SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

Overview
NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Smed IDSMED30011685
Length (bp)2847
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMED30011685) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMED30011685) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMED30011685) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMED30011685) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011685

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011685h1SMcG0017920 SmedASXL_015824SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011685h1SMcG0017920 SmedASXL_015824SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30011685h1SMcG0017920 dd_Smed_v4_5085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011685h1SMcG0017920 dd_Smed_v4_5085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011685h1SMcG0017920 SMU15025606dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011685h1SMcG0017920 SMU15025606dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011685h1SMcG0017920 SMU15005679dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011685h1SMcG0017920 SMU15005679dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:HGNC Symbol;Acc:HGNC:11109])

HSP 1 Score: 105.145 bits (261), Expect = 4.724e-26
Identity = 45/80 (56.25%), Postives = 63/80 (78.75%), Query Frame = 2
Query:  173 MPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            MPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:    1 MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 80          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:HGNC Symbol;Acc:HGNC:11109])

HSP 1 Score: 104.76 bits (260), Expect = 6.179e-26
Identity = 45/80 (56.25%), Postives = 63/80 (78.75%), Query Frame = 2
Query:  173 MPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            MPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:    1 MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 80          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:HGNC Symbol;Acc:HGNC:11109])

HSP 1 Score: 107.842 bits (268), Expect = 2.922e-25
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   52 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 132          

HSP 2 Score: 74.3294 bits (181), Expect = 6.318e-14
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  143 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 248          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:HGNC Symbol;Acc:HGNC:11109])

HSP 1 Score: 108.997 bits (271), Expect = 3.185e-25
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   35 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 115          

HSP 2 Score: 72.7886 bits (177), Expect = 4.377e-13
Identity = 37/90 (41.11%), Postives = 58/90 (64.44%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  142 EDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 231          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:HGNC Symbol;Acc:HGNC:11109])

HSP 1 Score: 108.227 bits (269), Expect = 3.635e-25
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   54 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 134          

HSP 2 Score: 73.9442 bits (180), Expect = 1.433e-13
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  145 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 250          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Celegans
Match: swsn-3 (SWI/SNF nucleosome remodeling complex component [Source:UniProtKB/TrEMBL;Acc:Q9BL39])

HSP 1 Score: 71.633 bits (174), Expect = 5.128e-13
Identity = 30/67 (44.78%), Postives = 46/67 (68.66%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNS 370
            L PYMRYSRK+W  V+  N + +LW++GK+IG+ W +LP+ EKSH+  EYE +K  Y   ++ +  +
Sbjct:   30 LQPYMRYSRKMWPKVRAENPEAQLWDIGKMIGKYWLDLPDGEKSHYQHEYELEKADYEKQMKHFQGN 96          

HSP 2 Score: 70.4774 bits (171), Expect = 1.377e-12
Identity = 39/113 (34.51%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  576 DNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
            D D+   E+ T + +A  RF+RN++L+ DLFS   V +   VV   R+  LK+Q   L TH+ KL++E+ + E++H+N+K  I+  S+ F  +  K +  +P++ E+ F + V
Sbjct:  130 DEDDGGNELST-RRLAGVRFERNNRLISDLFSPSIVTDTRTVVPHHRMEMLKRQATSLGTHQSKLEEELTKLERAHDNRKRAIEKGSDDFQEQLKKAVSEKPVVDEEKFEETV 241          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Fly
Match: Bap111 (gene:FBgn0030093 transcript:FBtr0071300)

HSP 1 Score: 108.227 bits (269), Expect = 9.988e-24
Identity = 62/121 (51.24%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   62 IFNFNRMNRLKSIKMKVGQKSS-----DSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKV 409
            IF  +          KV + SS     +SRLPKPPKPPEKP++PYMRYS++VW+SVK  + +LKLWE+GK IG MW+ LPE+EK+ F++EYE +KL+Y  +L+ YH +PAY++++  K KV
Sbjct:   52 IFTHSNYGNPAFTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELGKKIGAMWKLLPEDEKTEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKV 172          

HSP 2 Score: 78.9518 bits (193), Expect = 1.312e-14
Identity = 40/113 (35.40%), Postives = 69/113 (61.06%), Query Frame = 3
Query:  576 DNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
            ++++D +E +T KH+A  R+  NH+L+ ++FS+  VP++  VVT  R+  LK+QV+ L  H+ KL+ E+ + E+  E KK ++   SE F  E  +    +P + E+ F  MV
Sbjct:  202 EDEDDQDEGYTTKHLAYARYLHNHRLINEIFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEAFQEELKRHC--KPAVDEETFQKMV 312          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Zebrafish
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 111.694 bits (278), Expect = 1.459e-25
Identity = 48/81 (59.26%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:   68 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 148          

