CBFD_NFYB_HMF domain-containing protein

Overview
NameCBFD_NFYB_HMF domain-containing protein
Smed IDSMED30011687
Length (bp)481
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CBFD_NFYB_HMF domain-containing protein (SMED30011687) t-SNE clustered cells

Violin plots show distribution of expression levels for CBFD_NFYB_HMF domain-containing protein (SMED30011687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CBFD_NFYB_HMF domain-containing protein (SMED30011687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CBFD_NFYB_HMF domain-containing protein (SMED30011687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011687SMESG000070171.1 SmedASXL_000275SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011687SMESG000070171.1 SmedASXL_000275SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011687SMESG000070171.1 dd_Smed_v4_12599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30011687SMESG000070171.1 dd_Smed_v6_12599_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30011687SMESG000070171.1 dd_Smed_v4_12599_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011687SMESG000070171.1 SMED_07069_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011687SMESG000070171.1 SMED_07069_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Human
Match: DRAP1 (DR1 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:3019])

HSP 1 Score: 56.6102 bits (135), Expect = 8.016e-10
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Human
Match: DRAP1 (DR1 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:3019])

HSP 1 Score: 56.6102 bits (135), Expect = 8.541e-10
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Human
Match: POLE4 (DNA polymerase epsilon 4, accessory subunit [Source:HGNC Symbol;Acc:HGNC:18755])

HSP 1 Score: 52.7582 bits (125), Expect = 5.392e-9
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +R+KA++K + ++ +   ++I ++ +AAE FVE + K A   AQ   +KT+ +  L   I+      FL+G LD
Sbjct:   41 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD 117          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Celegans
Match: pole-4 (pep chromosome:WBcel235:II:14968633:14969354:-1 gene:WBGene00013150.1 transcript:Y53F4B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pole-4)

HSP 1 Score: 52.373 bits (124), Expect = 8.763e-9
Identity = 31/102 (30.39%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  180 IIDASFKDNEELDEHIATKNLF---FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            I   S +D  E++EH+  + L     P  R+K ++++N ++ ++NN+++ L+ KAAE F++EL   A   A L  +KT+    + + I       FL+  LD
Sbjct:   13 IAQMSEEDVREIEEHV--EELVRSQLPLGRVKKVVRMNPDVEMLNNEALQLMAKAAELFIKELSNAANQNAALEKRKTVQTKDIDKAIKKTWAFAFLEDALD 112          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Fly
Match: Chrac-16 (gene:FBgn0043001 transcript:FBtr0073642)

HSP 1 Score: 52.373 bits (124), Expect = 5.540e-9
Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  219 EHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNK--KTITKNHLIEFIDDNSNMNFL 461
            E   T   F P SR++ I+K + + G+I N+ + L+ K  E FV  L  GAAY  +   +  + +   HL + ++ N N+ FL
Sbjct:   11 ERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLA-GAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFL 92          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Fly
Match: Chrac-16 (gene:FBgn0043001 transcript:FBtr0339625)

HSP 1 Score: 52.373 bits (124), Expect = 5.540e-9
Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  219 EHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNK--KTITKNHLIEFIDDNSNMNFL 461
            E   T   F P SR++ I+K + + G+I N+ + L+ K  E FV  L  GAAY  +   +  + +   HL + ++ N N+ FL
Sbjct:   11 ERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLA-GAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFL 92          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Fly
Match: Mes4 (gene:FBgn0034726 transcript:FBtr0071827)

HSP 1 Score: 46.595 bits (109), Expect = 8.338e-7
Identity = 24/77 (31.17%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +RI+ I+KL+ ++ + NN+++ ++ KA E F+  L + +  +   S KKTI K  +   I    ++ FLDG ++
Sbjct:   78 LPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLDGAMN 154          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Fly
Match: Mes4 (gene:FBgn0034726 transcript:FBtr0301243)

