1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase

Overview
Name1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
Smed IDSMED30011684
Length (bp)4174
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30011684) t-SNE clustered cells

Violin plots show distribution of expression levels for 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30011684) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30011684) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30011684) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011684

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30011684SMESG000049234.1 dd_Smed_v4_3221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011684SMESG000049234.1 dd_Smed_v4_3221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30011684SMESG000049234.1 dd_Smed_v4_3221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011684SMESG000049234.1 dd_Smed_v4_3221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011684SMESG000049234.1 dd_Smed_v4_3221_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 641/1169 (54.83%), Postives = 838/1169 (71.69%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLE----MFLKGQTE----IIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE    M   G++     I++++NE     + +   D E+    E +P     N+       HK  +     VK+ SD             D     +KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPANILEDDNE-----EEIESADQEE----EAHPEFKFGNELSADDLGHKEAVAN--SVKKASD-------------DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIEL-IPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 641/1169 (54.83%), Postives = 838/1169 (71.69%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLE----MFLKGQTE----IIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE    M   G++     I++++NE     + +   D E+    E +P     N+       HK  +     VK+ SD             D     +KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPANILEDDNE-----EEIESADQEE----EAHPEFKFGNELSADDLGHKEAVAN--SVKKASD-------------DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIEL-IPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 640/1161 (55.12%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE         + E  E+A   + L     ED    EI        + + HPE             E S   L  K       ++  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRS-----MMEAGESASPANIL-----EDDNEEEIES---ADQEEEAHPEFKFG--------NELSADDLGHK-------EAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 640/1161 (55.12%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE         + E  E+A   + L     ED    EI        + + HPE             E S   L  K       ++  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRS-----MMEAGESASPANIL-----EDDNEEEIES---ADQEEEAHPEFKFG--------NELSADDLGHK-------EAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 1245.34 bits (3221), Expect = 0.000e+0
Identity = 640/1161 (55.12%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE         + E  E+A   + L     ED    EI        + + HPE             E S   L  K       ++  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRS-----MMEAGESASPANIL-----EDDNEEEIES---ADQEEEAHPEFKFG--------NELSADDLGHK-------EAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIEL-IPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 588/1260 (46.67%), Postives = 816/1260 (64.76%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKS-DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPT-IIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL   K  +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED     ++P  +  K + + HPE+ +  +   LK                        + K+  LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q    DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGEDS----VSPREMPAKENDEAHPELKQNFIAKNLK--------------------GFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1225          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 1049.27 bits (2712), Expect = 0.000e+0
Identity = 595/1321 (45.04%), Postives = 826/1321 (62.53%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKS-DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPT-IIVKNDTDPHPEMHKT----ELNGLLKVKEQSDTQLNI-----------------------------KVKEEKEPDSRKNASKKGS----------------------------LTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL   K  +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED     ++P  +  K + + HPE+ +      L G    K+Q D+  ++                             +  E    + R    KKG                             LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q    DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGEDS----VSPREMPAKENDEAHPELKQNFIAKNLKGFGFSKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFRQKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1306          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 588/1272 (46.23%), Postives = 816/1272 (64.15%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKS-DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPT-IIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIV------------TDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL   K  +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED     ++P  +  K + + HPE+ +  +   LK                        + K+  LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q                DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGEDS----VSPREMPAKENDEAHPELKQNFIAKNLK--------------------GFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQPARRRNSSIAWIQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1237          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 591/1304 (45.32%), Postives = 823/1304 (63.11%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKS-DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKT---------ELNG-------------------------LLKVKEQSDTQLNIKVKEEKEPDSRKN-----------ASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL   K  +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED        ++    D   HPE+ +           ++G                             K     ++  K  +E  P+ ++N           + K+  LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q    DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGED--------SVSPPGDQRAHPEVEQPVSSSSPATPSISGPPPCATSSGSTSSITITTTGCSTSSSGPSKHILGGEMPAKENDEAHPELKQNFIAKNLKGFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1285          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 589/1288 (45.73%), Postives = 817/1288 (63.43%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGL-------------PFGKS----------------DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPT-IIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL               GK                 +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED     ++P  +  K + + HPE+ +  +   LK                        + K+  LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q    DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGEDS----VSPREMPAKENDEAHPELKQNFIAKNLK--------------------GFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1253          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0343599)

HSP 1 Score: 546.199 bits (1406), Expect = 5.924e-173
Identity = 272/497 (54.73%), Postives = 367/497 (73.84%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W++ +R +THN K NN+CPM+ L+KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 532.332 bits (1370), Expect = 7.162e-168
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0100670)

HSP 1 Score: 546.199 bits (1406), Expect = 5.924e-173
Identity = 272/497 (54.73%), Postives = 367/497 (73.84%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W++ +R +THN K NN+CPM+ L+KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 532.332 bits (1370), Expect = 7.162e-168
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0100671)

HSP 1 Score: 546.199 bits (1406), Expect = 5.924e-173
Identity = 272/497 (54.73%), Postives = 367/497 (73.84%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W++ +R +THN K NN+CPM+ L+KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 532.332 bits (1370), Expect = 7.162e-168
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0070651)

HSP 1 Score: 540.036 bits (1390), Expect = 9.860e-171
Identity = 272/497 (54.73%), Postives = 363/497 (73.04%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W  NLR +THN +  NVCP + L KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 533.102 bits (1372), Expect = 4.672e-168
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0301475)

HSP 1 Score: 540.036 bits (1390), Expect = 9.860e-171
Identity = 272/497 (54.73%), Postives = 363/497 (73.04%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W  NLR +THN +  NVCP + L KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 533.102 bits (1372), Expect = 4.672e-168
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:100537538])

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 614/1179 (52.08%), Postives = 800/1179 (67.85%), Query Frame = 3
Query:  228 EDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKI-CAVLLE-RISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKH--ELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVD-GEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQ-----AMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVP-----------TTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVK-VKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ 3695
            +D    ESNC  +VDE GFF+ WKSE  EGQVL+ S ++ +R  S  K+ K+ CA+    +  + L+DRI+ ICSGTDLVN+S+ +MV+Q+   A  W + LR L  NT+ NNVCPM  L+KHW+RL      NG IPVRSI++TFASGKTEK IFQ+LK+LGLP GK+DEI    FTF+KFY L  KICPRTDIE +FK+    K D+++ E+ + +LN+ QRDPRLNEILFPF N      I+   EP +     G LS + F R+LMSD+NAPVFLDRL + Q+MD PL+HY+INSSHNTYLTGRQFGGKSSVEIYRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTD+LFKDVI  I++TAF+TSE P+ILSFENHC+K QQYKLA+YCED+ GDLLL +P++    ++    PLPSP  L+ KILIKN+RLKPEVEK+QLE F K           + E  +P V  +  ED   +E N   ++    + HPE     ++G L + E+ + +  + ++  KE   R       S +AEEE      A++  Y Y+ ATTNIHPYLS ++NY Q VKF GFD AE+ NIH++MSSFNE+VGLG +R + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG+ G+LLKP+FMRRP+R FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y  ++ F+FRKV+LPDLAVLR+ VY+D  KLIGQR+LPL+GLQSGYRHISLR E N PL L T+FC I   TY+P+G   +VDALSDP+ +LS  EKR  Q+  MGIE SDI DVP           T        P K S+   +    P  + +  +  +S+V TP +   +                   L+  KTF KLIK+Q +E+  L+KKH K  A L  S +   D+  A H +E +   K +  +  RK+S  + L      E++ + + M     K++++ ++  +  E + M   H  EE  +    L  + E L K++   QE Q  +L ++ ER+ KEM+  Q K S++++K +  D+ +KNKAER+RR+RELN  NT++F+ +RK  A KQ ++ ++L     EQ
Sbjct:    1 QDPLVFESNCFFKVDESGFFLTWKSEGKEGQVLEFSLINSIRDASALKDPKVLCALEASGKCESNLEDRIICICSGTDLVNLSFMYMVTQNPTTAKEWTDGLRSLIQNTRANNVCPMTCLRKHWMRLSFLTNVNGQIPVRSITRTFASGKTEKGIFQALKDLGLPSGKNDEIQREIFTFDKFYSLTQKICPRTDIEVLFKKFKGDKGDYLSVEQFVHFLNDNQRDPRLNEILFPFFNSKCAFQIIQRYEPVKALVCAGLLSCDGFCRFLMSDENAPVFLDRLEVYQEMDHPLSHYFINSSHNTYLTGRQFGGKSSVEIYRQVLLTGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQGIKETAFLTSEYPVILSFENHCTKHQQYKLARYCEDIFGDLLLKQPLEDFPPKMEPGCPLPSPNDLKGKILIKNRRLKPEVEKKQLEDFRK-----------HMEAGEPSVSTNLFEDENEDETNTAELL---NEAHPE----RIHGCL-ITEEENREEEVLLRHRKE---RCECLTYNSYSAEEENVADELAVIQSYTYVAATTNIHPYLSNIINYAQAVKFTGFDEAEEKNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGFLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNAEA-FVFRKVILPDLAVLRVAVYDDNNKLIGQRILPLDGLQSGYRHISLRNEYNKPLPLATVFCNIILKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIEASDIADVPSDVWKGNKKRKTNQAGMMMKPQKDSDRPREN--MPISSKEVCEPADSSVLTPQLTIDD-------------------LKQTKTFLKLIKKQQKEVNALKKKHAKAHAALRSSHSAQLDRTVAQHEKEKHTLEKQLHKNTSRKVSESSSLEMSRDIEQQMKTAVM---NHKSKVLRIIDVYASECSEMLRWHSAEEQTVVEQHLLQQCEQLHKLLMLEQEQQTHQLTLLHERQSKEMRTNQAKTSMESSKAISQDKSIKNKAERERRVRELNSTNTRKFLTERKRLAMKQTKECEQLQAAQREQ 1132          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: plcb3 (phospholipase C, beta 3 (phosphatidylinositol-specific) [Source:ZFIN;Acc:ZDB-GENE-030616-594])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 428/1176 (36.39%), Postives = 656/1176 (55.78%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQG-EGQVLDLSQVSDVR---FGSKPKEDKICAVLLE-RISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHC-SKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQL----EMFLKGQTEIIQEENENAEDPDPLVMVDG--------EDGPMNEINPTIIVKNDTDPHPE-MHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRK-NASKKGS----LTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENS---NQEPLTPNLANKSGQSNNSTVSTPVVG----FSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTK 3614
            V++ L  G+ F ++DE++NS  S   +RVD  GFF++W      E ++LD+S + D R   F   PK+ +I  +L   +     D R++T+  G DLVNIS+ +  +  +     W + L  L  N    N      L K + +L L V  +G IPV++I K F+    +K +  +L+  GL F + D I P  FT+E F    +K+ PR ++E IF +L S  K F++ +++++++N  QRD RLNE+L+P   +D V+ +++  E +    +  ++S+  F +YL  ++N  V  +RL+I  DM+QPL+HY+INSSHNTYLT  Q  G SSVE+YRQVLL+GCRCIELDCW G+  ++EPIITHG  M T+I FKDVI AI ++AF TS  P+ILSFENH  S  QQ K+A+YC  + GD LL  P+DK+ L                          V  QQL    E+  K   +  ++ +  A +   +   DG         D P+++ +   ++ N  +   E M K   N   K  ++ D + + + +EE  PD +K N + +G+    + A EE + L  Y        I P           VKF+ F++A      + MSSF E  G+  ++      V+YNK+Q+SRIYP+G RVDS+N+MPQ+FWN GCQMVALNFQT DLAMQLN G FEYNG  GYLLKPEFMRR ++ FDPF+   +DG++A T+++KIISGQFL+DKKVG YVEVDM+GLP DT RK +RT+   NN L+P++ DD  F+F KVVLP LA LR+ VYE+ GK IG R+LP+  L+ GY +I L+ E N PL LP++        YIP    +  +AL++P  +LS   +R  QL  +       ++ PT G P K+     +++S   + +P+ P  ++ +  S  + ++ P  G      NN     + E      S+  L+   ++ KL+K+Q +E + L KKH K    L K Q  + ++ ++   R+ ++  K   + ++K    + ++         E +++  E+QK QM    + H  +   ++    + E ++    L+   + L  +  E Q  Q K+LK + ++E KE++    +  +++   ++  R    KAE++  IR++N+IN K
Sbjct:   18 VNEVLKRGSKFIKWDEEANSTPSLITLRVDPNGFFLYWTGGTSMEAEILDMSHIRDTRTGKFAKTPKDQRIREMLFSGKADGNSDSRLLTVVYGNDLVNISFLNFQAVQDGYCKLWTDELFKLATNMLSQNASRNTFLLKAYTKLKLQVTQDGKIPVKNILKMFSD---KKRVEMALEHCGLIFNRVDGIKPDDFTWEMFQNFLNKLSPRPEVERIFVDLGSKGKPFLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQVRQLMEKYETNTSQLERDQISLMSFTKYLGGEENTVVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCIELDCWKGRPPEEEPIITHGFTMTTEIPFKDVIEAIAESAFKTSPYPLILSFENHVDSAKQQAKMAEYCRSMFGDALLIDPLDKYPL--------------------------VPGQQLPSPQELLGKILIKNKKKHHHRASNGGSIRRKDGTDEQSSPLNDCPLSDGDVGQLMSNGGEKLAERMAKDHDNS--KSIDRGDGESDEEEEEEPIPDPKKHNNTDEGTAYSEVNATEEMSTLVNY--------IEP-----------VKFKSFEVAAKRKKFFEMSSFVETKGMDTLKNSPTEFVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLAMQLNMGVFEYNGRCGYLLKPEFMRRTDKHFDPFTTDIVDGIVANTVKVKIISGQFLNDKKVGVYVEVDMFGLPADTKRK-YRTKTSNNNSLDPVW-DDETFVFNKVVLPTLASLRVAVYEENGKFIGHRILPVSALRPGYHYICLKNELNQPLMLPSLLVYTEVQDYIPNEHQEYAEALTNPIKHLSLLAQRESQLLAL-------MEDPTEGGPTKQEEGDGTDSSCVTSADPIFPLPSSPTLPSVPTDLNPPPSGQKEDLVNNVLKVIEPE------SVDELKQHNSYLKLLKKQCKEFKELSKKHLKKMLALSKEQKTLFNQQSSELQRKRSQIEKRIRTSLKKNGSEDSVH--------RELNELDLELQK-QMEQFREEHMQKLLVLRQGQLQMEKEVKQFHLKEANQKLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKRLNS---IVEAR----KAEKE--IRDVNEINRK 1110          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: plcb3 (phospholipase C, beta 3 (phosphatidylinositol-specific) [Source:ZFIN;Acc:ZDB-GENE-030616-594])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 428/1162 (36.83%), Postives = 656/1162 (56.45%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQG-EGQVLDLSQVSDVR---FGSKPKEDKICAVLLE-RISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHC-SKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPE-MHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRK-NASKKGS----LTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENS---NQEPLTPNLANKSGQSNNSTVSTPVVG----FSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR---EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELN 3599
            V++ L  G+ F ++DE++NS  S   +RVD  GFF++W      E ++LD+S + D R   F   PK+ +I  +L   +     D R++T+  G DLVNIS+ +  +  +     W + L  L  N    N      L K + +L L V  +G IPV++I K F+    +K +  +L+  GL F + D I P  FT+E F    +K+ PR ++E IF +L S  K F++ +++++++N  QRD RLNE+L+P   +D V+ +++  E +    +  ++S+  F +YL  ++N  V  +RL+I  DM+QPL+HY+INSSHNTYLT  Q  G SSVE+YRQVLL+GCRCIELDCW G+  ++EPIITHG  M T+I FKDVI AI ++AF TS  P+ILSFENH  S  QQ K+A+YC  + GD LL  P+DK+ L     LPSP +L  KIL         ++ ++           I+ ++   E   PL      D P+++ +   ++ N  +   E M K   N   K  ++ D + + + +EE  PD +K N + +G+    + A EE + L  Y        I P           VKF+ F++A      + MSSF E  G+  ++      V+YNK+Q+SRIYP+G RVDS+N+MPQ+FWN GCQMVALNFQT DLAMQLN G FEYNG  GYLLKPEFMRR ++ FDPF+   +DG++A T+++KIISGQFL+DKKVG YVEVDM+GLP DT RK +RT+   NN L+P++ DD  F+F KVVLP LA LR+ VYE+ GK IG R+LP+  L+ GY +I L+ E N PL LP++        YIP    +  +AL++P  +LS   +R  QL  +       ++ PT G P K+     +++S   + +P+ P  ++ +  S  + ++ P  G      NN     + E      S+  L+   ++ KL+K+Q +E + L KKH K    L K Q  + ++ ++   R   +I K+++     ++K    + ++         E +++  E+QK QM    + H  +   ++    + E ++    L+   + L  +  E Q  Q K+LK + ++E KE++    +  +++   ++  R    KAE++  + E+N
Sbjct:   18 VNEVLKRGSKFIKWDEEANSTPSLITLRVDPNGFFLYWTGGTSMEAEILDMSHIRDTRTGKFAKTPKDQRIREMLFSGKADGNSDSRLLTVVYGNDLVNISFLNFQAVQDGYCKLWTDELFKLATNMLSQNASRNTFLLKAYTKLKLQVTQDGKIPVKNILKMFSD---KKRVEMALEHCGLIFNRVDGIKPDDFTWEMFQNFLNKLSPRPEVERIFVDLGSKGKPFLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQVRQLMEKYETNTSQLERDQISLMSFTKYLGGEENTVVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCIELDCWKGRPPEEEPIITHGFTMTTEIPFKDVIEAIAESAFKTSPYPLILSFENHVDSAKQQAKMAEYCRSMFGDALLIDPLDKYPLVPGQQLPSPQELLGKIL---------IKNKKKHHHRASNGGSIRRKDGTDEQSSPL-----NDCPLSDGDVGQLMSNGGEKLAERMAKDHDNS--KSIDRGDGESDEEEEEEPIPDPKKHNNTDEGTAYSEVNATEEMSTLVNY--------IEP-----------VKFKSFEVAAKRKKFFEMSSFVETKGMDTLKNSPTEFVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLAMQLNMGVFEYNGRCGYLLKPEFMRRTDKHFDPFTTDIVDGIVANTVKVKIISGQFLNDKKVGVYVEVDMFGLPADTKRK-YRTKTSNNNSLDPVW-DDETFVFNKVVLPTLASLRVAVYEENGKFIGHRILPVSALRPGYHYICLKNELNQPLMLPSLLVYTEVQDYIPNEHQEYAEALTNPIKHLSLLAQRESQLLAL-------MEDPTEGGPTKQEEGDGTDSSCVTSADPIFPLPSSPTLPSVPTDLNPPPSGQKEDLVNNVLKVIEPE------SVDELKQHNSYLKLLKKQCKEFKELSKKHLKKMLALSKEQKTLFNQQSSELQRKRSQIEKRIRTS---LKKNGSEDSVH--------RELNELDLELQK-QMEQFREEHMQKLLVLRQGQLQMEKEVKQFHLKEANQKLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKRLNS---IVEAR----KAEKEIDVNEIN 1107          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: CABZ01072157.1 (pep chromosome:GRCz11:17:2348540:2386569:-1 gene:ENSDARG00000090381.3 transcript:ENSDART00000121614.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072157.1)