HSP 2 Score: 66.6254 bits (161), Expect = 6.848e-11
Identity = 38/90 (42.22%), Postives = 58/90 (64.44%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    ++ F
Sbjct:  175 EDPDDYDDGFSMKHTAAARFQRNHRLISDILSEVVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRRFLESTDSF 264          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Zebrafish
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 111.694 bits (278), Expect = 1.459e-25
Identity = 48/81 (59.26%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:   68 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 148          

HSP 2 Score: 66.6254 bits (161), Expect = 6.848e-11
Identity = 38/90 (42.22%), Postives = 58/90 (64.44%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    ++ F
Sbjct:  175 EDPDDYDDGFSMKHTAAARFQRNHRLISDILSEVVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRRFLESTDSF 264          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Zebrafish
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 105.916 bits (263), Expect = 1.045e-23
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 2
Query:  170 LMPYMRYSRKV----WESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKV    W+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:   50 LMPYMRYSRKVSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 134          

HSP 2 Score: 66.6254 bits (161), Expect = 6.621e-11
Identity = 38/90 (42.22%), Postives = 58/90 (64.44%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    ++ F
Sbjct:  161 EDPDDYDDGFSMKHTAAARFQRNHRLISDILSEVVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRRFLESTDSF 250          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Xenopus
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:NCBI gene;Acc:448018])

HSP 1 Score: 82.8037 bits (203), Expect = 6.141e-16
Identity = 36/58 (62.07%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYN 343
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++ N
Sbjct:   69 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKVRGN 126          

HSP 2 Score: 77.411 bits (189), Expect = 3.459e-14
Identity = 44/108 (40.74%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  588 DPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDM 911
            D ++ F+ KH AA RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H++KK K    +E F    N EL  + + T K+  DM
Sbjct:  178 DYDDGFSMKHSAAARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQDKKRKFLESTESF----NNEL--KRLCTLKVEVDM 279          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Xenopus
Match: abcb6 (ATP binding cassette subfamily B member 6 (Langereis blood group) [Source:Xenbase;Acc:XB-GENE-1001119])

HSP 1 Score: 53.5286 bits (127), Expect = 1.058e-6
Identity = 23/73 (31.51%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSW 388
            L  Y+R+  +  E ++     +   E+ +I+G  W +LP +EK H+++E E DK +Y   L+ Y N+ AY+++
Sbjct:  105 LTGYVRFMNERREQLRTERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQNTDAYQTY 177          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Mouse
Match: Smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:MGI Symbol;Acc:MGI:1927347])

HSP 1 Score: 108.997 bits (271), Expect = 1.003e-24
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   70 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 150          

HSP 2 Score: 73.9442 bits (180), Expect = 3.054e-13
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  161 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 266          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Match: sp|Q56A18|SMCE1_RAT (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Smarce1 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.671e-24
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   35 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 115          

HSP 2 Score: 72.7886 bits (177), Expect = 4.237e-12
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  126 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 231          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Match: sp|O54941|SMCE1_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Mus musculus OX=10090 GN=Smarce1 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.016e-24
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   70 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 150          

HSP 2 Score: 73.9442 bits (180), Expect = 2.136e-12
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  161 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 266          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Match: sp|Q969G3|SMCE1_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 7.981e-24
Identity = 46/81 (56.79%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   70 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAE 150          

HSP 2 Score: 73.9442 bits (180), Expect = 1.972e-12
Identity = 41/106 (38.68%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            Q  +E  E Y+     EDP++    F+ KH A  RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E+ H+ KK K    ++ F
Sbjct:  161 QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSF 266          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Match: sp|Q6DIJ5|HM20A_XENTR (High mobility group protein 20A OS=Xenopus tropicalis OX=8364 GN=hmg20a PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.606e-6
Identity = 23/73 (31.51%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSW 388
            L  Y+R+  +  E ++     +   E+ +I+G  W +LP +EK H+++E E DK +Y   L+ Y N+ AY+++
Sbjct:  105 LTGYVRFMNERREQLRTERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQNTDAYQTY 177          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Match: sp|Q6AZF8|HM20A_XENLA (High mobility group protein 20A OS=Xenopus laevis OX=8355 GN=hmg20a PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.399e-6
Identity = 23/73 (31.51%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSW 388
            L  Y+R+  +  E ++     +   E+ +I+G  W +LP +EK H+++E E DK +Y   L+ Y N+ AY+++
Sbjct:  105 LTGYVRFMNERREQLRTERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQKYQNTDAYQTY 177          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Match: A0A3S4ZXN7 (HMG box domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS7983 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 6.129e-69
Identity = 82/105 (78.10%), Postives = 92/105 (87.62%), Query Frame = 2
Query:  101 KMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
             +KVG KS DSR+PKPPKPPEKPLMPYMRYSRKVWE VKN+N Q KLWEVGKIIGQMWRELPE+EKS FVEEYE++K QY +ALR YHNSP+Y+SWL  KE+ EK
Sbjct:   12 PVKVGSKS-DSRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNPQSKLWEVGKIIGQMWRELPEDEKSLFVEEYESEKAQYTEALRQYHNSPSYQSWLAAKERAEK 115          