HSP 1 Score: 46.595 bits (109), Expect = 8.338e-7
Identity = 24/77 (31.17%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +RI+ I+KL+ ++ + NN+++ ++ KA E F+  L + +  +   S KKTI K  +   I    ++ FLDG ++
Sbjct:   78 LPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLDGAMN 154          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:ZFIN;Acc:ZDB-GENE-050522-309])

HSP 1 Score: 53.5286 bits (127), Expect = 2.170e-9
Identity = 30/80 (37.50%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL---IEFIDDNSNMNFLDGMLD 476
             P SRIK ++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L   IE ID+     FL+G LD
Sbjct:   51 LPLSRIKTLMKADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE---FAFLEGTLD 127          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Match: drap1 (DR1-associated protein 1 (negative cofactor 2 alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-400])

HSP 1 Score: 53.1434 bits (126), Expect = 9.115e-9
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+  A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLTKACDVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:ZFIN;Acc:ZDB-GENE-050522-309])

HSP 1 Score: 48.9062 bits (115), Expect = 2.343e-7
Identity = 28/77 (36.36%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL---IEFIDDNSNMNFLDG 467
             P SRIK ++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L   IE ID+     FL+G
Sbjct:   51 LPLSRIKTLMKADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE---FAFLEG 124          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:ZFIN;Acc:ZDB-GENE-050522-309])

HSP 1 Score: 46.595 bits (109), Expect = 5.482e-7
Identity = 21/59 (35.59%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL 422
             P SRIK ++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L
Sbjct:   51 LPLSRIKTLMKADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDL 109          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:ZFIN;Acc:ZDB-GENE-050522-309])

HSP 1 Score: 46.595 bits (109), Expect = 6.146e-7
Identity = 21/59 (35.59%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL 422
             P SRIK ++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L
Sbjct:   51 LPLSRIKTLMKADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDL 109          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:NCBI gene;Acc:549359])

HSP 1 Score: 57.7658 bits (138), Expect = 5.640e-11
Identity = 29/81 (35.80%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  234 KNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            K    P SRIKA++K + ++ + + +S+ +I+KA E F+E + K A  +AQ   +KT+ +  L   ID      FL+G LD
Sbjct:   33 KQARLPLSRIKALMKADPDLSLASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLDNAIDAIDEFAFLEGTLD 113          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:NCBI gene;Acc:549359])

HSP 1 Score: 50.8322 bits (120), Expect = 3.123e-8
Identity = 23/70 (32.86%), Postives = 43/70 (61.43%), Query Frame = 3
Query:  234 KNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDN 443
            K    P SRIKA++K + ++ + + +S+ +I+KA E F+E + K A  +AQ   +KT+ +  L  +I ++
Sbjct:   33 KQARLPLSRIKALMKADPDLSLASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLGMYIAED 102          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Xenopus
Match: arl14 (ADP ribosylation factor like GTPase 14 [Source:Xenbase;Acc:XB-GENE-5750500])

HSP 1 Score: 48.1358 bits (113), Expect = 8.789e-7
Identity = 24/69 (34.78%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  255 SRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            +RIK I++ + EIG +      +I++A E F+E L+K A    Q  + KT+T +HL + I+     +FL
Sbjct:    1 ARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRSAKTMTTSHLKQCIELEQQFDFL 69          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Match: Drap1 (Dr1 associated protein 1 (negative cofactor 2 alpha) [Source:MGI Symbol;Acc:MGI:1913806])

HSP 1 Score: 56.6102 bits (135), Expect = 4.185e-10
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Match: Drap1 (Dr1 associated protein 1 (negative cofactor 2 alpha) [Source:MGI Symbol;Acc:MGI:1913806])

HSP 1 Score: 56.6102 bits (135), Expect = 5.297e-10
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Match: Drap1 (Dr1 associated protein 1 (negative cofactor 2 alpha) [Source:MGI Symbol;Acc:MGI:1913806])