HSP 1 Score: 302.753 bits (774), Expect = 6.709e-88
Identity = 146/285 (51.23%), Postives = 196/285 (68.77%), Query Frame = 3
Query: 1887 GATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPN-NGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDP 2738
            G     +  +SA+VNY QP KF  F+ A   N  + +SSF E  G  LI ++ +  V+YNKRQLSRIYP+G RVDS+N+ PQ FW+AGCQ VALN+QT D  MQLN   FE+NG +GYLLK + MRR ++ FDPF +  +D +IA+TL IKI SGQFLSDK V T VEV++ GLP D  RK +RT++    NG+NP + ++  F+F KV+LP++A LR+ V E+ GK IG R++PL+ LQ+G++HI LR+E N PL LP++F  I    Y+P    D  DAL +P
Sbjct:  139 GQEVTAYEEMSALVNYVQPNKFISFENAAKKNRCFVISSFVETKGESLIAKNAVDWVEYNKRQLSRIYPKGTRVDSSNYSPQPFWSAGCQFVALNYQTMDFPMQLNMALFEFNGRTGYLLKHDVMRRSDKKFDPFCDR-IDTIIASTLTIKIYSGQFLSDKAVKTGVEVELIGLPKDPKRK-YRTKMSSTANGINPDWNEEP-FIFEKVLLPEMAYLRLVVQEEGGKFIGHRIIPLDALQTGFQHIGLRSESNMPLMLPSLFVHIEMKDYVPAAFADFSDALFNP 420          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: BX936422.1 (phospholipase C, eta 1 [Source:NCBI gene;Acc:566479])

HSP 1 Score: 303.523 bits (776), Expect = 1.122e-85
Identity = 224/702 (31.91%), Postives = 334/702 (47.58%), Query Frame = 3
Query:  747 SFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQT--EIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTE------LNGLLKV-----KEQSDT---------------------------QLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIG---ATTNIHPYLSAMVNYTQPVKFQ-GFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQ--------FLSDKK--VGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYED--TGK-LIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKIT 2681
            + TFE+F   Y  +  R D+  +    S+ KD +T E++  +L   Q+              +    I++  E SEE ++ G L IE F  Y+ S            I QDMDQP+ +Y+I SSHNTYLTG Q    S  ++Y  VL +GCRC+E+DCWDG   D EP++ HG  + + I FK VI  I   AFV +E P+ILS ENHCS  QQ K+A++ +++ GD L        ++ +A+           +L               ++ LKG+     +  + E  E  D        D   +EI     +KN T   P  H+ E      L+ L+K      KE +D+                            L+  V  ++   SR       +    +++    Q++  G    T  +   LS +V +T  V  Q   D     N+     SF+E     L+       + +N+RQLSRIYP   R+DS+NF PQ +WN GCQ+VALN+QT    MQLN+ KF  NG SGY+LKP  M +   +F+P S+ P+       L IKIISGQ         L D+   +  +VEV++ GLP D  +++  TRVV +NG NP++ +   F      +P++A++R  V++    G+  +GQR +    L  GYRH+ L  EG   ++  +IF  IT
Sbjct:  189 TLTFEEFTVFYKMMSLRRDLFLLLMCFSDKKDHLTAEELGNFLRVEQK--------MSSVTPECCLDIINKFEVSEENKQNGVLGIEGFTNYMRSPACDVFNPQHHEINQDMDQPICNYFIASSHNTYLTGDQLLSHSKTDMYAWVLQAGCRCVEVDCWDGP--DGEPMVQHGYTLTSKITFKSVIETINKYAFVNNEFPVILSIENHCSIQQQKKIAQHLKEIFGDKL--------DVGEALNKDPKQLPSPNLLKG-------------KILLKGKRLPSYLSADAEEGEVSD--------DDSADEIEDDFKLKNSTSNGPSQHQVESHIRKKLDSLMKESQIGDKEDTDSFSIRALLRATHEGLQRNLRKLALFLSLTLSFSVFPQRHSKSRLKCQSVETEDDSQQEPSGGQFNRCGRRRKTIKLSRDLSDLVVFTNSVASQECLDEGSPCNV----LSFSEARAQNLVHHRAERFLTFNQRQLSRIYPSAYRIDSSNFNPQTYWNVGCQLVALNYQTEGRMMQLNRAKFMVNGGSGYVLKPSLMSKG--AFNPLSDEPLPANPKKQLVIKIISGQQLPKPPDSMLGDRGEIIDPFVEVEIIGLPVDCCKEQ--TRVVDDNGFNPVWEETLSFTLH---MPEVALVRFLVWDHDPIGRDFVGQRTIAFSSLMPGYRHVYL--EG---MTEASIFVHIT 835          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 642/1169 (54.92%), Postives = 837/1169 (71.60%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEP-LTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA-------NHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   + +GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R+G+ PK+ KI + L  + +    LD +I+ +C GTDLVNIS+T+MV++  E+A  W+  L+ +THN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+PS+FTF+KFYEL  KICPRTD EE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K G++S   F RYLMSD+NAPVFLDRL + Q+M+ PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI+DTAFVTSE P+ILSFENHCSK QQYK++KYCE++ GDLLL+K ++ H L    PLPSP  L++KILIKNKRLK EVEK+QLE       + + E  E A  P  ++  D E+   N          + + HPE    +    L   + S  +     K+  E   ++N +KKG++T E+EQA +A Y Y+GATTNIHP+LS+M+NY QPVKFQGF +AE+ NIH++MSSFNE+VGLG ++   +  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y D+  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP          DKK + SN +  +TP     S +   S  + P  G  N K  D         + +  L+  K F K  K+Q +E+  L+KKH K+ +++ K Q    DK+ A       +H R + K +K KG+        NC     +K++   +  ++    K+++ D+V  HT E+T M      EE  L    L  + ELL ++++ +   Q ++LK+  +RE KEMKA Q K S++  K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEAL-----KSMMEAGETA-TPVSILEDDIEEEIEN-------ADQEEEAHPEF---KFGSELSSDDLSQKEAANIAKKMAEDAEQENNNKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNDEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPADN----TKNDKKGKTSNAKTNVTP---QSSSEVRPSVTAAPGAGTENKKAID------IPQVKVEELKQMKAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGA-------SNC---HEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFL 1130          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 640/1169 (54.75%), Postives = 834/1169 (71.34%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEP-LTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA-------NHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   + +GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R+G+ PK+ KI + L  + +    LD +I+ +C GTDLVNIS+T+MV++  E+A  W+  L+ +THN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+PS+FTF+KFYEL  KICPRTD EE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K G++S   F RYLMSD+NAPVFLDRL + Q+M+ PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI+DTAFVTSE P+ILSFENHCSK QQYK++KYCE++ GDLLL+K ++ H L    PLPSP  L++KILIKNKRLK EVEK+QLE       + + E  E A  P  ++  D E+   N          + + HPE    +    L   + S  +     K+  E   ++N +KKG++T E+EQA +A Y Y+GATTNIHP+LS+M+NY QPVKFQGF +AE+ NIH++MSSFNE+VGLG ++   +  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y D+  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP          DKK + SN +  +TP     S +   S  + P  G  N K    +            L +   F K  K+Q +E+  L+KKH K+ +++ K Q    DK+ A       +H R + K +K KG+        NC     +K++   +  ++    K+++ D+V  HT E+T M      EE  L    L  + ELL ++++ +   Q ++LK+  +RE KEMKA Q K S++  K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEAL-----KSMMEAGETA-TPVSILEDDIEEEIEN-------ADQEEEAHPEF---KFGSELSSDDLSQKEAANIAKKMAEDAEQENNNKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNDEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPADN----TKNDKKGKTSNAKTNVTP---QSSSEVRPSVTAAPGAGTENKKGKSSR------------LVSAPAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGA-------SNC---HEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFL 1124          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 1230.7 bits (3183), Expect = 0.000e+0
Identity = 640/1169 (54.75%), Postives = 834/1169 (71.34%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEP-LTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA-------NHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   + +GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R+G+ PK+ KI + L  + +    LD +I+ +C GTDLVNIS+T+MV++  E+A  W+  L+ +THN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+PS+FTF+KFYEL  KICPRTD EE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K G++S   F RYLMSD+NAPVFLDRL + Q+M+ PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI+DTAFVTSE P+ILSFENHCSK QQYK++KYCE++ GDLLL+K ++ H L    PLPSP  L++KILIKNKRLK EVEK+QLE       + + E  E A  P  ++  D E+   N          + + HPE    +    L   + S  +     K+  E   ++N +KKG++T E+EQA +A Y Y+GATTNIHP+LS+M+NY QPVKFQGF +AE+ NIH++MSSFNE+VGLG ++   +  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y D+  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP          DKK + SN +  +TP     S +   S  + P  G  N K    +            L +   F K  K+Q +E+  L+KKH K+ +++ K Q    DK+ A       +H R + K +K KG+        NC     +K++   +  ++    K+++ D+V  HT E+T M      EE  L    L  + ELL ++++ +   Q ++LK+  +RE KEMKA Q K S++  K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEAL-----KSMMEAGETA-TPVSILEDDIEEEIEN-------ADQEEEAHPEF---KFGSELSSDDLSQKEAANIAKKMAEDAEQENNNKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNDEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPADN----TKNDKKGKTSNAKTNVTP---QSSSEVRPSVTAAPGAGTENKKGKSSR------------LVSAPAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGA-------SNC---HEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFL 1124          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 1228.39 bits (3177), Expect = 0.000e+0
Identity = 639/1169 (54.66%), Postives = 832/1169 (71.17%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEP-LTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA-------NHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   + +GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R+G+ PK+ KI + L  + +    LD +I+ +C GTDLVNIS+T+MV++  E+A  W+  L+ +THN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+PS+FTF+KFYEL  KICPRTD EE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K G++S   F RYLMSD+NAPVFLDRL + Q+M+ PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI+DTAFVTSE P+ILSFENHCSK QQYK++KYCE++ GDLLL+K ++ H L    PLPSP  L++KILIKNKRLK EVEK+QLE       + + E  E A  P  ++  D E+   N          + + HPE              +  ++L+     +KE     N +KKG++T E+EQA +A Y Y+GATTNIHP+LS+M+NY QPVKFQGF +AE+ NIH++MSSFNE+VGLG ++   +  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y D+  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP          DKK + SN +  +TP     S +   S  + P  G  N K    +            L +   F K  K+Q +E+  L+KKH K+ +++ K Q    DK+ A       +H R + K +K KG+        NC     +K++   +  ++    K+++ D+V  HT E+T M      EE  L    L  + ELL ++++ +   Q ++LK+  +RE KEMKA Q K S++  K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEAL-----KSMMEAGETA-TPVSILEDDIEEEIEN-------ADQEEEAHPEF-------------KFGSELSSDDLSQKEA---ANIAKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNDEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPADN----TKNDKKGKTSNAKTNVTP---QSSSEVRPSVTAAPGAGTENKKGKSSR------------LVSAPAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGA-------SNC---HEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFL 1111          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 639/1169 (54.66%), Postives = 832/1169 (71.17%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEP-LTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA-------NHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   + +GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R+G+ PK+ KI + L  + +    LD +I+ +C GTDLVNIS+T+MV++  E+A  W+  L+ +THN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+PS+FTF+KFYEL  KICPRTD EE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K G++S   F RYLMSD+NAPVFLDRL + Q+M+ PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI+DTAFVTSE P+ILSFENHCSK QQYK++KYCE++ GDLLL+K ++ H L    PLPSP  L++KILIKNKRLK EVEK+QLE       + + E  E A  P  ++  D E+   N          + + HPE              +  ++L+     +KE     N +KKG++T E+EQA +A Y Y+GATTNIHP+LS+M+NY QPVKFQGF +AE+ NIH++MSSFNE+VGLG ++   +  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y D+  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP          DKK + SN +  +TP     S +   S  + P  G  N K    +            L +   F K  K+Q +E+  L+KKH K+ +++ K Q    DK+ A       +H R + K +K KG+        NC     +K++   +  ++    K+++ D+V  HT E+T M      EE  L    L  + ELL ++++ +   Q ++LK+  +RE KEMKA Q K S++  K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEAL-----KSMMEAGETA-TPVSILEDDIEEEIEN-------ADQEEEAHPEF-------------KFGSELSSDDLSQKEA---ANIAKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNDEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPADN----TKNDKKGKTSNAKTNVTP---QSSSEVRPSVTAAPGAGTENKKGKSSR------------LVSAPAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGA-------SNC---HEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFL 1111          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 1243.02 bits (3215), Expect = 0.000e+0
Identity = 639/1161 (55.04%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R  + PK+ KI A L  + +  N L+ RI+ +CSGTDLVNI +T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L       G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L    PLPSP  L++KILIKNKRLKPEVEK+QLE         ++   E  E   P  ++  ED    EI        + + HPE              +   +L+      KE  +  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +    P  AN + QS++    T      + ++  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEA--------LKSMMEAGESAAPASIL--EDDNEEEIES---ADQEEEAHPEY-------------KFGNELSADDYSHKE--AVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EIKKETEIKIQTLTTDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 1243.02 bits (3215), Expect = 0.000e+0
Identity = 639/1161 (55.04%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R  + PK+ KI A L  + +  N L+ RI+ +CSGTDLVNI +T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L       G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L    PLPSP  L++KILIKNKRLKPEVEK+QLE         ++   E  E   P  ++  ED    EI        + + HPE              +   +L+      KE  +  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +    P  AN + QS++    T      + ++  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEA--------LKSMMEAGESAAPASIL--EDDNEEEIES---ADQEEEAHPEY-------------KFGNELSADDYSHKE--AVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EIKKETEIKIQTLTTDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 592/1031 (57.42%), Postives = 753/1031 (73.04%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCL 3233
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R  + PK+ KI A L  + +  N L+ RI+ +CSGTDLVNI +T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L       G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L    PLPSP  L++KILIKNKRLKPEVEK+QLE         ++   E  E   P  ++  ED    EI        + + HPE              +   +L+      KE  +  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +    P  AN + QS++    T      + ++  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEA--------LKSMMEAGESAAPASIL--EDDNEEEIES---ADQEEEAHPEY-------------KFGNELSADDYSHKE--AVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPS----------DTSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL 992          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 1122.84 bits (2903), Expect = 0.000e+0
Identity = 558/895 (62.35%), Postives = 694/895 (77.54%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPT 2825
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R  + PK+ KI A L  + +  N L+ RI+ +CSGTDLVNI +T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L       G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L    PLPSP  L++KILIKNKRLKPEVEK+QLE         ++   E  E   P  ++  ED    EI        + + HPE    +    L   + S  +      ++   D     +KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEA--------LKSMMEAGESAAPASIL--EDDNEEEIESA---DQEEEAHPEY---KFGNELSADDYSHKEAVANSVKKTSDDLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPS 879          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb1 (phospholipase C, beta 1 [Source:MGI Symbol;Acc:MGI:97613])