HSP 2 Score: 144.821 bits (364), Expect = 6.129e-69
Identity = 69/133 (51.88%), Postives = 92/133 (69.17%), Query Frame = 3
Query:  516 KDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
            + R + D Q  + RESYILEDN+EDPE+ FTAKHVAA RFQRNH+LML++ SD ++P+ G  +TE RLN L+ QV  L  HKR L  E+D  E  H++K  ++K ESEK+  +Y K +   PIITE  F +M+
Sbjct:  130 RARERPDGQQNDLRESYILEDNEEDPEDQFTAKHVAAARFQRNHRLMLEILSDSRLPDPGQFITETRLNTLRMQVEQLKNHKRNLSQEIDNCEARHQSKIRRMKEESEKYIIDYEKLVSFCPIITEAQFGEMI 262          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Match: A0A3Q0KQM6 (SWI/SNF-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.276e-63
Identity = 67/136 (49.26%), Postives = 93/136 (68.38%), Query Frame = 3
Query:  507 FKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
             + +DR  +  Q  + RESYILEDN+ED E+ FTAKHVAA RFQRNH+LM ++ SD ++P+ G ++T+ RLN L+ QV  L  HKR L  E++  E  H+ K  +I+ ESE+F  +Y K   ARP+ITE  F+DM+
Sbjct:  141 LRSRDRGNELPQG-DLRESYILEDNEEDTEDQFTAKHVAAARFQRNHRLMQEVLSDTRLPDPGQLITQSRLNTLRLQVEQLKNHKRNLCQEIEGCEARHQAKVQRIREESERFRLDYQKTTTARPVITESQFADMI 275          

HSP 2 Score: 135.576 bits (340), Expect = 2.276e-63
Identity = 80/132 (60.61%), Postives = 98/132 (74.24%), Query Frame = 2
Query:   20 INLF*IKILSYIFIIFNFNRMNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            +N F     SY F   + N  N  ++I+M      SD R+PKPPKPPEKPLMPYMRYSRKVWE VKN+N  LKLWEVGKIIGQMWRELP++EK  +VEEY+ +K QY + LR YH+SPAY++WL+ KE+ EK
Sbjct:    1 MNHFHYDSKSYYFQSPHNN--NTFQAIRMN---SKSDMRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNPHLKLWEVGKIIGQMWRELPDDEKLLYVEEYDTEKTQYTELLRQYHSSPAYQAWLVAKERAEK 127          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Match: A0A3P7X3B0 (HMG box domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS5861 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.825e-63
Identity = 79/133 (59.40%), Postives = 100/133 (75.19%), Query Frame = 2
Query:   17 CINLF*IKILSYIFIIFNFNRMNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            C N+  ++  SY F   + N  +  ++I+M      SD R+PKPPKPPEKPLMPYMRYSRKVWE VKN+N  LKLWEVGKIIGQMWRELP++EK  +VEEY+ +K QY + LR YH+SPAY++WL+ KE+ EK
Sbjct:   16 CCNIRLVEAKSYYFQSPHNN--STFQTIRMN---SKSDMRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNPHLKLWEVGKIIGQMWRELPDDEKILYVEEYDAEKTQYTELLRQYHSSPAYQAWLVAKERAEK 143          

HSP 2 Score: 136.732 bits (343), Expect = 2.825e-63
Identity = 67/136 (49.26%), Postives = 93/136 (68.38%), Query Frame = 3
Query:  507 FKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
             + +DR  +  Q  + RESYILEDN+ED E+ FTAKHVAA RFQRNH+LM ++ SD ++P+ G ++T+ RLN L+ QV  L  HKR L  E++  E  H+ K  +I+ ESE+F  +Y K   ARP+ITE  F+DM+
Sbjct:  157 LRSRDRGNELPQG-DLRESYILEDNEEDTEDQFTAKHVAAARFQRNHRLMQEVLSDTRLPDPGQLITQSRLNTLRLQVEQLKNHKRNLCQEIEGCEARHKAKVQRIREESERFRLDYQKITTARPVITESQFADMI 291          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Match: A0A183LPY6 (HMG box domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.994e-63
Identity = 79/133 (59.40%), Postives = 100/133 (75.19%), Query Frame = 2
Query:   17 CINLF*IKILSYIFIIFNFNRMNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            C N+  ++  SY F   + N  +  ++I+M      SD R+PKPPKPPEKPLMPYMRYSRKVWE VKN+N  LKLWEVGKIIGQMWRELP++EK  +VEEY+ +K QY + LR YH+SPAY++WL+ KE+ EK
Sbjct:   16 CCNIRLVEAKSYYFQSPHNN--STFQTIRMN---SKSDMRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNPHLKLWEVGKIIGQMWRELPDDEKILYVEEYDAEKTQYTELLRQYHSSPAYQAWLVAKERAEK 143          