HSP 1 Score: 56.6102 bits (135), Expect = 5.559e-10
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Match: Pole4 (polymerase (DNA-directed), epsilon 4 (p12 subunit) [Source:MGI Symbol;Acc:MGI:1914229])

HSP 1 Score: 52.7582 bits (125), Expect = 4.066e-9
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +R+KA++K + ++ +   ++I ++ +AAE FVE + K A   AQ   +KT+ +  L   I+      FL+G LD
Sbjct:   42 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD 118          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Match: Pole4 (polymerase (DNA-directed), epsilon 4 (p12 subunit) [Source:MGI Symbol;Acc:MGI:1914229])

HSP 1 Score: 49.6766 bits (117), Expect = 4.616e-8
Identity = 23/75 (30.67%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGM 470
             P +R+KA++K + ++ +   ++I ++ +AAE FVE + K A   AQ   +KT+ +  L   I+      FL+G+
Sbjct:   42 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGL 116          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2YDP3|NC2A_BOVIN (Dr1-associated corepressor OS=Bos taurus OX=9913 GN=DRAP1 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.668e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D6N5|NC2A_MOUSE (Dr1-associated corepressor OS=Mus musculus OX=10090 GN=Drap1 PE=1 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 3.705e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Match: sp|A0JPP1|NC2A_RAT (Dr1-associated corepressor OS=Rattus norvegicus OX=10116 GN=Drap1 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.743e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14919|NC2A_HUMAN (Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 4.101e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+K A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QQ14|DPOE4_BOVIN (DNA polymerase epsilon subunit 4 OS=Bos taurus OX=9913 GN=POLE4 PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.261e-8
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +R+KA++K + ++ +   ++I ++ +AAE FVE + K A   AQ   +KT+ +  L   I+      FL+G LD
Sbjct:   40 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD 116          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Match: E9IEX9 (CBFD_NFYB_HMF domain-containing protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_09843 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 8.315e-12
Identity = 43/120 (35.83%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  120 SFILQFGDSDHDQINSQD-EEIIDASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            S  +Q   S  D+ NS++  E +D    D   +DE    K +  P  RIK IIK++ E+G+IN ++  L+ K+ E+F+E L K A  +   S K+T+ K  +   ID+   + FL+GMLD
Sbjct:   10 SKTIQLDKSQVDEENSRNSREDVD----DTPHVDEEQREKLIRLPLGRIKTIIKMDPEVGLINQEAAFLVAKSVEFFIESLAKEAYKYTVQSKKRTVQKRDVENAIDNVDALVFLEGMLD 125          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Match: A0A3P7L4J6 (CBFD_NFYB_HMF domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7415 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.936e-11
Identity = 37/100 (37.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  186 DASFKDNEELDEHIATKN---LFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            D+  KD   + E   T +   + FP SR+K I+K    + +IN++S+A+++ AAE F+ +L   AA  A  S KKT+++N L   +       FLDGMLD
Sbjct:   88 DSPHKDEGAVPEEAETSSVRLIRFPVSRLKTIVKTVPSVHLINSESLAVLSHAAERFIADLTLEAARMATESGKKTVSRNSLDAVVATLPQYEFLDGMLD 187          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Match: A0A5N4ADX6 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_12369 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.126e-11
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +R+K I+KL+ E G I+ DS+ L+ KAAE F++ L + AA +A  S +KT+ +  +   ID    + FL+G LD
Sbjct:   43 LPLTRVKTIMKLDPENGKISQDSVVLVTKAAELFLQYLGREAAKYAMQSKRKTVQRRDINTVIDSVPQLCFLEGALD 119          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Match: A0A1Y1LJ31 (CBFD_NFYB_HMF domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.938e-11
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +R+K I+KL+ E G I+ DS+ L+ KAAE F++ L + AA +A  S +KT+ +  +   ID    + FL+G LD
Sbjct:   43 LPLTRVKTIMKLDPENGKISQDSVVLVTKAAELFLQYLGREAAKYAMQSKRKTVQRRDINTVIDSVPQLCFLEGALD 119          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Match: U6IUL5 (DNA polymerase epsilon subunit OS=Echinococcus granulosus OX=6210 GN=EGR_00312 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.099e-10
Identity = 39/113 (34.51%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  135 FGDSDHDQINSQDEEIIDASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGML 473
             G+SD D     D ++         E  E + +K L  P SRIK+IIK    + ++N++++ALI K+ E+F+ EL + A      S KKT++  H+   I       FLDGML
Sbjct:   48 IGESDRDNDEVSDAQVESGGVATLSEPAE-VPSKLLHLPTSRIKSIIKTVPAVHLVNSEAVALIGKSTEFFLNELAREAHQMIVESGKKTLSMVHIEGVIQTLPQFEFLDGML 159          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Cavefish
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:103045108])