HSP 1 Score: 382.489 bits (981), Expect = 5.805e-112
Identity = 194/427 (45.43%), Postives = 275/427 (64.40%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSEN---------SNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR 3167
            +S +VNY QPVKF+ F+I++  N  + MSSF E  GL  + +  +  V+YNK QLSRIYP+G RVDS+N+MPQ+FWNAGCQMVALNFQT DLAMQ+N G +EYNG SGY LKPEFMRRP++ FDPF+E  +DG++A TL +KIISGQFLSDKKVGTYVEVDM+GLP DT RK F+T+    N +NP++ ++ + +F+KVVLP LA LRI  YE+ GK IG R+LP++ ++ GY +I LR E N PL+LP +F  I    Y+P+   D+++ALS+P  Y++  E+R KQLA + +E  D  +V     P +   +  SE          ++   L P   +++  S  +  S      + +       E +   I    L+  K+F KL K+  +E+++L K+H K +  L K  T   +++  ++ R
Sbjct:  540 MSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPI-VFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLE--DEEEVKKEADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIE--ELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYLR 961          

HSP 2 Score: 357.066 bits (915), Expect = 5.452e-103
Identity = 181/436 (41.51%), Postives = 277/436 (63.53%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGS---KPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            VSD L  G  F ++D+DS ++ +  ++R D  GFF +W  +  E ++LDLS V D R G     PK+ K+  +L       L+ R++T+  G DLVNIS+ ++V+   E+A  W N +  L  N    N+     L+K + +L L V   G IP+++I + F++ +  K +  +L+   LP  ++D I    FT + +    + +CPR +I+ IF E  + SK ++T +++++++N  QRDPRLNEIL+P   ++ V+ +++  EP+    K+G++S++ F RYL  ++N  V  ++L++ +DM QPL+HY+INSSHNTYLT  Q  G SSVE+YRQVLLSGCRC+ELDCW G+  ++EP+ITHG  M T+I FK+VI AI + AF TS  PI+LSFENH   P QQ K+A+YC  + GD LL +P++K+ L   V
Sbjct:   18 VSDSLKKGTKFVKWDDDS-TIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADR--KRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGV 450          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q15147|PLCB4_HUMAN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3)

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 640/1161 (55.12%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ W+SE  EGQVL+ S ++ +R G+ PK+ KI A L  + +  N L+ RIV +CSGTDLVNIS+T+MV+++ E+   W+  LR + HN + NNV PM  LKKHW++L      NG IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++F++EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE         + E  E+A   + L     ED    EI        + + HPE             E S   L  K       ++  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T     ++  +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRS-----MMEAGESASPANIL-----EDDNEEEIES---ADQEEEAHPEFKFG--------NELSADDLGHK-------EAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9QW07|PLCB4_RAT (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2)

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 639/1161 (55.04%), Postives = 831/1161 (71.58%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            +K +EFNW++ V   L  GA FDRY+E+S   E NCL +VDE+GFF+ WKSE  EGQVL+ S ++ +R  + PK+ KI A L  + +  N L+ RI+ +CSGTDLVNI +T+MV+++ EI   W+  LR + HN + NNV PM  LKKHW++L      +G IPVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP EE +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQY+++KYCED+ GDLLL + ++ H L     LPSP  L++KILIKNKRLKPEVEK+QLE         ++   E  E   P  ++  ED    EI        + + HPE              +   +L+      KE  +  N+ KKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  QL  MGIETSDI DVP+            S+N  +    P  AN + QS++    T      + ++  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E +   K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTSGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYQMSKYCEDLFGDLLLKQALESHPLEPGRLLPSPNDLKRKILIKNKRLKPEVEKKQLEA--------LKSMMEAGESAAPASIL--EDDNEEEIES---ADQEEEAHPEY-------------KFGNELSADDFSHKE--AVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQLRAMGIETSDIADVPSD----------TSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKGIE-LIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL---EIKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 1119          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q07722|PLCB4_BOVIN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus OX=9913 GN=PLCB4 PE=1 SV=1)

HSP 1 Score: 1076.23 bits (2782), Expect = 0.000e+0
Identity = 554/1005 (55.12%), Postives = 716/1005 (71.24%), Query Frame = 3
Query:  633 PVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNE-------INPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            PVRSI++TFASGKTEK+IFQ+LKELGLP GK+DEI+P++FT+EKFYEL  KICPRTDIE++FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +      I++  EP E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MD PLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLL+GCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSK QQYK++KYCED+ GDLLL + ++ H L    PLPSP  L++KILIK +  + EVEK+QLE         ++   E  E   P+ M++ ++    E        +P     N+       HK  +     VK+ SD             D     SKKG +T E+EQA +A Y Y+GATTNIHPYLS M+NY QPVKFQGF +AE+ NIHY+MSSFNE+VGLG ++   I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWN+GCQMV+LN+QTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R+FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++S F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPTIFC I   TY+P+G  D+VDALSDP+ +LS  EKR  Q+  MGIETSDI DVP+            S+N  +       AN + QS++    T         +  K  E     + +  L+  K + K +K+Q +EL +L+KKH K+ + + K      DK+ A + +E     K+    M+K    NCL    +K++   +   +    K+++ ++V  HT EW+ M   H  EE ++    L  + ELL K++    E Q ++LK+  +RE KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+
Sbjct:    1 PVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKQGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKKQTTETEVEKKQLEA--------LKSMMEAGESAAPVNMLEDDNEEEIESAEQEEEAHPEYKYGNELSADDLGHKEAIAN--SVKKASD-------------DLEHENSKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNSGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSD----------TSKNDKKGKANTAKANVTPQSSSELRPTTTAALGAGLEAKKGIEL-IPQVRIEDLKQMKAYLKHLKKQQKELSSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKLTHEKILEKAMKKKGGSNCL---EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSDMINTHSAEEQEIRDLLLSQQCELLRKLLISAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFL 967          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|G5EBH0|PLCB_CAEEL (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 322/711 (45.29%), Postives = 449/711 (63.15%), Query Frame = 3
Query: 1821 ASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGN--FPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG----KPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIV------------TDKLNANHAREINKKVKVKGSLMRKISH--------------------------------YNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ----EKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            + K+  LT EEE+ + A+YHY GATTNIHP LS++VNYT PVKF GFD+AE  N+H+HMSSF+E+ GLG +++     V+YNKRQ SRIYP+G RVDS+NF+PQIFWNAGCQMV+LNFQTPD+ MQLN GKFEYNG SGYLLKP+F+RRP+R+FDPFSESP+DGVIAA   +++ISGQFLSD+K+GTYVEV+MYGLPTDT RKE +T+V+P NGLNP+Y +D  F+FRKVVLP+LAVLR  VY++ GK +GQR+LPL+GLQ+GYRHISLR++ N  F LS P +F +I   TY+P+ L  LVDAL+DPRA+LS+++KR + LA MG++ SDI DVP T     +  K+PP +   +++         +  G   +S  S+ +   +   +    D+ K D I +  L  DK F KL+KR  +EL++LRKKH+K    + K Q                DKL  N+ R   K+   + SL   +S                                   C    +            + V  +++  LV T T EW++M  +H +EE +L    L+ + +LL K+M E Q++Q   LK+  E E K++K  QTK S++  K +  D+ +K KAERDRR++ELN+ N K F+++RK  A K  +  ++L ++H +Q    +K+   A+D E       +KE+ LA +  + +
Sbjct:  727 SKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILS-PVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDVPNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASSTIRSPNEQPQPVAVDKFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQPARRRNSSIAWIQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSASGTVTVSVCSPSGASCSGYSTGGPSTPVACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRHDEEEFELKKVQLKEQFDLLRKLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLDKDFHKALDAEVG----NYKEEQLAAQPTSVV 1431          

HSP 2 Score: 474.167 bits (1219), Expect = 3.523e-142
Identity = 260/532 (48.87%), Postives = 353/532 (66.35%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLER-ISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGL-------------PFGKS----------------DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQ-EPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGED 1652
            +K F+FNW+  +  +L++G+ FDRYD++S  LE N  VR+DE GFF+ W  E  +  VLD+ Q+ + R G  PK+ +I   L +R  S  + +R + I  G DLVN+    +V++  E+A      +  +  ++++ +VCP  QL K+   L + V     IP++ I KTF+SGK EK++ + L +LGL               GK                 +E+D    TFEKF  LY+KICPRT+++E+F +LS  K+++T E++I +LNE QRDPRLNEILFPF +   +  +L  +E   +Y+++GK+S + F R+LMSD+N PVFLDR+ +  DMDQPL HYYINSSHNTYLTGRQ+GGKSS EIYRQVLLSGCRCIELDCWDG GE++ EPIITHGKAMCTD+ FKDV+  IRDTAF  S+ P++LSFENHCSK  Q K+AKYC D+ GD+LL+KP +   L   V LPSP +LRKKILIKNKRLK ++E+ QL+ FL+     + EE+E  E P+    V GED
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLREGK--LDEEDELNETPE----VVGED 527          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|P13217|PIPA_DROME (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4)

HSP 1 Score: 540.036 bits (1390), Expect = 9.884e-170
Identity = 272/497 (54.73%), Postives = 363/497 (73.04%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDS-----NSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENA 1613
            +K +EF+W  PV  +L  G  FDR+ E+      N  E + L +VDEYGFF++WKSE  +G V++L QVSD+R G  PK+ KI   + ++       LD R +TICS TD +NI+Y H++  D   A  W  NLR +THN +  NVCP + L KHW+RL   V+ +G IPV++++KTFASGKTEK+++  +K+ GLP  K+  +    FTF+KFY LYHK+CPR DIEE+F  ++  K DFI+ E+ I+++N+ QRDPR+NEIL+P   +     I+++ E  EE +K  ++S++ F RYLMSD+NAPVFLDRL+   +MDQPLAHYYINSSHNTYL+GRQ GGKSSVE+YRQ LL+GCRC+ELDCW+GKGED+EPI+THG A CT+ILFKD I AI D AFV+SE P+ILSFENHC++ QQYKLAKYC+D  GDLLL +P+  H L   +PLP P KL++KILIKNKR+KPEVEK +LE++LKG+ +   +  E+A
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDA 498          

HSP 2 Score: 533.102 bits (1372), Expect = 4.684e-167
Identity = 283/638 (44.36%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 1878 HYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR-EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEM-KFKEDLLATKRAT 3785
            +Y G+TTN+HP+LS+MVNY QP+KFQGFD A + NI ++MSSF E+ G+  +++  I  V+YNKRQ+SRIYP+G R DS+N+MPQ+FWNAGCQMV+LNFQ+ DL MQLNQGKFEYNG  GYLLKP+FMRR ++ FDPF+++P+DGVIAA   +K+I+GQFLSDKKVGTYVEVDM+GLP+DT +KEFRTR+V NNGLNP+Y +D  F+FRKVVLPDLAVLR GVYE++GK++GQR+LPL+GLQ+GYRH+SLRTE NFP+SLP +F  I    Y+P+G  D +  LSDPR +    +++ +Q+  +GIE                              +   A  +G++       P + F          EP    ++L  L  +K FQK+ K+Q +EL+ LRKKH K+   + K+Q    DKL    ++ +I     +K S                                      +   T +WT M  +HRKEE D+    ++  Q+ +  +M  VQ  Q K+L+    R+IK++ A+Q K S D  K V ND+ LK K E+DRR+RE    N KRF++++K    KQ R  ++L   H +Q +E  + + K   L++M K +E+   T+  T
Sbjct:  538 NYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQ----------------------------SGGAARDAGKAKEEEKKEPPLVF----------EP----VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNS--------------------------------------INDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQK---LMDMYKIEEEAYKTQGKT 1091          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A0X3P0N3 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Schistocephalus solidus OX=70667 GN=TR168281 PE=4 SV=1)

