6255.32Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183Q0346.064e-8765.28Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183JHD49.060e-8765.28Uncharacterized protein OS=Schistosoma curassoni O... [more]
C1L9G61.217e-8665.28Heterogeneous nuclear ribonucleoprotein A2 homolog... [more]
A0A183VJF71.393e-8665.80Uncharacterized protein OS=Trichobilharzia regenti... [more]
Q86ER11.281e-8565.28Heterogeneous nuclear ribonucleoprotein A2 homolog... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa34.136e-5953.26heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1a4.414e-5752.20heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa1a4.414e-5752.20heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
ENSAMXT00000025677.25.128e-4946.63pep primary_assembly:Astyanax_mexicanus-2.0:24:390... [more]
ENSAMXT00000047970.15.291e-4546.63pep primary_assembly:Astyanax_mexicanus-2.0:24:139... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004893.15.460e-6151.91pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA01.065e-5752.27heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA2B15.325e-5748.66heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA09.205e-5651.67heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ago24.318e-1764.81argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP11.638e-3236.70Subunit of cleavage factor I; cleavage factor I is... [more]
NSR16.875e-1125.27Nucleolar protein that binds nuclear localization ... [more]
PUB11.346e-1030.14Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
PAB12.038e-824.53Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NOP131.459e-625.77Nucleolar protein found in preribosomal complexes;... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493491.053e-4041.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398797.854e-3842.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384171.235e-3442.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365221.226e-2735.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333891.459e-2634.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010040.25.501e-6153.51heterogeneous nuclear ribonucleoprotein A1 [Source... [more]
hnrnpa31.428e-5750.00heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa32.176e-5750.00heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
ENSORLT00000036181.19.840e-4543.17heterogeneous nuclear ribonucleoprotein A0-like [S... [more]
ENSORLT00000044874.12.774e-4442.54heterogeneous nuclear ribonucleoprotein A0-like [S... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050993.10.000e+099.27SMESG000050993.1[more]
SMESG000025890.13.868e-8262.18SMESG000025890.1[more]
SMESG000080165.17.599e-7558.38SMESG000080165.1[more]
SMESG000081075.11.897e-6153.73SMESG000081075.1[more]
SMESG000050994.17.979e-4398.95SMESG000050994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011690 ID=SMED30011690|Name=Heterogeneous nuclear ribonucleoprotein A2|organism=Schmidtea mediterranea sexual|type=transcript|length=1614bp
TTTGATTTTGTTTTACTTATATACAAAGTTATATTCTGCCATTTTGTTTA
TTAATTTATTGTATACTATTTAATTTTTAATGTCAAACAGAAATGATAAT
GATCGATCATCTGAACAATTTAGGAAGTTGTTTATTGGAGGTTTAAGTTT
TGTTACAACCGAAGATGCTCTGAAGTCTCATTTTGAGCAATGGGGAGAAC
TTGTCGATGTTGTAGTAATGCGTATGGGTGGCAAAAATGGAAAGTCGAGG
GGATTTGGATTTGTAACTTATAAAGATCCCGATATGGTTGATGCAGCTCA
AGCCAGTAGACCACATATAATTGATGAAAGAACAGTTGAAACCAAAAGGG
CAATGCCTCGCGATGAAGCAAATTCCGCAGAGTCTCATATGACCGTTAAA
AAGTTGTTTGTAGGTGCATTGAAAAAAGAAGTTGTGGCAGATGATTTAAG
AGATTATTTTGGTCGATTTGGTAACATAACGGAGTGCGAAATTATAACTT
GGAGAGAAACTGGTGAATCACGTGGTTTTGGGTTTGTGACATACGACGAC
TATGATCCAGTTGATAAAATTTTACTTCTCAAACCACATTATATAGACAA
CAAGCGCTGTGAAGTTAAAAAAGCACTGAGTAAAGAAGAGGCCAGATCCT
TAAAAGCCAAGGAGAGCATGAGTACAATTGGTAAGTCAAAGTTTCCTTCT
ATGTCACAATCTAATGGTGGAATGATGGGCTTTATGGGTGATATGCGAAA
CGAAATAAATAATCGTTATGATAATTTTGGTTATCAGGATTATGATGATA
GGTTTGGTCGTTATCCTAATCAGGGTTACAGTGGAGGGCCTGTGAGAGGA
AATTTGAGTTACAGGAATCAGCCATATAGTGGAAGGATGAGGAGAGATTA
TTAAAATCGGTCTAGCTTGTAAGAGATCTTAGTGATTTAGAGTGATTATA
TAGAATGATTAACGATTCTAGGAATACTGAGAGCAGTTACTGAGGGATAA
ACTATCATATAATTCCGTAGTTTACAGTTATGTTAAGTTATTGAGCTTAG
CTATTGAGTCAGTGACAATTTATCGTATTCAAGCTAGAAGATTGTAATTG
TACAATAGTGATCGGCATTTTATACATTTGACTTTTAATCATTCGCATAG
TTAATTTAATGTTTGTTATTTTTTATTGAAATAGAGGTGCCTAAGAATTT
AGTATTTTATTAATTAAAGCATAGGGTTACGATTGTTAGTTATTAATAAA
TAACAAGTGATACATTTTTATTTAAATAAAAAATAATTTGTCATGATGAA
ATTCGTTGATCAGAATTTGTGATTCACTGGTATCGGTTCTTGTGCTATGA
CCAGATGTAGTACTGCTGCTGTCATCATCGGACAGTCCGATCAAAGTTCT
TCCTCTAAAGGCTGCCAAGTGTGCATAGTAAGTGGGAGCTGGATATGAAA
CGCTTCTGGTACATCTCGCATAAATATGGCATAAAAAGTAAGTAAAGCTC
TGCAACTCGTCTGATCCCCAATTATTTTCATCAAAAAGAACATGGTAATG
CGCAGATTTTTATTGGTAATATAAAGGAAATGAAATTGTGAATTAAAAAC
TGTTATTGTATTAA
back to top

protein sequence of SMED30011690-orf-1

>SMED30011690-orf-1 ID=SMED30011690-orf-1|Name=SMED30011690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MSNRNDNDRSSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMG
GKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDERTVETKRAMPRDEANSA
ESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGF
GFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTI
GKSKFPSMSQSNGGMMGFMGDMRNEINNRYDNFGYQDYDDRFGRYPNQGY
SGGPVRGNLSYRNQPYSGRMRRDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR012337RNaseH-like_sf
IPR003165Piwi
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 16..89
e-value: 1.5E-20
score: 84.3
coord: 108..180
e-value: 1.1E-17
score: 74.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 17..76
e-value: 4.2E-14
score: 52.1
coord: 109..174
e-value: 5.5E-13
score: 48.5
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 15..93
score: 15.409
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 107..184
score: 15.392
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 5..98
e-value: 4.3E-23
score: 83.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 101..182
e-value: 7.1E-22
score: 79.4
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 103..268
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 12..101
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 103..268
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 12..101
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 13..141
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 107..244