HSP 1 Score: 54.6842 bits (130), Expect = 9.606e-10
Identity = 31/80 (38.75%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL---IEFIDDNSNMNFLDGMLD 476
             P SRIKA++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L   IE ID+     FL+G LD
Sbjct:   64 LPLSRIKALMKADPDLSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE---FAFLEGTLD 140          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Cavefish
Match: drap1 (DR1 associated protein 1 [Source:NCBI gene;Acc:103031620])

HSP 1 Score: 55.4546 bits (132), Expect = 1.329e-9
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+  A +  Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLTKACHVTQSRNAKTMTTSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Cavefish
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:103045108])

HSP 1 Score: 50.8322 bits (120), Expect = 5.264e-8
Identity = 29/78 (37.18%), Postives = 47/78 (60.26%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHL---IEFIDDNSNMNFLDGM 470
             P SRIKA++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L   IE ID+     FL+G+
Sbjct:   64 LPLSRIKALMKADPDLSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE---FAFLEGI 138          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Sea Lamprey
Match: drap1 (DR1-associated protein 1 (negative cofactor 2 alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-400])

HSP 1 Score: 54.299 bits (129), Expect = 6.597e-10
Identity = 26/75 (34.67%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + E+G +      +I++A E F+E L+  A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEVGKVAAAVPVIISRALELFLESLLTKACQVTQSRNAKTMTTSHLKQCIEAEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Yeast
Match: DPB3 (Third-largest subunit of DNA polymerase II (DNA polymerase epsilon); required to maintain fidelity of chromosomal replication and also for inheritance of telomeric silencing; stabilizes the interaction of Pol epsilon with primer-template DNA, positively affecting the processivity of the polymerase and exonuclease activities of Pol epsilon; mRNA abundance peaks at the G1/S boundary of the cell cycle; DPB3 has a paralog, DLS1, that arose from the whole genome duplication [Source:SGD;Acc:S000000482])

HSP 1 Score: 41.9726 bits (97), Expect = 9.940e-6
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  225 IATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNK-KT---ITKNHLIEFIDDNSNMNFLD 464
            +  K   FP S++K I K + E  I +N +I+    AAE FV+ LV+ +   AQL++K KT   ++ N + E ++   N  FL+
Sbjct:    5 VKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLNSKGKTSLRLSLNSIEECVEKRDNFRFLE 88          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Nematostella
Match: EDO42541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S160])

HSP 1 Score: 59.6918 bits (143), Expect = 2.294e-12
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  216 DEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            +E   ++   FP++R++ ++KL+ ++ + N +++ L+ +AAE FVE   K +        +KTI K  L   +DDN  + FL+G+LD
Sbjct:   25 EEEKPSRMTQFPQTRVRNMMKLDPDLQLANKEAVFLVTRAAELFVEYFAKASYKKTIQGKRKTIQKKDLDATVDDNDEVAFLEGVLD 111          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Nematostella
Match: EDO41226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W7])