HSP 1 Score: 1610.12 bits (4168), Expect = 0.000e+0
Identity = 803/1231 (65.23%), Postives = 990/1231 (80.42%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN-PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKN-DTDPHPEMHKTELNGL-LKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            M+SDIAKRQRTVPS+K ++F WR+PV   L  GA+FDR+DE++  +E  C +RVDE GFF+ WKSE  EGQVL+LSQVSDVR G KPK++K+ ++L ER +N PLD+R++T+CSG DLVNISYT+ V+   E+A +WI ++R LTHNTK  NVCPM QL+KHWLR+ L V   G IPVR ++KTFASG+ E+IIFQSLKELGLP GK+DE++PS FTFE+FYELYHKICPRTDIEE+FK LSN K  I+ EK++E+LNEVQRDPRLNEIL+P+AN+ T++YI +  EP E+   +  L++ECFYRYLMSDDNAPVFLDRL+I QDMDQPL HYYINSSHNTYL GRQFGGKSSVEIYRQVLL+GCRCIELDCWDGKG+DQEPIITHGKAMCTDILFKDVIYA+RDTAFVTS+ P+I+SFENHCSK QQ+KLAKYCED+LGDLLLTKPIDKH L    PLPSP KL++KIL+KNKRL P+VEK QLE+FLKGQT+ IQEE E+++  D +  VDGE GP+N+++PT+  K  D DPHPE      +G  +     S + L  ++ E  E     N  ++GSLT EEEQAMLAQYHY GATT IHP LS+MVNY Q VKFQGFD+AE+ N+ +H+SSFNEN  LGLI+  C   V YNKRQ+SRIYPRGNRVDS+N+MPQIFWNAGCQMVALNFQTPDLAMQLNQG+FEYNGN G+LLKPEFMRRPER FDPFSESPMDGVIAAT E++IISGQFLSD+KVGTYVEVDMYGLPTDT RKEFRTRVVPNNGLNP+YG+D+VF+FRKVVLPDLAVLR  VYEDTGKLIGQRVLPL+GLQSGYRHISLRTEGNFPLSLPT+FC+++ TTY+PEGL DLVDALSDPRA+LSKEE+RMKQLA MGI++S+I DVP T K  K+    +   +    +  +  +  G    +  ST     +++KK++K+++PKF  ISL +L  DK ++KL+K+Q ++LE LR++HEK+++ + ++ TI+TDKLNA HA+       +K +  +                 N  +  ++++QK++M DLV+  TD+W+S+K Q  KE H L ++F+++R+ELLLKV++E  EDQK+ELK IQERE KEMKAQQTK SI++N+ V+ DRKLKNKAERDRRIRELND NTKRFIDQRKAQAQ+ +RQ QEL R+HDE+E+ VV+ +++ER  L   ++E+LLA+KR T I
Sbjct:    1 MSSDIAKRQRTVPSAKVYDFVWRRPVPPALREGAYFDRFDEETGIVELGCFLRVDEDGFFLFWKSEANEGQVLELSQVSDVRQGCKPKDEKVVSILTERFANRPLDERVMTVCSGLDLVNISYTNFVASTPEVAAWWIQSVRGLTHNTKAQNVCPMTQLRKHWLRITLTVNPRGKIPVRVVTKTFASGRNERIIFQSLKELGLPSGKNDEVEPSEFTFERFYELYHKICPRTDIEELFKSLSNGKPTISHEKMMEFLNEVQRDPRLNEILYPYANRQTIRYIQEAYEPQEKSASQDGLTLECFYRYLMSDDNAPVFLDRLDIYQDMDQPLCHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGKGDDQEPIITHGKAMCTDILFKDVIYAVRDTAFVTSDCPVIMSFENHCSKHQQFKLAKYCEDILGDLLLTKPIDKHPLEPGYPLPSPEKLKRKILVKNKRLTPDVEKHQLELFLKGQTDPIQEETESSDLADTIACVDGEVGPLNDLDPTMPPKPLDIDPHPETKSRPGSGTTINTLSPSGSSLPCRLSE-AEMKRLVNKKEEGSLTVEEEQAMLAQYHYTGATTAIHPLLSSMVNYAQAVKFQGFDVAEERNLSFHVSSFNENRALGLIKCYCTEFVVYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGRFEYNGNCGFLLKPEFMRRPERQFDPFSESPMDGVIAATCEVRIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQSGYRHISLRTEGNFPLSLPTLFCRVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADVPATTKSLKRSGQSRVGVT----VNSSCPSSCGIDRPAGTSTSASNVNSSKKEEKREDPKFPGISLGMLRNDKNYRKLVKKQAKDLELLRRRHEKEASTMLRAHTILTDKLNAAHAK---ASAGIKAAAQKS----------------NGVNSQLKDLQKSEMSDLVRQQTDQWSSLKAQQMKEVHHLVLTFMDARKELLLKVLREAHEDQKRELKQIQERENKEMKAQQTKISIESNRTVLGDRKLKNKAERDRRIRELNDYNTKRFIDQRKAQAQRNERQIQELCRRHDEEEQGVVTGVNRERDELIHSYQEELLASKRTTVI 1207          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A4Z2CYF8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Schistosoma japonicum OX=6182 GN=EWB00_006501 PE=4 SV=1)

HSP 1 Score: 1586.24 bits (4106), Expect = 0.000e+0
Identity = 811/1234 (65.72%), Postives = 988/1234 (80.06%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDG-PMN-----EINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPS+KAFEF W++PV + L +G HFDRYDE++  LE NC VRVD+ GFF++W+SE  + Q L+LSQ+SDVR G+KPK++K+ A + ER S    DRIVTICSG DLVNI+YTHMV++D E A+FWI +LR LTHNTK  NVCPM QL+KHWLRL L V A   IPVR I KTFASG+ E+I++QSLK+L LP GK+D+IDP+ F FEKFYELYHKICPRTDIE++FK LS  K+ I  +K+IE+LNE QRDPRLNEIL+PFANK T+KYI +N E  EE++   ++SIECFYRYLMSDDNA VFLD+L+I QDMDQPL+HYYINSSHNTYL GRQFGGKSSVEIYRQVLL+GCRCIELDCWDG+GEDQEPIITHGKAMC+DILFKDVIYAIRDTAFV S+ P+I+SFENHCSK QQYKLAKYCE++LGD+LLTKP+D + L   VPLP P KL++KILIKNKRLKPE EKQQLE+FLKGQT+ IQEENE  EDPD  +  D  DG P N     +++ T I    +D    +        L     S     +++K+E+           G+LTAEEEQ M+A YHY GAT++IHP LS+ +NY QPVKFQGFD+AED NIH+HMSSF+E + LGL++   I  V+YNKRQ+SRIYPRGNRVDS+N+MPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGN GYLLKPEFMRRPER FDPFSESPMDGVIAAT E+KIISGQFLSD+KVGTYVEVDMYGLPTDT RKEFRTRVVPNNGLNP+YGDD+VF+FRKVVLPDLAVLR  VYEDTGKLIGQRVLPL+GLQ+GYRHISLRTEGNFPLSLPT+FC+++ TTY+PEGL DLVDALSDPRA+LSKEE+RMKQLA MGI++S+I DVP+TG   +         ++ +     L++ SG  + + VS+     ++ KKDDKKD+PKFD IS+ LL+TDK +QKLIK+Q +ELE L+K+ EKD+  + ++ TI+TDKLN +HA+E       + S  R I+  N             ++  +E+  +NQM +LV+ HTD+W+++K    KE +DL +SF ++R++LL+K+MKEVQE+QK+EL+IIQ+RE+KEMKAQQTKASI+++++V+NDRKL+NKAERDRRIRELND NTKRFIDQRK QAQ+ D+QTQELN++H   E+E+V+ I KER     K++EDLLA KRAT I
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFIWKRPVPEVLQSGEHFDRYDEEAGILEPNCFVRVDKDGFFIYWQSENNDSQQLELSQISDVRSGTKPKDEKLTAQIQER-SGKSWDRIVTICSGLDLVNINYTHMVAKDVETASFWIQSLRSLTHNTKAANVCPMTQLRKHWLRLTLTVNARNRIPVRVIMKTFASGRNERIVYQSLKDLNLPHGKNDDIDPNEFPFEKFYELYHKICPRTDIEDLFKSLSKGKNHIHADKMIEFLNETQRDPRLNEILYPFANKQTIKYIQENYETQEEFKNTDEISIECFYRYLMSDDNACVFLDKLDIYQDMDQPLSHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCSDILFKDVIYAIRDTAFVASDCPVIMSFENHCSKQQQYKLAKYCEEILGDMLLTKPLDNYPLEPGVPLPPPEKLKRKILIKNKRLKPEAEKQQLELFLKGQTDAIQEENEVTEDPDLTIDRDDGDGVPGNKPNNGDLSSTTIGGGGSDTTISLSTIPTPQTLSTCTSSAELKRLQLKKEE-----------GNLTAEEEQIMMAHYHYTGATSSIHPLLSSFINYAQPVKFQGFDVAEDENIHHHMSSFSETMALGLLKNQAIEFVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRPERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGDDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADVPSTGNAKRVGGVVGGSGTSGQLSGSALSSVSGSGDVANVSS-----NSTKKDDKKDDPKFDPISISLLQTDKIYQKLIKKQAKELEILQKRQEKDAVTMLRNHTIITDKLNTSHAKE-------RSSTKRSINKEN------------GQNAALEDTHRNQMCELVRQHTDQWSNLKSTQMKEVYDLVLSFFDTRKDLLVKIMKEVQEEQKRELRIIQDREVKEMKAQQTKASIESSRSVMNDRKLRNKAERDRRIRELNDYNTKRFIDQRKLQAQRHDKQTQELNKRHALDEQEIVNGIKKEREEFMRKYEEDLLALKRATVI 1198          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A5K4F0P8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1575.07 bits (4077), Expect = 0.000e+0
Identity = 814/1255 (64.86%), Postives = 983/1255 (78.33%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDG-PMNEIN-----------------PTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTG--------KPFKKPPDKKSENSNQEPLTPN-LANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPS+KAFEF W++PV + L  G HFDRYDE++  LE NC VRVD+ GFF++W+SE  + Q L+LSQ+SDVR G+KPK++K+ A + E+ S    DRIVTICSG DLVNI+YTHMV++D E A+FWI +LR LTHNTK  NVCPM QL+KHWLRL L + A   IPVR I KTFASG+ E+I++QSLK+L LP GK+D+IDP+ F FEKFYELYHKICPRTDIE++FK LSN K  I  +K+IE+LNE QRDPRLNEIL+PFANK T+KYI +N E  EE++   ++SIECFYRYLMSDDNA VFLD+L+I QDMDQPL+HYYINSSHNTYL GRQFGGKSSVE+YRQVLL+GCRCIELDCWDG+GEDQEPIITHGKAMCTDILFKDVIYAIRDTAFV S+ P+I+SFENHCSK QQYKLAKYCE++LGD+LLTKP+D + L   V LP P KL++KILIKNKRLKPE EKQQL++FLKGQT+ IQEENE  EDPD  +  D  DG   N+ N                    ++  +T P P++     +  LK       +L +K KEE            G+LTAEEEQ M+A YHY GAT++IHP LS+ VNY QPVKFQGFD+AED NIH+HMSSF+E V LGL++   I  V+YNKRQ+SRIYPRGNRVDS+N+MPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGN GYLLKPEFMRRPER FDPFSESPMDGVIAAT E+KIISGQFLSD+KVGTYVEVDMYGLPTDT RKEFRTRVVPNNGLNP+YGDD+VF+FRKVVLPDLAVLR  VYEDTGKLIGQRVLPL+GLQ+GYRHISLRTEGNFPLSLPT+FC+++ TTY+PEGL DLVDALSDPRA+LSKEE+RMKQLA MGI++S+I DVP+TG                          L+ + ++N SG    S VS      ++ KKD+KKD+PKFD IS+ LL+TDK +QKLIK+Q +ELE L+K+ EKD+  + ++ TI+TDKLN +HA+E       + S  R ++  N             ++  +++   NQM +LV+ HTD+W+S+K    KE ++L +SF +SR+ELL+K+MKEVQE+QK+EL+IIQ+RE+KEMKAQQTKASI++N++V+NDRKL+NKAERDRRIRELND NTKRFIDQRK QAQ+ D+QTQELN+ H   E+E+++ I KER     K++EDLLA KRAT I
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFIWKRPVPEVLQTGEHFDRYDEETGILEPNCFVRVDKDGFFIYWQSENNDSQQLELSQISDVRSGAKPKDEKLTAQIQEK-SGKSWDRIVTICSGLDLVNINYTHMVAKDAETASFWIQSLRSLTHNTKAANVCPMTQLRKHWLRLTLTLNARNRIPVRVIMKTFASGRNERIVYQSLKDLNLPHGKNDDIDPNEFPFEKFYELYHKICPRTDIEDLFKSLSNGKSHIHADKMIEFLNETQRDPRLNEILYPFANKQTIKYIQENYETQEEFKNTDEVSIECFYRYLMSDDNACVFLDKLDIYQDMDQPLSHYYINSSHNTYLIGRQFGGKSSVEMYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVASDCPVIMSFENHCSKHQQYKLAKYCEEILGDMLLTKPLDNYALEPGVALPPPEKLKRKILIKNKRLKPEAEKQQLDLFLKGQTDAIQEENEVTEDPDLTIDRDDGDGCSANKANNGEITATTTTTTGSGGGGDTVIPLNTTPTPQLVSCTSSAELK-------RLQLK-KEE------------GNLTAEEEQIMMAHYHYTGATSSIHPLLSSFVNYAQPVKFQGFDVAEDENIHHHMSSFSETVALGLLKNQAIEFVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRPERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGDDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADVPSTGGGGNAKRVGGGAGGGSSGGLGGTSGQLSGSVMSNISGSGETSNVS-----LNSTKKDEKKDDPKFDPISITLLQTDKMYQKLIKKQAKELEILQKRQEKDAVSMLRNHTIITDKLNTSHAKE-------RSSTKRTVNKEN------------GQNAALQDTHHNQMCELVRQHTDQWSSLKSTQMKEVYELVLSFFDSRKELLIKIMKEVQEEQKRELRIIQDREVKEMKAQQTKASIESNRSVMNDRKLRNKAERDRRIRELNDYNTKRFIDQRKLQAQRHDKQTQELNKHHTLDEQEIINGIKKEREEFIRKYEEDLLALKRATVI 1210          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A0R3U5L3 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2018 PE=4 SV=2)

HSP 1 Score: 1568.52 bits (4060), Expect = 0.000e+0
Identity = 804/1305 (61.61%), Postives = 986/1305 (75.56%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISN---PLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQ---------------------------LADMGIETSDIVDVPTT----GKPFKKPP-------DKKSENSNQEPLTPNL-----ANKSG-------------QSNNSTVSTPV--------VGFSNNXXX----------XXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            M+SDIAKRQRTVPSSKA++F WR+PV   L  G +FDR+DE++ +LE  C +RVDE GFF+ WKS+  EGQVL+LSQVSDVR G KPK++K+ A L ER+S+    LD+ IVT+CSG DLVNISYT+ V+   E+A+ WI ++R LTHNTK  NVCPM QL+KHWLRL L V   G IPVR ++KTFASG+ E+IIFQSLKELGLP GK+DE++PS FTFE+FYELYHKICPRTDIEE+FK LSN K+ +T EK+IE+LNEVQRDPRLNEIL+P+AN+ T++YI +  E  +E      LS++ FYRYLMSDDNAPVFLDRL+ICQDMDQPL HYYINSSHNTYL GRQFGGKSSVEIYRQVLL+GCRCIELDCWDGKGEDQEPIITHGKAMC+DILFKDVIYA+RDTAFVTS+ P+I+SFENHCSK QQYKLAKYCED+LGD+LLTKP+DK+ L   VPLPSP KL++KILIKNKRL+P+VEK QLE+F+KGQ + +QE+++ AEDPDP+V  D + GPMN          D DPHPE      +G + V   S    +  + +  E + ++  +KKGSLTAEEEQAMLAQYHY GAT  IHP LS+MVNY QPVKFQGFD+AED N+HYHMSSF+E V LGL++ + I  V+YNKRQ+SRIYPRGNRV+S+N+MPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGN GYLLKPEFMRRPER FDPFSESPMDGVIAAT E++IISGQFLSD+KVGTYVEVDMYGLPTDT RKEFRTRVVPNNGLNP+YG+D+VF+FRKVVLPDLAVLR  VYEDTGKLIGQRVLPL+GLQSGYRHISLRTEGNFPLSLPT+FC+++ TTY+PEGL DLVDALSDPRA+LSKEE+RMKQ                           LA MGI++S+I DVPT+        K+ P       +  S NS    L   +     A+ +G             +S  STV +P         VG S                K ++PKF  ISL +L +DK ++KL+K+Q +ELE L+++HEK++A + ++ T++TDKLN++HA+ I        S  +K++  N                 ++E    QM DLV+  TDEW+ +K     E H L ++F+++R++LLLK++++  ++QK+ LK IQERE K+MKAQQ K S+D+N+NV+ND +LKNKAERDRRIREL D NTKRFIDQRKAQAQ+ DRQ Q+L R+H+E+E  V++ ++ ER  L   ++E+LLATKR T I
Sbjct:    1 MSSDIAKRQRTVPSSKAYDFVWRRPVPAALREGTYFDRFDEETGTLELGCFLRVDEDGFFLFWKSDVNEGQVLELSQVSDVRHGMKPKDEKLVATLTERVSSIGKNLDEHIVTVCSGLDLVNISYTNFVATSPEVASLWIQSVRGLTHNTKAQNVCPMTQLRKHWLRLTLTVNPRGKIPVRVVTKTFASGRNERIIFQSLKELGLPSGKNDEVEPSEFTFERFYELYHKICPRTDIEELFKTLSNGKETLTIEKMIEFLNEVQRDPRLNEILYPYANRQTIRYIQETYESRDENTSSDTLSLKGFYRYLMSDDNAPVFLDRLDICQDMDQPLCHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGKGEDQEPIITHGKAMCSDILFKDVIYAVRDTAFVTSDYPLIMSFENHCSKHQQYKLAKYCEDILGDMLLTKPLDKYPLEAGVPLPSPEKLKRKILIKNKRLEPDVEKHQLELFMKGQADPVQEDDDVAEDPDPVVTPDCDVGPMN---------GDIDPHPETKLRPGSGQINVLSTSLPLSSSLIGKLSETEMKRLITKKGSLTAEEEQAMLAQYHYTGATKTIHPLLSSMVNYAQPVKFQGFDVAEDENVHYHMSSFSETVALGLMKNEAIEFVNYNKRQMSRIYPRGNRVESSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRPERQFDPFSESPMDGVIAATCEVRIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQSGYRHISLRTEGNFPLSLPTLFCRVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQVGILLEPVALLLLHMFTIPISVTSHLKLASMGIDSSEIDDVPTSSTKLAAMLKQRPMGMGNLSNAPSANSAAGLLPSGVGSVAAASSAGLTLPGVGASADHQKSTGSTVVSPSANPLTSGGVGVSGATSGPSANSAKKEDKKAEDPKFPPISLSMLRSDKNYRKLVKKQAKELEALQRRHEKEAAAMLRAHTLLTDKLNSSHAKAIASSTSSLRSTPQKMNGINT---------------PMKEAHIAQMNDLVRQQTDEWSKLKYTQMNEIHGLVLTFMDARKDLLLKILRDAHDEQKRLLKQIQERENKDMKAQQIKISLDSNRNVMNDPRLKNKAERDRRIRELKDYNTKRFIDQRKAQAQRNDRQVQDLLRRHEEEEHGVIAGVNLERDDLIRSYREELLATKRTTMI 1281          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A074ZXA5 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Opisthorchis viverrini OX=6198 GN=T265_05106 PE=4 SV=1)