HSP 2 Score: 136.732 bits (343), Expect = 2.994e-63
Identity = 67/136 (49.26%), Postives = 93/136 (68.38%), Query Frame = 3
Query:  507 FKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
             + +DR  +  Q  + RESYILEDN+ED E+ FTAKHVAA RFQRNH+LM ++ SD ++P+ G ++T+ RLN L+ QV  L  HKR L  E++  E  H+ K  +I+ ESE+F  +Y K   ARP+ITE  F+DM+
Sbjct:  157 LRSRDRGNELPQG-DLRESYILEDNEEDTEDQFTAKHVAAARFQRNHRLMQEVLSDTRLPDPGQLITQSRLNTLRLQVEQLKNHKRNLCQEIEGCEARHKAKVQRIREESERFRLDYQKITTARPVITESQFADMI 291          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Match: G4V6I7 (SWI/SNF-related OS=Schistosoma mansoni OX=6183 GN=Smp_154640 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.305e-63
Identity = 67/136 (49.26%), Postives = 93/136 (68.38%), Query Frame = 3
Query:  507 FKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMV 914
             + +DR  +  Q  + RESYILEDN+ED E+ FTAKHVAA RFQRNH+LM ++ SD ++P+ G ++T+ RLN L+ QV  L  HKR L  E++  E  H+ K  +I+ ESE+F  +Y K   ARP+ITE  F+DM+
Sbjct:  155 LRSRDRGNELPQG-DLRESYILEDNEEDTEDQFTAKHVAAARFQRNHRLMQEVLSDTRLPDPGQLITQSRLNTLRLQVEQLKNHKRNLCQEIEGCEARHQAKVQRIREESERFRLDYQKTTTARPVITESQFADMI 289          

HSP 2 Score: 135.191 bits (339), Expect = 3.305e-63
Identity = 78/123 (63.41%), Postives = 95/123 (77.24%), Query Frame = 2
Query:   47 SYIFIIFNFNRMNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            SY F   + N  N  ++I+M      SD R+PKPPKPPEKPLMPYMRYSRKVWE VKN+N  LKLWEVGKIIGQMWRELP++EK  +VEEY+ +K QY + LR YH+SPAY++WL+ KE+ EK
Sbjct:   24 SYYFQSPHNN--NTFQAIRMN---SKSDMRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNPHLKLWEVGKIIGQMWRELPDDEKLLYVEEYDTEKTQYTELLRQYHSSPAYQAWLVAKERAEK 141          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Cavefish
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 111.309 bits (277), Expect = 1.156e-25
Identity = 48/81 (59.26%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:   50 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 130          

HSP 2 Score: 69.707 bits (169), Expect = 5.640e-12
Identity = 44/112 (39.29%), Postives = 67/112 (59.82%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNK 863
            Q  ++  E Y+     EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    +E F SE  +
Sbjct:  141 QSRLDKGEPYMSIQPAEDPDDYDDGFSMKHTAAARFQRNHRLISDILSEVVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRRFLESTESFNSELKR 252          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Cavefish
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 111.309 bits (277), Expect = 2.180e-25
Identity = 48/81 (59.26%), Postives = 64/81 (79.01%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:  105 LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 185          

HSP 2 Score: 70.0922 bits (170), Expect = 4.872e-12
Identity = 44/112 (39.29%), Postives = 67/112 (59.82%), Query Frame = 3
Query:  537 QQAVETRESYILEDNDEDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNK 863
            Q  ++  E Y+     EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    +E F SE  +
Sbjct:  196 QSRLDKGEPYMSIQPAEDPDDYDDGFSMKHTAAARFQRNHRLISDILSEVVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRRFLESTESFNSELKR 307          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Sea Lamprey
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 106.686 bits (265), Expect = 1.146e-24
Identity = 45/81 (55.56%), Postives = 61/81 (75.31%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKVW+ VK AN  LKLWE+GKIIG MWR+L E +K  ++ +YE +K++YND ++ YH SP Y +++  K + E
Sbjct:   74 LMPYMRYSRKVWDQVKAANPDLKLWEIGKIIGSMWRDLSEEDKQEYLNDYEAEKIEYNDLMKAYHTSPTYLAYINAKTRAE 154          

HSP 2 Score: 58.151 bits (139), Expect = 5.804e-9
Identity = 35/84 (41.67%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  612 KHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNK 863
            KH+ A RFQRNH+L+ ++ S+  VP++ +VVT  R+  LK+QV+ L  H+RKL+ E+ + E+ H  KK K    +  F SE  +
Sbjct:  192 KHLGASRFQRNHRLINEVLSEVVVPDVRVVVTTGRMQVLKRQVDSLTVHQRKLEAELLQIEERHLEKKRKFLENTSTFNSEMKR 275          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Nematostella
Match: EDO49477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG66])