HSP 1 Score: 51.2174 bits (121), Expect = 2.638e-9
Identity = 25/80 (31.25%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            N  FP +RIK I++ + ++G +      +I+KA E F++ LV+ A  + Q  N KT++  HL   I      +FL  +++
Sbjct:    9 NARFPPARIKKIMQTDEDVGKVAAAVPVIISKALEIFMQTLVEKACNYTQARNAKTLSTAHLKRCITSEQQFDFLKDLVE 88          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Medaka
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:101162035])

HSP 1 Score: 54.299 bits (129), Expect = 7.533e-10
Identity = 27/77 (35.06%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  246 FPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
             P +RIKA++K + ++ + + +S+ +I KA E FVE + K A  +AQ   +KT+ +  L   I+      FL+G LD
Sbjct:   48 LPLARIKALMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAVDEFAFLEGTLD 124          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Medaka
Match: drap1 (DR1 associated protein 1 [Source:NCBI gene;Acc:101159386])

HSP 1 Score: 53.1434 bits (126), Expect = 5.710e-9
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+  A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLTKACQVTQSRNAKTMTMSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Medaka
Match: drap1 (DR1 associated protein 1 [Source:NCBI gene;Acc:101159386])

HSP 1 Score: 53.5286 bits (127), Expect = 7.258e-9
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  237 NLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFL 461
            N  FP +RIK I++ + EIG +      +I++A E F+E L+  A    Q  N KT+T +HL + I+     +FL
Sbjct:    9 NARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLTKACQVTQSRNAKTMTMSHLKQCIELEQQFDFL 83          
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Planmine SMEST
Match: SMESG000070171.1 (SMESG000070171.1)