HSP 1 Score: 1563.9 bits (4048), Expect = 0.000e+0
Identity = 794/1228 (64.66%), Postives = 970/1228 (78.99%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPS+KAFEFNWR+PV D L NGA FDR DE++ +LE++C VRVD  GFF++WK+E  + Q+L+LSQ+SDVR GSKPKE+K+ A + ER      DRIVTICSG DLVNI YTHM++ + E A +WI  LR LTHNTK  NVCPM QL+KHW+RL L V     IPVR I KTFASG+ E+++FQSLKELGLP GK+D I+P++F FEKFYELYHKICPRTDIE++FK LSN+ D +  +K+IE+LNE QRDPRLNEIL+PFAN+ T+KYI +N E  EEY+    LSIECFYRYLMSD+NA VFLDRL++ Q+MDQPL+HYYINSSHNTYL+GRQFGGKSSVE+YRQVLL+GCRCIELDCWDG+GEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSE P+I+SFENHCSK QQYKLAKYCED+LGD+LLTKPID   L    PLP P KL++KILIKNKRLKPE EKQQLE+FLKGQT+ IQEEN+ AEDPD  V VDG+ G +    P+         + E     LNG   +   S+T            D ++   KKG+LTAEEEQ M+ QY + GAT++IHP LS+ +NY QPVKFQGFD+AE+ N+H+HMSSF+E + LGL++   I  V+YNKRQ+SRIYPRGNRVDS+N+MPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGN GYLLKPEFMRR ER FDPFSESPMDGVIAAT E+KIISGQFLSD+KVGTYVEVDMYGLPTDT RKEFRTRVVPNNGLNP+YG+D+VF+FRKVVLPDLAVLR  VYE+TGKLIGQRV+PL+GLQ+GYRHISLRTEGNFPLSLPT+FC++  TTY+PEGL DLVDALSDPRA+LSKEE+RMKQLA MGI++S+I DVPTT           + +      T     ++G ++ +                KKD+PKFD ISL LL+TDK +QKL+K+Q++ELE ++++ +KD+  + ++ T+VTDKLN  HA+E       + S  R     N             +S ++E  QK+Q+ +L++   D+WT++K+   KE  DL + ++E R+ELLL++MKEVQE+QK+EL+I+QERE+KEM+AQQTKASI+++++V+NDRKLKNKAERDRRIRELND NTKRFIDQRK QAQ+QD+QTQELN++H ++EK+V+ A+ KE+     K++EDLLA KR+T I
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFNWRRPVPDVLQNGAFFDRLDEETGTLETDCFVRVDPDGFFIYWKTENSDSQLLELSQISDVRAGSKPKEEKLIAQIQERGPGKSWDRIVTICSGLDLVNIIYTHMIAPEPETAAYWIQQLRSLTHNTKAVNVCPMTQLRKHWIRLTLSVNPKNKIPVRVIMKTFASGRNERVVFQSLKELGLPHGKNDVIEPAAFPFEKFYELYHKICPRTDIEDLFKSLSNNTDVLHADKMIEFLNETQRDPRLNEILYPFANRQTIKYIQENYETQEEYKNTDMLSIECFYRYLMSDNNACVFLDRLDVYQEMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEYPVIMSFENHCSKHQQYKLAKYCEDILGDMLLTKPIDGFPLEPGAPLPPPEKLKRKILIKNKRLKPEAEKQQLELFLKGQTDAIQEENDIAEDPDLTVDVDGKFGSLLLHEPSA-----RSCYSESGTKGLNGESGLSSSSNTPAP-PSGGSSSADLKRLQMKKGNLTAEEEQMMMVQYQHTGATSSIHPLLSSFINYVQPVKFQGFDVAEEKNLHFHMSSFSETISLGLMKNQAIEYVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRLERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEETGKLIGQRVIPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVNLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADVPTTTAKRTPASGAAAASGPPGAAT-----EAGDASGAKKEE------------KKDDPKFDPISLSLLQTDKNYQKLLKKQSKELELVQRRQDKDATAMLRNHTVVTDKLNTTHAKE-------RSSTKRPSKKEN------------GQSSVLEATQKSQLCELMRQQADQWTNLKVAQMKEICDLVLGYIEVRKELLLRIMKEVQEEQKRELRIVQEREVKEMRAQQTKASIESSRSVMNDRKLKNKAERDRRIRELNDYNTKRFIDQRKIQAQRQDKQTQELNKRHAQEEKDVIDAMHKEKDDFIRKYEEDLLAVKRSTVI 1186          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 657/1197 (54.89%), Postives = 847/1197 (70.76%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNP--LDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLK----GQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNAS-----KKGSLT---AEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ 3695
            +K++EFNW++ V D L  GA FDR DED    ES+CL +VDE+GFF+ WKSE  EGQVL+ S ++ VR G+ PK+ KI + L     N   L+  I+ +CSG DLVN+S+ +MV+ + + A  W+  L+ + HN K NNVCPM  LKKHW+RL      NG IPVR I++TF SGKTEK IFQ+LKELGLP GK+DEID S FTF+ FY L  KICPRTDIEE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +   V  I++  E  E+ +K+G++S + F RYLMSD+NAPVFLDRL++CQDMDQPLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLLSGCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSKPQQYK+AKYCED+ G+LLL +P++   +  A PLPSP  L++KILIKNKRLKPEVE++QLE F +    G+  +   ++EN ED         E+    E+N  +  +N T   P    T+ N + K K   D    I    E +      AS     KKG      A+ EQ ++A Y Y GATTNIHPYLSAMVNY QPVKFQ F+IAE+ NIH++MSSFNE+VGLG ++ + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG  GYL KP+FMRR +R FDPFSE+P+DGVIAAT  +++ SGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP Y ++  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC I   TY+P+G   +VDALSDP+ +LS  EKR  Q+  +GIETSDI DVP       K   K   N  +  +TP  ++  GQ++ +T         NN  + KKD    + +++  L+  K++ KLIK+Q +EL  L+K+H KD   + KS     DK+ A H +E     K+    ++K    NC     LK++   + + +    K ++ D+V  HT EW+ M   H  EE ++  + +  + E L K++  VQE Q  +LK++ ER+ KEMKA Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+++RK  A K  ++ ++L +   EQ
Sbjct:    2 TKSYEFNWQKHVPDFLQEGAVFDRLDEDPFVFESSCLFKVDEFGFFLTWKSEGKEGQVLECSLINSVRVGAVPKDPKILSSLEAAGKNEADLEGCIICVCSGPDLVNLSFMYMVADNADTAKKWLEGLKSVIHNFKANNVCPMTCLKKHWMRLSFLTNVNGKIPVRGITRTFGSGKTEKGIFQALKELGLPSGKNDEIDHSMFTFDVFYALTQKICPRTDIEELFKKINGDKTDYLTVDQLVSFLNENQRDPRLNEILFPFYDPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLDRLDMCQDMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRLKPEVEQKQLESFKRHMEAGEMSVQGGDDENEED--------MENADSKEVNSDMKTRN-TSEEPSEQDTQENSVKKDKIPDDEITEISEATEADVTDLSEASDLDNKKKGGDAPEDADAEQQLIASYKYEGATTNIHPYLSAMVNYAQPVKFQSFEIAEEKNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSIAEKRADQMRALGIETSDIADVPNES---SKNDKKGKVNQVKANVTPQTSSDMGQTSTAT--------QNNSSETKKDSALVNQVTIEDLKQMKSYVKLIKKQQKELNALKKRHAKDHNAMQKSHCTQVDKMVAQHDKEKFTLEKLLEKAIKKRGENNC---SELKKETAIKVENLTTDHKAKVKDIVAQHTKEWSEMINSHSTEEQEMKDAHVTQQCEHLKKLLSSVQEQQTMQLKLVHERQSKEMKANQAKTSMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKHSKELEQLQKSQREQ 1174          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 1241.87 bits (3212), Expect = 0.000e+0
Identity = 662/1228 (53.91%), Postives = 858/1228 (69.87%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNP--LDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLK----GQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNAS-----KKGSLT---AEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATA 3788
            +K++EFNW++ V D L  GA FDR DED    ES+CL +VDE+GFF+ WKSE  EGQVL+ S ++ VR G+ PK+ KI + L     N   L+  I+ +CSG DLVN+S+ +MV+ + + A  W+  L+ + HN K NNVCPM  LKKHW+RL      NG IPVR I++TF SGKTEK IFQ+LKELGLP GK+DEID S FTF+ FY L  KICPRTDIEE+FK+++  K D++T ++++ +LNE QRDPRLNEILFPF +   V  I++  E  E+ +K+G++S + F RYLMSD+NAPVFLDRL++CQDMDQPLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLLSGCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTSE P+ILSFENHCSKPQQYK+AKYCED+ G+LLL +P++   +  A PLPSP  L++KILIKNKRLKPEVE++QLE F +    G+  +   ++EN ED         E+    E+N  +  +N T   P    T+ N + K K   D    I    E +      AS     KKG      A+ EQ ++A Y Y GATTNIHPYLSAMVNY QPVKFQ F+IAE+ NIH++MSSFNE+VGLG ++ + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG  GYL KP+FMRR +R FDPFSE+P+DGVIAAT  +++ SGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP Y ++  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC I   TY+P+G   +VDALSDP+ +LS  EKR  Q+  +GIETSDI DVP       K   K   N  +  +TP  ++  GQ++ +T         NN  + KKD    + +++  L+  K++ KLIK+Q +EL  L+K+H KD   + KS     DK+ A H +E     K+    ++K    NC     LK++   + + +    K ++ D+V  HT EW+ M   H  EE ++  + +  + E L K++  VQE Q  +LK++ ER+ KEMKA Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+++R           + L  KH ++ +++  +  ++   LE KF E LL +  A +
Sbjct:    2 TKSYEFNWQKHVPDFLQEGAVFDRLDEDPFVFESSCLFKVDEFGFFLTWKSEGKEGQVLECSLINSVRVGAVPKDPKILSSLEAAGKNEADLEGCIICVCSGPDLVNLSFMYMVADNADTAKKWLEGLKSVIHNFKANNVCPMTCLKKHWMRLSFLTNVNGKIPVRGITRTFGSGKTEKGIFQALKELGLPSGKNDEIDHSMFTFDVFYALTQKICPRTDIEELFKKINGDKTDYLTVDQLVSFLNENQRDPRLNEILFPFYDPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLDRLDMCQDMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRLKPEVEQKQLESFKRHMEAGEMSVQGGDDENEEDM--------ENADSKEVNSDMKTRN-TSEEPSEQDTQENSVKKDKIPDDEITEISEATEADVTDLSEASDLDNKKKGGDAPEDADAEQQLIASYKYEGATTNIHPYLSAMVNYAQPVKFQSFEIAEEKNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSIAEKRADQMRALGIETSDIADVPNES---SKNDKKGKVNQVKANVTPQTSSDMGQTSTAT--------QNNSSETKKDSALVNQVTIEDLKQMKSYVKLIKKQQKELNALKKRHAKDHNAMQKSHCTQVDKMVAQHDKEKFTLEKLLEKAIKKRGENNC---SELKKETAIKVENLTTDHKAKVKDIVAQHTKEWSEMINSHSTEEQEMKDAHVTQQCEHLKKLLSSVQEQQTMQLKLVHERQSKEMKANQAKTSMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEER-----------KRLAMKHSKELEQLQKSQREQLEKLE-KFNEQLLKSHHANS 1193          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 [Source:NCBI gene;Acc:103033015])

HSP 1 Score: 1189.1 bits (3075), Expect = 0.000e+0
Identity = 632/1193 (52.98%), Postives = 820/1193 (68.73%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLK----GQTEII--QEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTP--NLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ 3695
            +KA+EFNW++ V D L  GA+FDR+DED  + ESNC  RVD +GFF+ WKSE  EGQVL+ S ++ +R  S PK+ KI + L    +  + L+ RI+ ICSG DLVN+S+ ++V+QD  IA  W ++LR L HN++ NNVCPM  L+KHW+RL      NG IPVRSI++TFASGKTEK+IFQ+LK+LGLP GK+DE++P +FTFEKFY L  KICPRTDIE +FK+L   K DF+ T++++ +LNE QRDPRLNEILFPF +    + I+++ E  E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MDQPLAHY+I+SSHNTYLTGRQFGG+SSVE+YRQVLLSGCRC+ELDCWDGKGEDQEPIITHGKAMCTD+LFKDVI AI +TAFV+SE P+ILSFENHCS+ QQYKLA+YCED+ GD LL +P+D   L    PLPSP  L++KILIKN+RLKPEVEK+QLE F K    G   +     E+EN ED     +VD       E +P  I            + ++    K  +     L +  +   E   ++N  K       +EQA++  Y Y+ ATTNIHPYLS ++NY Q VKF GF+ AE+ NIH++MSSFNE+VGLG +R + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC I   TY+P+G   +VDALSDP+ +LS  EKR  Q+  MGIET +I DVP           KK + +  + L+P  +L  +S  S  +  + P           K  +     +++  L+  K + KL K+Q +EL  L+KK  K    L +S     DK+   H +E     K      +K+S  NC     +  +   +   I    K ++ D    H  EW  M   H  E  +L    +  + E L K+M   QE Q ++L  + ER+ KEM+A Q K+S+   + +  D+ +KNKAER+RR+RELN  NT++F+ +RK  A  Q ++ ++L     EQ
Sbjct:    2 AKAYEFNWQRAVPDCLQEGAYFDRFDEDPFAFESNCFFRVDAFGFFITWKSEGKEGQVLECSLINSIRSTSVPKDPKILSALEATGKTESDLEGRIICICSGADLVNLSFMYIVAQDISIAKQWTDSLRSLIHNSRANNVCPMTCLRKHWMRLSFLTNVNGKIPVRSITRTFASGKTEKVIFQALKDLGLPSGKNDELEPDAFTFEKFYSLSQKICPRTDIEVLFKKLCGEKSDFLNTDQLVSFLNENQRDPRLNEILFPFYDSKRARQIIESYETDEKLQKKGLMSCDGFSRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGRSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQAIEETAFVSSEFPVILSFENHCSRHQQYKLARYCEDIFGDTLLRQPLDDFPLEPGQPLPSPNDLKRKILIKNRRLKPEVEKKQLEHFRKHMEAGDVNMSTNMSEDENEEDAGCADLVD-------EAHPERICGRLVISQTNSSEGDVPAADKGNKDEVAGLEVLAQTPLEAACQENGKKACEPGVADEQALIQSYTYVAATTNIHPYLSNIINYAQAVKFLGFEEAEETNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIETWEIADVPNDS----CKRSKKGKANQVKSLSPQRSLETRSTSSGQNASTFP----------KKDTDTTMPQVTVEDLKQMKEYLKLAKKQVKELNALKKKQTKAHTALQRSHCTQMDKVVVQHEKEKRVLEKQLEKNKKKVSESNCC---EMGREIEMKMKTITADHKTKVKDAAAAHAREWAEMMKAHSAEIQELRDQHVLQQCEQLRKLMLMTQEQQTQQLTHLHERQCKEMRANQAKSSMANGRAISQDKSIKNKAERERRVRELNSNNTRKFLTERKRLAMGQSKEIEQLQTAQHEQ 1169          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 [Source:NCBI gene;Acc:103033015])