HSP 1 Score: 113.235 bits (282), Expect = 5.761e-27
Identity = 60/94 (63.83%), Postives = 77/94 (81.91%), Query Frame = 2
Query:  119 KSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHK 400
            +  D R+PKPPKPPEKPLMPYMRYSRKVW+ VKN N   KLW++GKIIGQMWR+L + EK  ++EEYE +K +YN+A++LYH+SPAY+ W+  K
Sbjct:   84 QPGDIRVPKPPKPPEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQEYMEEYEIEKQEYNEAVKLYHSSPAYQDWITAK 177          

HSP 2 Score: 88.1965 bits (217), Expect = 1.306e-18
Identity = 41/81 (50.62%), Postives = 60/81 (74.07%), Query Frame = 3
Query:  603 FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKF 845
            ++ KHVAA RFQRNHKLM ++FS+  VP++  VVT+ RL  LK+QV  LI+H++KL+ E+ + E+  ++KK +   ESEKF
Sbjct:  224 YSVKHVAAARFQRNHKLMAEVFSETVVPDVRTVVTKTRLGVLKRQVQSLISHQKKLEGELQQIEEKFKSKKQRFLDESEKF 304          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Nematostella
Match: EDO41032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L8])

HSP 1 Score: 53.1434 bits (126), Expect = 1.810e-7
Identity = 28/82 (34.15%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  170 LMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            L  Y+R+  +  E V++ N  L   EV +I+G MW +LP  +K  F+EE E DK +Y   L  Y  +  YK ++  ++ ++K
Sbjct:   19 LTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQRTDTYKMFIAKQKALKK 100          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Medaka
Match: SMARCE1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:NCBI gene;Acc:101167768])

HSP 1 Score: 106.686 bits (265), Expect = 5.838e-24
Identity = 61/121 (50.41%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   50 YIFIIFNFNRMNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            Y  + +N  R+   +S   +V   SS   +PKPPKPP+KPLMPYMRYSRKVW+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ +YE +K++YN++++ YHNSPAY +++  K + E
Sbjct:   31 YSHLAYNNYRLGGSQSSNSRV-TNSSGINIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNDYEAEKIEYNESMKAYHNSPAYLAYVNAKGRAE 150          

HSP 2 Score: 74.7146 bits (182), Expect = 1.315e-13
Identity = 39/96 (40.62%), Postives = 61/96 (63.54%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNK 863
            EDP++    F+ KH AA RFQRNH+L+ ++ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK K    ++ F +E  +
Sbjct:  177 EDPDDYDDGFSIKHTAAARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKRKFLEATDSFNNELKR 272          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Medaka
Match: smarce1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 [Source:NCBI gene;Acc:101174813])

HSP 1 Score: 105.531 bits (262), Expect = 9.288e-24
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 2
Query:  170 LMPYMRYSRKV----WESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVE 412
            LMPYMRYSRKV    W+ VK +N  LKLWE+GKIIG MWR+L + EK  ++ EYE +K++YND+L+ YHNSPAY +++  K + E
Sbjct:   68 LMPYMRYSRKVSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQDYLNEYEAEKIEYNDSLKAYHNSPAYLAYVNAKNRAE 152          

HSP 2 Score: 78.1814 bits (191), Expect = 7.294e-15
Identity = 44/112 (39.29%), Postives = 69/112 (61.61%), Query Frame = 3
Query:  585 EDPEEV---FTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDM 911
            EDP++    F+ KH AA RFQRNH+L+ D+ S+  VP++  VVT  R+  LK+QV  L+ H+RKL+ E+ + E  H+ KK +    ++ F    N EL  + + ++K+  DM
Sbjct:  179 EDPDDYDDGFSVKHTAAARFQRNHRLISDILSEIVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEDRHQEKKKRFLETTDSF----NTEL--KRLCSQKVEVDM 284          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Planmine SMEST
Match: SMESG000020191.1 (SMESG000020191.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 702/711 (98.73%), Postives = 703/711 (98.87%), Query Frame = 3
Query:  504 SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVXXXXXXXXXXXXXXXXXXXXXLSDKRTPVTETISEGSIKPXXXXXXXXXXXXQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKIXXXXXXXXXXXXXYKAPILSPECEPESKTNYYDTNESSSAMQXXXXXXXXXXXXXXXXXXXTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQS--------GSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE 2612
            SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVRKARDEIIREEKEREEFIKTRLSDKRTPVTETISEGSIKPENNNVEENSKVEQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKISESSASPSNVSNNYKAPILSPECEPESKTNYYDTNESSSAMQSPIKKVTSKKRKPPSKSKSTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQGYVHPYGPGPYTGYGTQFGPSNQSFPNQNNQPVQENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQ+        GSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE
Sbjct:  134 SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVRKARDEIIREEKEREEFIKTRLSDKRTPVTETISEGSIKPENNNVEENSKVEQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKISESSASPSNVSNNYKAPILSPECEPESKTNYYDTNESSSAMQSPIKKVTSKKRKPPSKSKSTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQGYVHPYGPGPYTGYGTQFGPSNQSFPNQNNQPVQENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQTEQQQPVSGGSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE 844          