HSP 1 Score: 285.034 bits (728), Expect = 2.495e-100
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 3
Query:   39 MSDIDIDDVQLSDSDSTASEEIINEIPSFILQFGDSDHDQINSQDEEIIDASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 476
            MSDIDIDDVQLSDSDSTASEEIINEIPSFILQFGDSDHDQINSQDEEIIDASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD
Sbjct:    1 MSDIDIDDVQLSDSDSTASEEIINEIPSFILQFGDSDHDQINSQDEEIIDASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAAEYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD 146          
The following BLAST results are available for this feature:
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DRAP18.016e-1037.33DR1 associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
DRAP18.541e-1037.33DR1 associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
POLE45.392e-932.47DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pole-48.763e-930.39pep chromosome:WBcel235:II:14968633:14969354:-1 ge... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Chrac-165.540e-932.53gene:FBgn0043001 transcript:FBtr0073642[more]
Chrac-165.540e-932.53gene:FBgn0043001 transcript:FBtr0339625[more]
Mes48.338e-731.17gene:FBgn0034726 transcript:FBtr0071827[more]
Mes48.338e-731.17gene:FBgn0034726 transcript:FBtr0301243[more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pole42.170e-937.50polymerase (DNA-directed), epsilon 4, accessory su... [more]
drap19.115e-936.00DR1-associated protein 1 (negative cofactor 2 alph... [more]
pole42.343e-736.36polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole45.482e-735.59polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole46.146e-735.59polymerase (DNA-directed), epsilon 4, accessory su... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pole45.640e-1135.80polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole43.123e-832.86polymerase (DNA-directed), epsilon 4, accessory su... [more]
arl148.789e-734.78ADP ribosylation factor like GTPase 14 [Source:Xen... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drap14.185e-1037.33Dr1 associated protein 1 (negative cofactor 2 alph... [more]
Drap15.297e-1037.33Dr1 associated protein 1 (negative cofactor 2 alph... [more]
Drap15.559e-1037.33Dr1 associated protein 1 (negative cofactor 2 alph... [more]
Pole44.066e-932.47polymerase (DNA-directed), epsilon 4 (p12 subunit)... [more]
Pole44.616e-830.67polymerase (DNA-directed), epsilon 4 (p12 subunit)... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2YDP3|NC2A_BOVIN3.668e-937.33Dr1-associated corepressor OS=Bos taurus OX=9913 G... [more]
sp|Q9D6N5|NC2A_MOUSE3.705e-937.33Dr1-associated corepressor OS=Mus musculus OX=1009... [more]
sp|A0JPP1|NC2A_RAT3.743e-937.33Dr1-associated corepressor OS=Rattus norvegicus OX... [more]
sp|Q14919|NC2A_HUMAN4.101e-937.33Dr1-associated corepressor OS=Homo sapiens OX=9606... [more]
sp|A6QQ14|DPOE4_BOVIN2.261e-832.47DNA polymerase epsilon subunit 4 OS=Bos taurus OX=... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9IEX98.315e-1235.83CBFD_NFYB_HMF domain-containing protein (Fragment)... [more]
A0A3P7L4J65.936e-1137.00CBFD_NFYB_HMF domain-containing protein OS=Dibothr... [more]
A0A5N4ADX69.126e-1140.26Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1Y1LJ319.938e-1140.26CBFD_NFYB_HMF domain-containing protein OS=Photinu... [more]
U6IUL51.099e-1034.51DNA polymerase epsilon subunit OS=Echinococcus gra... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pole49.606e-1038.75DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
drap11.329e-936.00DR1 associated protein 1 [Source:NCBI gene;Acc:103... [more]
pole45.264e-837.18DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drap16.597e-1034.67DR1-associated protein 1 (negative cofactor 2 alph... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DPB39.940e-634.52Third-largest subunit of DNA polymerase II (DNA po... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO425412.294e-1232.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412262.638e-931.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pole47.533e-1035.06DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
drap15.710e-936.00DR1 associated protein 1 [Source:NCBI gene;Acc:101... [more]
drap17.258e-936.00DR1 associated protein 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of CBFD_NFYB_HMF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000070171.12.495e-100100.00SMESG000070171.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011687 ID=SMED30011687|Name=CBFD_NFYB_HMF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=481bp
TTTAATTTTAAATTCTAAGTAAAATTAGTTTTCAAAATATGAGTGACATT
GATATCGATGACGTCCAGTTAAGTGATAGTGATTCTACAGCATCTGAAGA
AATCATAAATGAAATTCCCTCATTTATTTTACAGTTTGGAGATTCAGATC
ATGATCAAATAAATTCACAAGATGAAGAAATTATTGATGCTTCTTTCAAG
GATAATGAAGAACTGGATGAACATATCGCAACTAAGAATTTATTTTTTCC
CAAATCTCGAATCAAGGCTATTATTAAGCTTAATAATGAAATTGGAATTA
TTAATAATGATTCCATAGCTTTGATAAATAAAGCTGCTGAATATTTTGTC
GAGGAACTTGTAAAAGGTGCTGCTTATTTCGCTCAGTTATCAAATAAAAA
AACAATTACAAAAAATCACTTGATTGAGTTTATAGATGATAATTCGAATA
TGAATTTTTTAGATGGAATGCTTGATTAGTC
back to top

protein sequence of SMED30011687-orf-1

>SMED30011687-orf-1 ID=SMED30011687-orf-1|Name=SMED30011687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MSDIDIDDVQLSDSDSTASEEIINEIPSFILQFGDSDHDQINSQDEEIID
ASFKDNEELDEHIATKNLFFPKSRIKAIIKLNNEIGIINNDSIALINKAA
EYFVEELVKGAAYFAQLSNKKTITKNHLIEFIDDNSNMNFLDGMLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009072Histone-fold
IPR003958CBFA_NFYB_domain
Vocabulary: molecular function
TermDefinition
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003958Transcription factor CBF/NF-Y/archaeal histone domainPFAMPF00808CBFD_NFYB_HMFcoord: 69..129
e-value: 1.6E-11
score: 44.3
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 31..146
e-value: 1.7E-19
score: 72.1
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 55..144
NoneNo IPR availablePANTHERPTHR10252:SF79DNA POLYMERASE EPSILON SUBUNIT 4coord: 64..146
NoneNo IPR availablePANTHERPTHR10252HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATEDcoord: 64..146