HSP 1 Score: 1157.51 bits (2993), Expect = 0.000e+0
Identity = 619/1193 (51.89%), Postives = 807/1193 (67.64%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKG--------QTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTP--NLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ 3695
            +KA+EFNW++ V D L  GA+FDR+DED  + ESNC  RVD +GFF+ WKSE  + ++L   + +                   +  + L+ RI+ ICSG DLVN+S+ ++V+QD  IA  W ++LR L HN++ NNVCPM  L+KHW+RL      NG IPVRSI++TFASGKTEK+IFQ+LK+LGLP GK+DE++P +FTFEKFY L  KICPRTDIE +FK+L   K DF+ T++++ +LNE QRDPRLNEILFPF +    + I+++ E  E+ +K+G +S + F RYLMSD+NAPVFLDRL + Q+MDQPLAHY+I+SSHNTYLTGRQFGG+SSVE+YRQVLLSGCRC+ELDCWDGKGEDQEPIITHGKAMCTD+LFKDVI AI +TAFV+SE P+ILSFENHCS+ QQYKLA+YCED+ GD LL +P+D   L    PLPSP  L++KILIKN+RLKPEVEK+QLE F K          T + ++ENE     D   +VD       E +P  I            + ++    K  +     L +  +   E   ++N  K       +EQA++  Y Y+ ATTNIHPYLS ++NY Q VKF GF+ AE+ NIH++MSSFNE+VGLG +R + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG+ GYLLKP+FMRRP+R FDPFSE+P+DGVIAAT  +++ISGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP+Y ++  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC I   TY+P+G   +VDALSDP+ +LS  EKR  Q+  MGIET +I DVP           KK + +  + L+P  +L  +S  S  +  + P           K  +     +++  L+  K + KL K+Q +EL  L+KK  K    L +S     DK+   H +E     K      +K+S  NC     +  +   +   I    K ++ D    H  EW  M   H  E  +L    +  + E L K+M   QE Q ++L  + ER+ KEM+A Q K+S+   + +  D+ +KNKAER+RR+RELN  NT++F+ +RK  A  Q ++ ++L     EQ
Sbjct:    2 AKAYEFNWQRAVPDCLQEGAYFDRFDEDPFAFESNCFFRVDAFGFFITWKSEGKDPKILSALEATG------------------KTESDLEGRIICICSGADLVNLSFMYIVAQDISIAKQWTDSLRSLIHNSRANNVCPMTCLRKHWMRLSFLTNVNGKIPVRSITRTFASGKTEKVIFQALKDLGLPSGKNDELEPDAFTFEKFYSLSQKICPRTDIEVLFKKLCGEKSDFLNTDQLVSFLNENQRDPRLNEILFPFYDSKRARQIIESYETDEKLQKKGLMSCDGFSRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGRSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQAIEETAFVSSEFPVILSFENHCSRHQQYKLARYCEDIFGDTLLRQPLDDFPLEPGQPLPSPNDLKRKILIKNRRLKPEVEKKQLEHFRKHMEAGDVNMSTNMSEDENEEDAGCD---LVD-------EAHPERICGRLVISQTNSSEGDVPAADKGNKDEVAGLEVLAQTPLEAACQENGKKACEPGVADEQALIQSYTYVAATTNIHPYLSNIINYAQAVKFLGFEEAEETNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIETWEIADVPNDS----CKRSKKGKANQVKSLSPQRSLETRSTSSGQNASTFP----------KKDTDTTMPQVTVEDLKQMKEYLKLAKKQVKELNALKKKQTKAHTALQRSHCTQMDKVVVQHEKEKRVLEKQLEKNKKKVSESNCC---EMGREIEMKMKTITADHKTKVKDAAAAHAREWAEMMKAHSAEIQELRDQHVLQQCEQLRKLMLMTQEQQTQQLTHLHERQCKEMRANQAKSSMANGRAISQDKSIKNKAERERRVRELNSNNTRKFLTERKRLAMGQSKEIEQLQTAQHEQ 1148          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: plcb3 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 [Source:NCBI gene;Acc:103029357])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 423/1157 (36.56%), Postives = 659/1157 (56.96%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCL-VRVDEYGFFVHWKSEQG-EGQVLDLSQVSDVRFGSKPKEDKICAVL----LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHC-SKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAED-PDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDP-RAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR---EINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIE--EVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQERE-----IKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRE 3593
            V + L  G+ F ++DE+ +S +   + ++VD YGFF++W      E +++D+S + D R G   K  K   V       +    ++ ++VT+  G DLVNIS+ +  +   +IA  W   L  L  N    N      L K + +L L V  +G IPV++I K F+  +    +  +L++ GL   ++D +    FT++KF    + +C R +I+ IF EL S  K F++ +++++++N  QRD RLNE+L+P   ++ V+ +++  E +    +  ++S+  F +YL  ++NA V  +R ++  DM+QPL+HY+INSSHNTYLT  Q  G SSVE+YRQVLL+GCRCIELDCW G+  D+EPIITHG  M T+I FK+VI AI ++AF TS  P+ILSFENH  S  QQ K+A+YC  + GD LL  P++K+ L     LPSP +L  KILIKNK+       Q           + ++  + AED   PL      D P+NE   + I+ N  +   E    + + + K  ++ D +   + +EE   D +K+ S +G+            Y  + AT      +S +VNY +PVKF+ F++A   N ++ MSSF E  G+  ++ + I  V+YNK+QLSRIYP+G RV+S+N+MPQ+FWN GCQMVALNFQT DL MQLN   FEYNG+SGYLLKPEFMRR ++ FDPF+E+ +DG++A T++IKI+SGQFL+DKKVG YVEVDM+GLP DT RK FRT+   NN ++P++ DD  F+F KVVLP LA LR+ ++E+ GK IG R+LP+  L+ GY +I+L+ + N PL L ++        YIP+      DAL++P +  L + E+++    +   + +  V      KP  +P       +  +  +              V  PV+            EP+    S+  L+  K+++KL+K+Q +EL+ LRKKH K    L K Q   +++LN++  R   ++ KK+++    ++K      + ++  +     E   ++  E Q  ++++L K         K  H  E +       +  Q + +K +KE+ + +KKEL+ I +R+     I+  K  + KA  ++ +N IN + +++     RR+ E
Sbjct:   18 VHEVLKRGSKFIKWDEEPSSGQPTLVTLKVDPYGFFLYWSGGGNMEVEIVDISHIRDTRTGKFAKLPKALTVRELLGFGKGEGNVEGKLVTVVHGNDLVNISFLNFQAMQEDIAKVWTEELFKLATNILSQNSSRNTFLLKAYTKLTLQVTQDGKIPVKNILKMFSDKRR---VESALEQCGLVANRADGVKLDDFTWDKFQSFLNNLCMRPEIDRIFLELGSKGKPFLSLDQMLDFINRRQRDSRLNEVLYPPLKREQVRQLMEKYESNPSQLERDQISLMTFSKYLGGEENAVVPPERFDVMDDMNQPLSHYFINSSHNTYLTVGQLTGPSSVEMYRQVLLTGCRCIELDCWKGRPPDEEPIITHGFTMTTEIPFKEVIEAIAESAFKTSPYPVILSFENHVDSTRQQAKMAEYCRSIFGDALLIDPLEKYPLVPGQQLPSPQELMGKILIKNKKKHHHHHHQA-----TNGGSVRRKAGDGAEDQASPL-----NDCPLNEGEASQIISNGGEKLAERMSKD-SDIRKSIDRGDGESEEEEEEEPVADPKKHHSDEGT-----------AYSEVNATEE----MSTLVNYIEPVKFKSFELAAKRNKYFEMSSFVETKGMDSLKNNPIEFVEYNKKQLSRIYPKGTRVESSNYMPQLFWNVGCQMVALNFQTLDLPMQLNLSVFEYNGHSGYLLKPEFMRRTDKHFDPFTENIVDGIVANTVKIKIVSGQFLTDKKVGVYVEVDMFGLPADTKRK-FRTKTSNNNSMDPVW-DDEAFVFSKVVLPTLASLRVALFEENGKFIGHRILPVVALRPGYHYINLKNDLNQPLLLASLLVYTEVMDYIPDEHQGYADALTNPIKHVLDQRERQLAVFMEDNNDGNKRVQQDEGEKPEPRPV------AVVDFPSLPSPTPPPVEPEIPVPAPVI------------EPQ----SIEQLKQHKSYEKLLKKQNKELKELRKKHLKKVWALSKEQKTRSNQLNSDIQRRKSQVEKKLRLS---VKKNEPEGPVRTELNELVVELEKQTVQLREWQMQELLELRKKQYQLEKEKKFIHLGESYQKLKEVAQECQAVQIKKLKEICDKEKKELQKILDRKRQNSIIEARKGDKEKA--ESEQNEINRKHIQDSVNSYRRLDE 1116          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 302/582 (51.89%), Postives = 391/582 (67.18%), Query Frame = 3
Query: 1842 TAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVV--GFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDR 3581
            + E E A ++ Y Y G TTNIHPYLSA+VNY QPVKFQ F +AE+ NIHY+MSSFNE+VGLG ++   I LV+YNKRQ+SRIYPRG RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG  G+LLKP+FMRRP+R+FDPFSE+P+DGVIA T  +++ISGQFLSD++VGTYVEVDMYGLPTDT RKEFRTR+VPNNGLNP+Y  +  F+FRKV+LPDLAVLRI V++D+ KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC I   TY+P+G  D VDALSDP+ +LS+ EKR  Q+  MGIE SDI DVP           +   + N+   TP           S   TPV      NN      DEP    + +  L   K+F KL+K+Q +E+  L+K H K  A L K+ T   DK+ + + RE +  +K     + K    +C   +   EK  EE   +E  +K Q +   +         +   R+EE     +    + EL+  ++    E Q ++L++  ER+ K+++  Q K S++ +K +  DR +KNKAER+R
Sbjct:    1 SVESEDAWVSAYKYTGGTTNIHPYLSALVNYAQPVKFQNFVVAEERNIHYNMSSFNESVGLGYLKTGAIELVNYNKRQMSRIYPRGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGFCGFLLKPDFMRRPDRTFDPFSETPVDGVIAGTCSVQVISGQFLSDRQVGTYVEVDMYGLPTDTIRKEFRTRLVPNNGLNPLYNQEP-FVFRKVILPDLAVLRIAVFDDSNKLIGQRILPLDGLQTGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDFVDALSDPKRFLSQAEKRANQMQAMGIEASDIGDVP-----------ESRGSVNRGAATP---------QTSVTCTPVTVRSLGNNAIGSTPDEPLVPPVCVDTLRHSKSFLKLLKKQEKEMTLLKKAHAKAQASLQKTYTGQGDKVTSQYERERSSILKQTEKTLAKKGEGHCAGLQKETEKRVEEL-TVEHQRKTQALQAERAREQAALQAQQARRQEEARTAHA--AQQDELVRALLAGAHEQQIRQLQLTHERDTKQLEGTQAKQSMEESKLISQDRSIKNKAERER 558          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB1 (phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGNC:15917])

HSP 1 Score: 362.459 bits (929), Expect = 3.874e-107
Identity = 189/417 (45.32%), Postives = 261/417 (62.59%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADM---GIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNA 3155
            +S +VNY QPVKF  F+ A   N  Y MSSF E  G+  + +  +  V+YNK QLSRIYP+G RVDS+N+MPQ+FWNAGCQ+VALN+QT DLAMQLN G FEYN  SGY+LKPEFMRR ++ FDPFS++ +DG+IA T+ +K+ISGQFLSDKKVG +VEVDM+GLP DT RK ++T+  P N +NP++ D+  F+F+KVVLP LA LR+  +ED GK +G R++P+  ++ GYRHI LR E N  L+LP I   I    Y+P+   DL +AL++P  Y+S  E+R +QLA +     E +  V +   G P   PP       ++    P     SG ++  TV +P                  + +++  ++  K   KL  +Q +E ++L K+H+K  A L K Q      L A
Sbjct:  512 MSNLVNYVQPVKFTTFEAARKKNRSYEMSSFVETKGMEQLTKCPVEFVEYNKCQLSRIYPKGTRVDSSNYMPQVFWNAGCQLVALNYQTMDLAMQLNIGMFEYNRRSGYILKPEFMRRSDKHFDPFSDNTVDGIIANTVSVKVISGQFLSDKKVGCFVEVDMFGLPVDTKRKIYKTKTAPGNSINPVW-DEEPFVFKKVVLPTLACLRVAAFEDGGKFLGHRIMPVSAIRPGYRHICLRNESNQALALPAILVYIQVKDYVPDAFADLTEALANPIRYVSLMEQRAQQLAALIGEFDEGTAEVRMAHDG-PISMPP-----APHKVAAPPGAPQGSGPTD--TVKSPAKPPPQKDDVLASILRGVEALTVEQIKQHKAVLKLQFKQHKEAKDLSKRHQKRIAELAKEQMARLSDLQA 919          

HSP 2 Score: 315.849 bits (808), Expect = 1.111e-90
Identity = 151/355 (42.54%), Postives = 227/355 (63.94%), Query Frame = 3
Query:  417 LDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            L+ + VT+  G+D VN+++ + V+   EIA  W   +  L  N   +N    I L K + +L L +  +  IPV++I + FA+ +  + +  +L+  GLP G++D I P+ F  + F      ICPR +I+ IF E+ + S+ ++T ++  E++N  QRDPRLNEIL+P      V+ +++  EP+    K+G +S+  F ++L  D+N+ +  +++++  DM QPL+HY+INSSHNTYL   Q  G SSVE+YRQ LL+GCRC+ELDCW G+  D+EP+ITHG  M T+ILFKDVI AI+D AF TS  P+ILSFENH   P QQ K+A+YC  + GD LL  P++K+ L   +
Sbjct:   18 LEQKTVTVVFGSDFVNLTFLNFVAFSEEIAKEWATGIFQLASNLLYHNSSRDIFLDKLYTKLTLQLNQDSKIPVKNICRLFAADR--RRVETALESCGLPNGRNDAIYPAEFGPDVFRLFIKSICPRPEIDGIFAEVGARSRPYLTVDQFTEFINNCQRDPRLNEILYPPLKPSQVQLMIEKYEPNASLAKKGHISVGGFLKFLQGDENSAIPAEKIDLSDDMMQPLSHYFINSSHNTYLMAGQLAGSSSVEMYRQALLAGCRCVELDCWKGRTADEEPVITHGFTMTTEILFKDVIEAIKDCAFKTSPFPVILSFENHVDSPKQQAKMAEYCRTIFGDALLMDPLEKYLLESGI 370          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB1 (phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGNC:15917])