HSP 2 Score: 207.223 bits (526), Expect = 2.032e-55
Identity = 112/118 (94.92%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 MNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRK------VWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            MNRLKSIKMKVGQKSSDSRLPKPPKPPEKPLMPYMRYSRK      VWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK
Sbjct:    1 MNRLKSIKMKVGQKSSDSRLPKPPKPPEKPLMPYMRYSRKESNYNHVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 118          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Planmine SMEST
Match: SMESG000020191.1 (SMESG000020191.1)

HSP 1 Score: 1159.05 bits (2997), Expect = 0.000e+0
Identity = 702/711 (98.73%), Postives = 703/711 (98.87%), Query Frame = 3
Query:  504 SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVXXXXXXXXXXXXXXXXXXXXXLSDKRTPVTETISEGSIKPXXXXXXXXXXXXQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKIXXXXXXXXXXXXXYKAPILSPECEPESKTNYYDTNESSSAMQXXXXXXXXXXXXXXXXXXXTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQS--------GSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE 2612
            SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVRKARDEIIREEKEREEFIKTRLSDKRTPVTETISEGSIKPENNNVEENSKVEQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKISESSASPSNVSNNYKAPILSPECEPESKTNYYDTNESSSAMQSPIKKVTSKKRKPPSKSKSTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQGYVHPYGPGPYTGYGTQFGPSNQSFPNQNNQPVQENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQ+        GSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE
Sbjct:  128 SFKQKDRIQKDQQAVETRESYILEDNDEDPEEVFTAKHVAAQRFQRNHKLMLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSHENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVRKARDEIIREEKEREEFIKTRLSDKRTPVTETISEGSIKPENNNVEENSKVEQIVDSCTSQHPNLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSFENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQKYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKISESSASPSNVSNNYKAPILSPECEPESKTNYYDTNESSSAMQSPIKKVTSKKRKPPSKSKSTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQNDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYYNQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQGYVHPYGPGPYTGYGTQFGPSNQSFPNQNNQPVQENLQIHTSKDQNLSAQPTSMPSQMNIIDESQKYQTEQQQPVSGGSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQGHFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPKIQE 838          