HSP 1 Score: 347.436 bits (890), Expect = 1.707e-100
Identity = 166/296 (56.08%), Postives = 215/296 (72.64%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVP-NNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIE 2798
            +S +VNY QP+KF  F+ A+  N +Y MSSF E+ G+  + +  +  V+YNK QLSRIYP+G RVDS+N+MPQ+FWNAGCQMVALN+QT DLAMQLN G FEYN  SGYLLKPEFMRR ++ FDPF++  +DGVIA T+ +K+ISGQFLSD+KV TYVEVDM+GLP DT RK ++TR    NN +NP++ +D  F+F KVVLP LA LRIGV+E+ GK IG R+LP+  ++ G+ HI LR E N PLSLP IF  I    Y+P    + +  LS+P  Y    E+R KQL  + ++
Sbjct:  510 MSNLVNYVQPIKFDSFEDAKKRNRNYEMSSFVESKGMEQLTKCPVEFVEYNKTQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNYQTLDLAMQLNMGIFEYNCRSGYLLKPEFMRRADKQFDPFTQDIIDGVIANTISVKVISGQFLSDRKVSTYVEVDMFGLPVDTKRK-YKTRTSKDNNSINPVWEEDP-FVFDKVVLPSLASLRIGVFEEGGKFIGHRILPVSAIRPGFHHICLRNESNQPLSLPAIFVFIQVKDYVPVAFENFISGLSNPIMYQGLMEQRAKQLESLTMD 803          

HSP 2 Score: 306.99 bits (785), Expect = 1.167e-86
Identity = 158/356 (44.38%), Postives = 220/356 (61.80%), Query Frame = 3
Query:  417 LDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL--SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            ++ R +T+  G DLVNIS+ +  +    +A  W + L  L  N    N      L K + +L L       +PVRSI + F + K  K +  +L    LP G++D I   +FT+E FY   +K+CPRTDI+ IF E     +   +T E+  +++N  QRDPRLNE+LFP      V+ ++D  E S    K+G++S+  F RYL  ++N  V  ++L++ +DM QPL+HY+INSSHNTYLTG Q  G SSVE+YRQ LL+GCRC+ELDCW G+  D++PIITHG  M T+I FK+VI AI +TAF TS  P++LSFENH   P QQ K+A+YC  + GD LL   +DK+ L   V
Sbjct:   19 MESRTITVVHGPDLVNISFLNFTALTESVAKVWTDELFTLATNLLAQNSSRDKFLNKAYTKLKLQSNTEDKVPVRSILRMFPTDK--KKVENALMSCELPSGRNDNIPIETFTYEAFYSFVNKLCPRTDIDSIFAERYGGQASAXMTVEQFTDFINSKQRDPRLNEVLFPPMKTHQVQALIDKFE-STNLAKKGQISVLGFLRYLNGEENGIVPPEKLDLNEDMTQPLSHYFINSSHNTYLTGGQLKGNSSVEMYRQSLLAGCRCVELDCWKGRTADEDPIITHGFTMTTEIPFKEVIDAIAETAFKTSPYPVVLSFENHVDSPKQQAKMAEYCRLMFGDALLVDVLDKYPLESGV 371          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: plcd3b (phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GENE-081222-2])

HSP 1 Score: 181.415 bits (459), Expect = 2.929e-47
Identity = 92/244 (37.70%), Postives = 140/244 (57.38%), Query Frame = 3
Query:  717 FGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPI 1448
            F +SD         ++F +L+ K+  R D+  +FK LS     +   ++ ++L + Q +           ++     I+  +EP +E R +G ++++ F RYL S D +       ++  DM QPL+HY+I+SSHNTYLT  Q  G SS E Y + L+ GCRC+ELDCWDG   D EP+I HG  + + ILF+DVI +I   AF  S  P+ILS ENHC+  QQ  +A++   +LG+ L+T P+
Sbjct:  183 FDESDSSHTGDLVEDEFVQLFRKLTRRDDVATLFKRLSPDGIGLPAARLAQFLQDEQHED---------DSEHRAACIIAEHEPLDEGRSKGLMTLDGFVRYLTSPDGSLWDQRHDSVSHDMTQPLSHYFISSSHNTYLTDDQLRGPSSTEAYVKSLMRGCRCVELDCWDGA--DGEPVIYHGYTLTSQILFRDVITSIAHEAFKASAYPVILSLENHCNVEQQIVMARHLRSILGERLVTAPL 415          

HSP 2 Score: 176.407 bits (446), Expect = 1.381e-45
Identity = 109/269 (40.52%), Postives = 145/269 (53.90%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKK-------VGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGV--YEDTGK--LIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQT 2687
            LS  V Y   V F+G + AE       M SF+E   +GLI     A V YN + LSR YP G RV S N+ P   WNAGCQ+VALNFQTP   M L  G F  NG  GY+LKP F+R P   FDP + +   G     L I +ISGQ L  ++       +   V V+++G+  DT  +E  T    NNGLNP++ ++  FLF ++ +P+LA++R  V  Y+ T +   IGQ  LP   L+ GYRH+ L +     L   T+F  I  T
Sbjct:  491 LSDCVIYCSGVHFEGLERAESHQKGNEMCSFSETKTMGLIETQGNAFVRYNMQHLSRTYPSGTRVGSGNYNPHDMWNAGCQIVALNFQTPGKEMDLYDGLFRQNGGCGYVLKPSFLRDPHTDFDPGNPARGTGRHPVKLAITVISGQQLPKERNSRRGSIIDPLVSVEVHGVRGDTAVRE--THHQENNGLNPVWKEE--FLF-QLTVPELALIRFVVKDYDVTSRNDFIGQFSLPFSCLRQGYRHVHLLSLDGRSLFPATLFVHIRIT 754          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003983.1 (pep scaffold:Pmarinus_7.0:GL481506:4806:23311:-1 gene:ENSPMAG00000003626.1 transcript:ENSPMAT00000003983.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 3.140e-46
Identity = 85/161 (52.80%), Postives = 110/161 (68.32%), Query Frame = 3
Query:  963 EPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQD-MDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTK 1442
            EPSE  R+ G +S E F R+L+  DN    L+     +  + +PL+HYYI SSHNTYLTG Q  G SSVE+YR VLL GCR +ELDCWD  G+D  PII HG  + T I F+DV+ AI  +AFVTSE+P+ILS ENHC   QQ K+A+  ++V G+ L+T+
Sbjct:    3 EPSESMRQRGIMSFEGFARFLLDADNFACVLEESPPDESQLQRPLSHYYIASSHNTYLTGHQLKGDSSVELYRTVLLQGCRSVELDCWD--GDDGSPIIYHGHTLTTKIPFQDVVEAINRSAFVTSELPVILSIENHCCLAQQRKMAEIFKNVFGERLVTR 161          

HSP 2 Score: 119.398 bits (298), Expect = 2.467e-28
Identity = 77/216 (35.65%), Postives = 110/216 (50.93%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIH--YHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVG--TYVEVDMYGLPTDTFRK-EFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGV 2546
            +S +V Y Q VKF    ++  +     YHMSS NEN    L RR    +  +   QL R YP   R++S+N  P ++W  G QMVALN+QT DL M LN   FE NG  G++LKP  +RR  +               A  + ++ISGQ++         +VE+++ G+P DT      RT+ V  N LNP++G+        V L  +A LR+ V
Sbjct:  267 MSDLVIYCQAVKFPAKSLSALIRTPKCYHMSSMNENAAKRLCRRYGAKVPQHTMCQLLRTYPAATRIESSNPHPMLYWLHGIQMVALNYQTEDLPMALNAAMFEQNGGCGFVLKPPVLRRVRKRLRSACAR-AVVARRARADAQVISGQYVCPGNTAGSPHVELELAGMPLDTCHAGHLRTKTVARNALNPLWGETFTL---PVHLEAMAFLRLSV 478          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Yeast
Match: PLC1 (Phospholipase C; hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes; Plc1p and inositol polyphosphates are required for acetyl-CoA homeostasis which regulates global histone acetylation [Source:SGD;Acc:S000006189])

HSP 1 Score: 102.834 bits (255), Expect = 1.751e-22
Identity = 52/116 (44.83%), Postives = 71/116 (61.21%), Query Frame = 3
Query: 1086 QPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLL 1433
            +PL HY+I SSHNTYL G+Q     SVE Y QVL  GCRC+E+D WDG   +  P++ HG  + + I  K VI  I+  AF+TS  P+I+S E +C+K  Q   +    +VL + L
Sbjct:  384 KPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDG---ENGPVVCHG-FLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQKLASLIMREVLAEQL 495          

HSP 2 Score: 87.8113 bits (216), Expect = 6.700e-18
Identity = 84/283 (29.68%), Postives = 124/283 (43.82%), Query Frame = 3
Query: 1944 VKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCI--ALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEY-------NGNSGYLLKPEFMR---RPERSFDPFSESPMDGVIAATLEIKIISGQFL--------SDKKVGTYVEVDMY-----GLP------TDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISL-RTEGNFPLSLPTIFCKITQTTYI 2696
            +KF+ F + E   I  H  S NE     +I+   +  +L  +N+R L R+YP   R  S+NF P  FW AG QMVA N+QT D+  QLN   F+        +  SGY+LKP+ +       +      E   +G    T++I+I+S Q L        S     ++V+V+ +      +P      T     E  T+    NG NPI+  +     +     DL  ++  V  +  + I    L L  L+ GYRHI L   EG        IFC +   T I
Sbjct:  596 IKFRNFSLPESKTIA-HCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIPLIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDKGTRISATEASTKSSQGNGFNPIWDAEVSITLKDT---DLTFIKFMVISEETQ-IASVCLKLNYLRMGYRHIPLFNMEGE-----QYIFCTLFIHTQI 868          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO42237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S279])

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 490/1165 (42.06%), Postives = 706/1165 (60.60%), Query Frame = 3
Query:  171 WRQPVSDDLINGAHFDRYDEDS-------NSLESNCLVRVDEYGFFVHWKSEQG-EGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKD-FITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFL-----KGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFI 3623
            W   V   L +G    R+DE S       N L  N    VD+ GFF+ W+S+   EG  +++S +S+VR G  PK+ K+   L    ++PL++R  T+   T+LV+ +Y H+ +  + +A  W+  LRPL HN +++N   + QL K +++  L   A G I V+SI K   +GK E ++  +L+ LGLP  K+D+I P  FTFE FY+LY K+CPR +I E+  E    +   +T  +++ ++N+ QRDPRLNEILFPF + +    ++   E   +  +  ++ +    RYL+S+DN  +   RLN+  DM+QPL+HY+INSSHNTYL GRQFGG+SSVE+YRQ L++GCRCIELDCWD  G++ EPIITHG AMCT ILFKDVI AIRD+AF TS+ P+ILSFENHCSK QQYK+A YC D+LGD+L+TKP++   L +  PLPSP +LR KILIKNK+LKPE E +    F         T+  +   ++ E+ D ++   G              K D       H+  +N   KV +                          SLT ++   ++A +     T NI+P LS++VNY QPV FQGFD +E  N+ Y MSSFNE+ G GL+R   +  V YNKRQ+SRIYPRG+RVDS+N+MPQ+FWN GCQMV+LNFQTPDL   LNQGKFE+NG SGY+LKP+ MRR +R FDPF+ESP+DG + A + IK+ISGQ+LSDKK+ T VEVDMYGLPTDT RK+++T+   +NGLN +Y D    +FR+VVLP++A+LR  V +D  ++I QRV+PL+ +Q+GYRH+ LRTE + P+ L T+F  IT   Y+PEG   +VD L++P  +    +KR  Q+   GI+ +    V    +P      K+   S    L P +  +        V  P+               +F  ISL  L+ DKT++K+IKRQ +E E ++KK+ K+  ++ ++ T   +KL  ++  EI  K   + +  R         +K+LK   +++   + + Q+ +   ++ T TDEWTSM  +   EE  +     E++  +L   + +  E Q KE  I  ERE  E+K +QTK SI+A K++  D+ +KNK ER+R++++L+  N K+F+
Sbjct:    8 WEVYVPLKLQSGTLLSRWDEASFLNKEPNNKLRINT-TYVDKCGFFLAWRSQDDKEGSSIEISNISEVRLGVLPKDQKVRESLQRTGADPLEERGFTVVYNTNLVDCNYLHLFASTSRVAKEWVEGLRPLLHNVRLDNCSVLTQLHKQYVKAGLHKDALGKISVKSICKALYAGKFESLVLDALQALGLPCSKNDKITPEDFTFEHFYQLYLKVCPRLEIMELCVEWGGGRAPILTATQLVNFMNKEQRDPRLNEILFPFCDNEKALSLIWKYEKQMDMLQRDRICVNGLTRYLLSEDNLLIMPGRLNLSDDMNQPLSHYFINSSHNTYLVGRQFGGRSSVEMYRQCLIAGCRCIELDCWD--GQNDEPIITHGNAMCTKILFKDVIEAIRDSAFQTSDFPVILSFENHCSKHQQYKMACYCMDILGDMLVTKPLESCPLEEGRPLPSPNQLRGKILIKNKKLKPEQEAEGESSFYGTKESSASTQSTESNGDDDEERDSVLPFKG--------------KRDDKGFGSTHRLNMNAYKKVSQ--------------------CCLDAASLTPDDVADIMASFPTQSTTGNINPLLSSLVNYIQPVPFQGFDESEKRNLFYQMSSFNESTGFGLVRATPLDFVKYNKRQMSRIYPRGSRVDSSNYMPQVFWNVGCQMVSLNFQTPDLPFHLNQGKFEFNGRSGYILKPDLMRRDDRMFDPFTESPIDGYVGAYVAIKVISGQYLSDKKITTVVEVDMYGLPTDTIRKKYKTKSSTSNGLNTLY-DGEHMVFRRVVLPEMALLRFAVIDDNDRIIAQRVVPLDSIQAGYRHVPLRTENDTPIPLATLFVHITLRCYVPEGYGAIVDELAEPIKFQCAADKRAAQMVVFGIDENVRARVIQV-EPRLLQHSKEHSRSVGFSLKPTINEQLFIGKYKIV--PI---------------EFIPISLEELKKDKTYRKVIKRQQKESEVIQKKYSKERVMMQRAHTSELEKLITSYD-EI--KQAAQKTYERATKRCGDDRAKALKAVYDKKIAYLSQSQREKAQKVLATQTDEWTSMISRQIAEEIAIYEQHAETQICVLQAALDQAHEIQLKETVIKHERENSEIKKRQTKQSIEAGKSIFMDKTIKNKEERERKLKQLDRHNLKQFV 1113          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO43813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXP6])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 375/796 (47.11%), Postives = 515/796 (64.70%), Query Frame = 3
Query:  411 NPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTE--KIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADM 2789
            +PL ++ +TI  G ++V++ Y   VS  + +A  W ++L  +THN    N CP   LKK + ++C+    +G + V+++ K  +S   E  K I  +L+ +GLP GK+D I    F+F+ F+E Y+++C R DI++IF E+ +  K ++ TE++++++N  QRDPRLNEIL+P+ N++  + I+   EP++++ K+G  S++   RYLMS+DNAP+  DRL++ QDM QP++HY+INSSHNTYLTG Q  GKSSVE+YRQ LL+GCRCIELDCWDGK EDQEP+ITHG  +CT+I FKDVI AI + AF TS+ P+ILSFENHC+  QQ K+A YC ++ GD+LL+KP+D + L +                   R  P ++    ++ +K +  I  E N  ++          +    N   PT        P  E    E+NG                  E +PD    AS++ S   EE    +A              LS +VNY QPV F+ FD++   N  Y MSSF E V    ++   +  V+YNKRQLSRIYP+G RV S N+MPQIFWNAGCQ+VALNFQT DLAM LN G FEYNG  GY+LKP FMRR +R+FDPF+ES +DG+IA  + +K+ISGQ L++KKVGTYVEV+MYGLP DT RK++RT+VVPNNG+NP+Y DD  F F+KVVLP LAVLRI VYE++GKLIGQR+LP++GL  GYRHI LR + N PL+LP +F  I    Y+P G  D  +AL DP A+ S+E+KR +QLA +
Sbjct:   18 DPLTEKAITIVHGANMVDLMYVTFVSSSSTMARQWTDSLVKITHNLLEINECPTTFLKKQYTKICVQTTQDGKVSVKNVIKYISSSSKEDRKRIQDALQSVGLPHGKNDAISLEKFSFDIFWEFYNRLCNRQDIDKIFTEIGTKKKPYMVTEQLVDFINNNQRDPRLNEILYPYCNEEKAREIIRKYEPNQDFVKKGHFSVQGLTRYLMSEDNAPIHPDRLSLHQDMTQPISHYFINSSHNTYLTGHQLTGKSSVEMYRQTLLAGCRCIELDCWDGKTEDQEPVITHGMTLCTEISFKDVIEAIAECAFKTSDYPVILSFENHCTPKQQLKMASYCVNIFGDMLLSKPLDDYPLEEG------------------RPLPPLKVLMRKIVIKNKKPIDSEPNATSD----------QAFSNNSAPPT--------PATEDKPPEING------------------EVDPD----ASQRDSTVEEEAAPDMA--------------LSELVNYFQPVHFKSFDVSAKRNRSYEMSSFVETVATTQLKEKPVEFVNYNKRQLSRIYPKGTRVGSENYMPQIFWNAGCQLVALNFQTLDLAMMLNLGIFEYNGRCGYILKPSFMRRSDRTFDPFAESTVDGIIAGAVHVKVISGQLLTEKKVGTYVEVEMYGLPADTVRKKYRTKVVPNNGINPVYDDDP-FEFKKVVLPSLAVLRIAVYEESGKLIGQRILPVDGLNPGYRHIKLRNDCNLPLTLPVLFVHIITKDYVPSGFEDFANALCDPIAFQSQEDKRQQQLAAL 740          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO38229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH9])