HSP 2 Score: 214.157 bits (544), Expect = 1.181e-57
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 2
Query:   80 MNRLKSIKMKVGQKSSDSRLXXXXXXXXXXLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 415
            MNRLKSIKMKVGQKSSDSRLPKPPKPPEKPLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK
Sbjct:    1 MNRLKSIKMKVGQKSSDSRLPKPPKPPEKPLMPYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEKVEK 112          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Planmine SMEST
Match: SMESG000020100.1 (SMESG000020100.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.852e-14
Identity = 32/77 (41.56%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  176 PYMRYSRKVWESVKNANGQLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAYKSWLLHKEK 406
            PY+RYSR VWE V N N  + + ++G  +G++WR L + +K  F EE++ D ++Y + LR Y+ S  YK WL   E+
Sbjct:   24 PYIRYSRSVWEKVSNENPGMNIGQIGNTVGRLWRNLADEDKEIFNEEFKEDMIKYENELRTYYKSVGYKEWLKRNEE 100          
The following BLAST results are available for this feature:
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCE14.724e-2656.25SWI/SNF related, matrix associated, actin dependen... [more]
SMARCE16.179e-2656.25SWI/SNF related, matrix associated, actin dependen... [more]
SMARCE12.922e-2556.79SWI/SNF related, matrix associated, actin dependen... [more]
SMARCE13.185e-2556.79SWI/SNF related, matrix associated, actin dependen... [more]
SMARCE13.635e-2556.79SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
swsn-35.128e-1344.78SWI/SNF nucleosome remodeling complex component [... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Bap1119.988e-2451.24gene:FBgn0030093 transcript:FBtr0071300[more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smarce11.459e-2559.26SWI/SNF related, matrix associated, actin dependen... [more]
smarce11.459e-2559.26SWI/SNF related, matrix associated, actin dependen... [more]
smarce11.045e-2356.47SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smarce16.141e-1662.07SWI/SNF related, matrix associated, actin dependen... [more]
abcb61.058e-631.51ATP binding cassette subfamily B member 6 (Langere... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Smarce11.003e-2456.79SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q56A18|SMCE1_RAT3.671e-2456.79SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|O54941|SMCE1_MOUSE7.016e-2456.79SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q969G3|SMCE1_HUMAN7.981e-2456.79SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q6DIJ5|HM20A_XENTR5.606e-631.51High mobility group protein 20A OS=Xenopus tropica... [more]
sp|Q6AZF8|HM20A_XENLA6.399e-631.51High mobility group protein 20A OS=Xenopus laevis ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S4ZXN76.129e-6978.10HMG box domain-containing protein OS=Protopolystom... [more]
A0A3Q0KQM62.276e-6349.26SWI/SNF-related OS=Schistosoma mansoni OX=6183 PE=... [more]
A0A3P7X3B02.825e-6359.40HMG box domain-containing protein OS=Schistosoma m... [more]
A0A183LPY62.994e-6359.40HMG box domain-containing protein OS=Schistosoma m... [more]
G4V6I73.305e-6349.26SWI/SNF-related OS=Schistosoma mansoni OX=6183 GN=... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smarce11.156e-2559.26SWI/SNF related, matrix associated, actin dependen... [more]
smarce12.180e-2559.26SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smarce11.146e-2455.56SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494775.761e-2763.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410321.810e-734.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SMARCE15.838e-2450.41SWI/SNF related, matrix associated, actin dependen... [more]
smarce19.288e-2456.47SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020191.12.032e-5598.73SMESG000020191.1[more]
SMESG000020191.11.181e-5798.73SMESG000020191.1[more]
SMESG000020100.11.852e-1441.56SMESG000020100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011685 ID=SMED30011685|Name=SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2847bp
ATTAAAATGGCAACTATGTATTAATTTATTTTAAATAAAGATTTTAAGTT
ATATCTTTATTATATTTAATTTTAATCGTATGAATAGACTTAAAAGTATC
AAAATGAAAGTTGGTCAAAAATCTTCAGATTCCAGATTACCTAAGCCACC
AAAACCTCCTGAAAAACCTCTTATGCCATACATGAGATATAGTCGTAAAG
TGTGGGAATCAGTTAAAAATGCAAATGGTCAACTAAAATTGTGGGAAGTT
GGTAAAATAATCGGTCAGATGTGGCGAGAACTTCCTGAAAATGAAAAGTC
TCATTTTGTAGAAGAATATGAAAATGATAAGCTACAATACAATGACGCTT
TACGACTATATCACAACTCTCCAGCCTATAAGTCATGGCTCCTTCACAAA
GAAAAGGTTGAAAAAAGTATGGATGATAATGATTCAGTTGATAGTATGTC
ACAGTCTCAGGTCAGTTTTTACCTATTCTAATCGCAATTACTAATATTGT
TAGTCATTTAAGCAGAAAGATCGAATTCAAAAAGATCAACAAGCTGTAGA
AACAAGAGAATCATACATATTGGAAGATAACGACGAAGATCCAGAAGAAG
TATTTACAGCTAAACACGTTGCTGCACAGAGATTTCAGCGCAATCATAAA
CTAATGCTTGACCTATTCAGTGATTTTAAAGTCCCGGAATTGGGAATAGT
TGTCACTGAGGTCAGATTAAATGCGCTCAAACAGCAAGTAAATGGTCTCA
TAACACATAAAAGGAAATTAGATGATGAAATGGATGAGTCCGAAAAGTCA
CATGAAAATAAAAAGCTTAAAATTAAAACAGAATCAGAAAAGTTTTGGTC
TGAATATAATAAGGAATTAGAGGCTCGGCCAATCATTACTGAAAAAATGT
TTTCCGATATGGTTAGAAAAGCCAGAGATGAAATTATTCGCGAGGAAAAG
GAAAGAGAAGAATTTATTAAAACTAGATTAAGTGACAAGCGAACACCAGT
AACGGAAACGATTAGTGAGGGCAGTATAAAACCTGAAAATAATAACGTCG
AAGAAAATTCTAAAGTTGAACAAATTGTAGATAGTTGTACCAGTCAGCAC
CCAAATTTACCCCAGGCGGTTTCATTGGCGGAATCTACTGCCTCGAAAAT
TACTCATCCATCAGATTCTCAAGTCCCAGTTGCTTTGGATTCTCATCAAA
ATCTACCTGTATCTCACCATAATCAAACTCCTAGTCGTAGTCAAATGAGT
TTCGAAAATAGACCTGCAATTAGTAGCCATAATTTTAATCAAACGTTTAT
TCCAACAAATACACCCTCTAATTTCCAACCGAGGTATCCACACCAGCCTC
AACTCGTACCACCCTCAAAGCCTACTACTCACATGGTAGCTGATCAAGAT
CAAAAATATATGAAATCGTCCAAAATTATTGATCATCCCCCTCCAAATAT
TGATAAAGAGATGCCTGTTGATATAAAAAACAAAAATTTTAAAGATTTCT
CGGATTTACAATTTCCACCACCGAAAATTTCTGAATCATCTGCAAGTCCA
TCTAACGTATCCAATAACTATAAAGCACCGATTTTGTCACCTGAGTGTGA
ACCAGAATCTAAAACCAATTATTACGATACCAATGAGTCTTCTTCAGCTA
TGCAATCACCTATTAAAAAAGTGACAAGCAAGAAAAGAAAGCCACCCTCT
AAATCAAAAAGTACACAAGGATCCCAACCTGCTGAAATTGAAAATATAAA
TTCATCCCAAATCTCAAATGAAATAATGGGAAACCCTCCAATAGCTAATC
CTCACATTAGTCCATCCAAAATAAATAGCACAACAATTGACCCGAATTAC
CAAAATGATCCCAATTTTTCACAGTTACCAATGCAGCAAGGAATGTATCC
TCCTTATCATTATTATCCCCCACAATTTGTTCCTCACGGTAGAGCACCAC
CAGCACCATATGGTTCATCCTATCAACCAGGATATAATCAAGCCAACTAT
TACAATCAAATACCTCAAGCCTATCGACCGATGGCACCTCATCCTGTTCA
AAATGAAAGTGGAGTTAATCAATATGGAATGCCACATAAGCCAATACCAC
ACAACCAGGGATACGTTCATCCTTACGGACCTGGCCCTTACACTGGTTAT
GGTACTCAATTTGGACCCTCAAATCAATCTTTTCCCAATCAGAATAACCA
ACCAGTTCAAGAAAATTTGCAAATTCATACAAGTAAAGATCAAAACCTTT
CAGCACAGCCTACGTCAATGCCTAGTCAAATGAATATTATTGATGAGTCA
CAAAAATATCAAAGTGGTTCAATTAATCAGGGCTATCCAAATTCACAAAT
CAGTGGGCCTTTGCCACCTCCTGGCTATTCTTCTCAATATCCGGGTCTGC
CATATATTAACCCACCAGTAGCTACTGGTTCTCATTACCCAGGCGTTCAA
GGACATTTCTACTATCCTCCCGGTCCTCAATCTCACAATACTCCTGGACA
AGCACCCTCTGATCACCCTTTTTGGTCTCACCAACAGTCTTCTAATTATT
CTTCCATGCAATCATTAGTAGAAAATAACTCAAATGAATCTCAACCTCCG
AAAATTCAAGAATGATGCTATTTTTATTTATTTGAGAACATAAATTGTAA
CCTTGTCGTTAATGTGTAATAATTACTGTTTTTACTGTATTCATTATGTG
TCTAGATTTTGTATAGAATTTTTTATTGGATTTTAGAAAAATAATTTTAG
CAAATAGTTTGTTTTAATTCAGAATTTATTAGAGTAAATATGAAATGCTC
GTAATAACATTCAGAAAAACCAATTGCTCTTTAATTTTTATTGTTGA
back to top

protein sequence of SMED30011685-orf-1

>SMED30011685-orf-1 ID=SMED30011685-orf-1|Name=SMED30011685-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=654bp
MLDLFSDFKVPELGIVVTEVRLNALKQQVNGLITHKRKLDDEMDESEKSH
ENKKLKIKTESEKFWSEYNKELEARPIITEKMFSDMVRKARDEIIREEKE
REEFIKTRLSDKRTPVTETISEGSIKPENNNVEENSKVEQIVDSCTSQHP
NLPQAVSLAESTASKITHPSDSQVPVALDSHQNLPVSHHNQTPSRSQMSF
ENRPAISSHNFNQTFIPTNTPSNFQPRYPHQPQLVPPSKPTTHMVADQDQ
KYMKSSKIIDHPPPNIDKEMPVDIKNKNFKDFSDLQFPPPKISESSASPS
NVSNNYKAPILSPECEPESKTNYYDTNESSSAMQSPIKKVTSKKRKPPSK
SKSTQGSQPAEIENINSSQISNEIMGNPPIANPHISPSKINSTTIDPNYQ
NDPNFSQLPMQQGMYPPYHYYPPQFVPHGRAPPAPYGSSYQPGYNQANYY
NQIPQAYRPMAPHPVQNESGVNQYGMPHKPIPHNQGYVHPYGPGPYTGYG
TQFGPSNQSFPNQNNQPVQENLQIHTSKDQNLSAQPTSMPSQMNIIDESQ
KYQSGSINQGYPNSQISGPLPPPGYSSQYPGLPYINPPVATGSHYPGVQG
HFYYPPGPQSHNTPGQAPSDHPFWSHQQSSNYSSMQSLVENNSNESQPPK
IQE*
back to top

protein sequence of SMED30011685-orf-2

>SMED30011685-orf-2 ID=SMED30011685-orf-2|Name=SMED30011685-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MNRLKSIKMKVGQKSSDSRLPKPPKPPEKPLMPYMRYSRKVWESVKNANG
QLKLWEVGKIIGQMWRELPENEKSHFVEEYENDKLQYNDALRLYHNSPAY
KSWLLHKEKVEKSMDDNDSVDSMSQSQVSFYLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
IPR001849PH_domain
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016514SWI/SNF complex
Vocabulary: biological process
TermDefinition
GO:0043044ATP-dependent chromatin remodeling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 22..56
NoneNo IPR availableCOILSCoilCoilcoord: 87..107
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 600..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 609..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..338