HSP 1 Score: 202.601 bits (514), Expect = 1.562e-54
Identity = 116/302 (38.41%), Postives = 172/302 (56.95%), Query Frame = 3
Query: 1833 GSLTAEEEQAMLAQYHYIGA---------TTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKK--------VGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVY-EDTGK--LIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKI 2678
            G+++ E+E A + Q     A            +   LS  VNY   V F+ F+ +++    Y MSSF E+    L +      V+YN RQLSR YP G+RVDS+N+ PQ+ WN GCQ+VALN+QT    M LNQG+F  N  +GY+LKP +MR P+  F+P +     GV    L I++ISGQ L   +        +  YVEV +YG+ +D+   +F+T+V+ +NG NP++ ++   + + + +P+LA+LR  VY ED GK   IGQ  LP+  L++GYRHI L      PL   ++F  +
Sbjct:  367 GTVSDEDEAADIEQEDLAAAREGEESKEKKVKLAKELSRCVNYISSVGFKNFEHSKENAKFYQMSSFVESKVATLAQNKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNVGCQIVALNYQTDGEYMHLNQGRFRENKRAGYVLKPAYMRNPDIKFNPNNPKSCPGVKKKLLIIQVISGQQLPKPQGSSSKGEVIDPYVEVKIYGVNSDS--ADFKTKVIKDNGFNPVWNEE---IKKLLYVPELAMLRFCVYDEDVGKDDFIGQFSLPITSLRTGYRHIHLLDIKGEPLPHASLFVHV 663          

HSP 2 Score: 167.162 bits (422), Expect = 9.258e-43
Identity = 88/236 (37.29%), Postives = 133/236 (56.36%), Query Frame = 3
Query:  744 SSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPID 1451
            ++   E+F E +  I  R +I EI  + ++ K  +  E + ++L +      + E+     +K     I+   EP+EE +++ +L I+    YL+S +          + QDM QPL+HY+I SSHNTYL   Q  G SSV+ Y      GCRC+ELDCWDG   D  PI+ HG  + + I FKD+I A+ + AF  S+ P+ILS ENHC+   Q K+A++ E++LGD L   P+D
Sbjct:  106 AALNKEEFAEFFKAIATRDEIVEIMNKFTSGKAHMNVEDLQKFLYK----QGVKEV-----SKQYCDIIISTYEPTEEGQRDKQLGIDGLTNYLLSKEGDIFDTAHDKVYQDMRQPLSHYFIASSHNTYLMEDQLKGPSSVDAYINAFNKGCRCVELDCWDGDNGD--PIVYHGHTLTSKIKFKDIIQAVAEHAFKVSDYPVILSLENHCNIENQRKIAEHLENILGDKLFKDPVD 330          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO46562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPT6])

HSP 1 Score: 197.208 bits (500), Expect = 1.202e-51
Identity = 107/280 (38.21%), Postives = 158/280 (56.43%), Query Frame = 3
Query: 1893 TTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKK----------VGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYED--TGK-LIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTY 2693
            T  +  +LS +V YTQ   F+G ++ ED   H+ + S  E                Y + +L RIYP G R+DS+N  PQ FWN GCQ+VALN+QT    +Q+N+GKF  NGN GY+LKP+ + +  +SFDP +   + GV    L+I++ISGQ L   K          +  YVEV++ G+P DT   ++RT+ V +NG NP++ +  VFL      PD+A++R  V+++   G+  IGQ  LP + +  G+RH+ L  EG   L   T+FC +T   Y
Sbjct:  600 TIRLSRHLSDLVAYTQSRAFKGLEVEEDGENHWEVISIPEPRAYRFTDTKATQFTRYTRYKLCRIYPAGYRIDSSNPNPQTFWNCGCQLVALNYQTEGRMLQINRGKFRANGNCGYVLKPDILCKESQSFDPMTRKDIPGVSKKVLKIRVISGQQLPKPKDSILGDRGEIIDPYVEVEIIGIPADT--SKYRTKTVIDNGFNPVWEETMVFLLN---FPDIALVRFVVWDEDPIGRDFIGQMTLPFQSIMPGFRHVHL--EG---LDQATVFCHVTIMDY 869          

HSP 2 Score: 176.022 bits (445), Expect = 7.758e-45
Identity = 118/389 (30.33%), Postives = 194/389 (49.87%), Query Frame = 3
Query:  288 VHWK-SEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPL-THNTKMNNVCPMIQLKKHWLR---LCLGVKANGMIPVRSISKTFASGKTE-KIIFQSLKELGLPFGKSDEIDPSSFT-FEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLL 1433
            + W  S++G+   + ++ V ++R G+       C+ +        ++R  T+  G     +    +V+ + E A  W+  LR L   +   N      + +  WLR          +G++ +  +   F   K   KI  + ++E       +D ++ S    FE+F   Y  I  R ++  +  +  NSK+ +T ++++ +L   QR    +E        +    I+   EP++  +K   L I+ F  YL+S D      +  ++ QDM +PL+HY+I SSHNTYLTG Q    SS+++Y +VL SGCRC+ELDCWDGK  D EP++ HG  M + + F+ VI  I D AF+ +  P+ILS ENHCS  QQ  +A +  D   D+L
Sbjct:   49 ISWTPSKKGDRAKIPVNTVKEIREGTVSDAFSQCSEVFP------EERCFTLIHGESFATLD---LVAANREEAMHWMIGLRYLMAQHYGENEPTRRQKARDLWLRGIYTAADKSGDGLLSIDEVY--FLMHKLNVKISNRQVRE-NFKAADTDTVNSSGLLDFEEFANFYKSISTRRELYMLLLKYGNSKENMTVQELLNFLRIEQRVTECDE--------EYCSNIIQTYEPADSNKKNMLLGIDGFTSYLLSADGEIFNPEHSDVYQDMTRPLSHYFIASSHNTYLTGDQLASASSMDMYVRVLQSGCRCLELDCWDGK--DGEPVVYHGYTMTSKVKFRYVILNINDFAFLNNRYPVILSLENHCSVEQQKFMANFMRDTFKDIL 415          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO46546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ0])

HSP 1 Score: 192.2 bits (487), Expect = 8.535e-50
Identity = 117/316 (37.03%), Postives = 170/316 (53.80%), Query Frame = 3
Query: 1779 IKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGA----TTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGT--------YVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYED---TGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKIT 2681
            I +K +K P S  N  + G ++ EE++ +    H        TT +   LS +V+  + V FQ F  + D    + + S NE +   L        V+YNKR LSRIYP G RV S+N+ PQ  WN GCQ+VALN+QTP + M +N GKF  NG  GY+LKP  MR     F+P ++  + G+    ++IK+ISGQ     K  T        YV ++++G+P+D  ++  RTR VP+NG NP++  D  F F  + LP++A+ R  V +D       IGQ  +PL  +Q G RH+ L      PL   T+F  +T
Sbjct:  444 ILIKNKKLPASIDNDEEAGEVS-EEDEYVEENGHDANKNPRKTTKLARELSDLVSLCKSVTFQDFQYSADNQKFWELCSLNEALARRLGNAYPEEFVNYNKRCLSRIYPSGKRVGSSNYNPQDMWNCGCQLVALNYQTPGIMMHVNSGKFLENGECGYVLKPSVMRDEIAYFNPNTKDAIPGISPQIVQIKVISGQQFPKPKGSTAKGDVIDPYVTIEVFGIPSDIAQE--RTRTVPHNGFNPVF--DETFEFH-INLPEIALFRFVVQDDDFIGDGFIGQYTIPLNCMQQGDRHLRLLAFDGDPLDSATLFVHVT 753          

HSP 2 Score: 177.178 bits (448), Expect = 4.932e-45
Identity = 133/416 (31.97%), Postives = 206/416 (49.52%), Query Frame = 3
Query:  234 SNSLESNCLVRVDEYGFFVHWK--SEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLD-DRIVTICSGTDLV--NISYTHMVSQDNEIATFWINNLRPLTHNTK-------MNNVCPMIQLKKHWLRLCLGVKAN-GMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTK 1442
            SNS +      +DE    + WK  S++ E   + +  V ++R G   +           I   +D D I   C+ + +   N    ++V+   + A  W+  LR L  + K       ++++     LK+ ++   +G K     I V ++ +       E I+ Q  K   +    S     +S + E+F   Y ++  R +I  +    +++ D++TT+ ++ +L   Q   R        A K     I+   EP+EE RK+  L I+ F +YLM  D      D+ NICQDM QPL+HY+I SSHNTYL   Q  G+SS+E Y   L  GCRC+ELDCWDG  +  EPII HG  + + I+FK+ + AI + AF  S  P+ILS ENHC   QQ  +AKY +++L D L T+
Sbjct:   35 SNSRQYQRFFAIDEDFSTLRWKPSSKKPEKAKISMDTVREIRSGKNTE-----------IFREMDRDDIQEDCAFSIIYGDNFDTLNLVAYSPDEANIWVTGLRCLVDSEKDPLQLITIDSLTLHTWLKEQFVLADMGGKGRLNEIEVLTVLRQLKVQIPEVIVKQRFKATAV----SSAPQKNSLSREEFLSFYKELTTRPEIYFLLARYASNNDYLTTDDLLLFLESEQGITR--------AGKHYCLEIISRCEPTEEGRKKKCLGIDGFTQYLMESDCDIFDPDQQNICQDMTQPLSHYFIASSHNTYLLDNQLSGRSSIEGYIAALQQGCRCVELDCWDGPYD--EPIIYHGHTLTSKIMFKETVEAIEEHAFDVSPYPVILSIENHCCVKQQQIMAKYLKEILKDKLYTE 425          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:100049535])

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 644/1215 (53.00%), Postives = 855/1215 (70.37%), Query Frame = 3
Query:  150 SKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVL--LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSK-DFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLK----GQTE----IIQEENE-------------NAEDPDPLV-MVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLN-----IKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEV---QKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQ 3695
            +K +EFNW++ + + +  GA FDR+DED    E NCLVRVDE+GFF+ WK+E  EGQVL+ S ++ +R G+ PK+ KI +    + +    L+  I+ ICSG DLVN+S+  MV+ + E A  WI  LR + HN K NNVCPM  LKKHW+++C     NG IPVR I++TFASGKTEK IFQ+LK+LGLP GK+DEI+PS FTF+ FY L  KICPRTDIEE+FK+++ +K D++T + ++ +LNE QRDPRLNEILFPF +      I++  E  EE +K+G++S + F RYLMSD+NAPVFLDRL + Q+MDQPLAHY+I+SSHNTYLTGRQFGGKSSVE+YRQVLLSGCRC+ELDCWDGKGEDQEPIITHGKAMCTDILFKDVI AI++TAFVTS+ P+ILSFENHCSKPQQYK+AKYCE++ GDLLL +P++ H +    PLPSP  L++KILIKNKRLKPEVE++Q E F K    G+T     I+ EE++             N+E P  L  M   ++     +  T+ +K +          + N + KV E   T+++       + E  + D++K     G +  + E+A++AQY Y GATTNIHP+LSAMVNY QPVKFQ FD+AE+ NIHY+MSSFNE+VGLG ++ + I  V+YNKRQ+SRIYP+G RVDS+N+MPQIFWNAGCQMV+LNFQTPDLAMQLNQGKFEYNG+ GYLLKP+FMRR +R FDPFSE+P+DGVIAAT  +++ SGQFLSDKK+GTYVEVDMYGLPTDT RKEFRTR+V NNGLNP Y ++  F+FRKV+LPDLAVLRI VY+D  KLIGQR+LPL+GLQ+GYRHISLR EGN PLSLPT+FC+I   TY+P+G   +VDALSDP+ +L+  EKR  Q+  +GI+T+DI DVP +G        K   ++ +  +TP  ++   Q++NS          NN  + KKD     N S+  L+  K + KL+K+Q +EL  L+KKH K+   + K+     DK+ + H +E +   K+     +K    NC      +E + E  D I+ +    K ++ ++   HT EW+ +   H  +E ++    +  + E+L K++   QE Q  +LK+I ER+ KEM+A Q K S++ +K +  D+ +KNKAER+RR+RELN  NTK+F+D+RK  A K  ++ ++L +   EQ
Sbjct:    2 TKCYEFNWQKHLPEFMQEGASFDRFDEDPYLFEPNCLVRVDEFGFFITWKNEGKEGQVLECSLINSIRVGAVPKDPKILSSFESIGKTEADLEGCIICICSGADLVNLSFMFMVADNPETARKWIEGLRSVIHNFKANNVCPMTCLKKHWMKMCFLTNINGKIPVRGITRTFASGKTEKGIFQALKDLGLPSGKNDEIEPSDFTFDMFYALTQKICPRTDIEELFKKINGNKTDYLTVDHLVSFLNENQRDPRLNEILFPFYDPKRAMQIIEKYERDEELKKKGRMSSDGFCRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSDYPVILSFENHCSKPQQYKMAKYCEEIFGDLLLKQPLESHPIEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQFEAFKKHMEAGETNTPAIIMGEEDDVENGEKEGEEKDLNSEAPSCLSEMTSVKEANDVSLKETVSLKKEE---------QSNSIKKVPEHDGTEMSEATDATDISEASDQDNKK----AGEVAEDSEEALIAQYTYEGATTNIHPFLSAMVNYAQPVKFQSFDVAEERNIHYNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCQIILKTYVPDGFGAIVDALSDPKKFLTIAEKRADQMKALGIDTNDIADVP-SGNSKNDKKGKGKGDTVKTSVTPQASSDMAQTSNSA--------QNNTSESKKDATLVPNASIEDLKQTKAYLKLMKKQQKELNALKKKHSKEQNTMQKAHCTQVDKMVSLHEKEKSTLEKLLEKAFKKRGENNC------QELKKETEDKIQTLVTEHKAKVKEITAQHTKEWSELISGHSNKEQEMKDGHVMQQCEVLKKLLNNNQEQQTSQLKLIHERQSKEMRANQAKVSMENSKAINQDKTIKNKAERERRVRELNSSNTKKFLDERKRLAMKHQKEMEQLEKNQREQ 1187          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 360.147 bits (923), Expect = 5.585e-104
Identity = 183/428 (42.76%), Postives = 266/428 (62.15%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIV----------DVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR 3167
            +S +V Y QPVKF  F+ ++ +N  Y MSSF E   L  + +  +  V+YNK QLSRIYP+G RVDS+N+ PQ+FWNAGCQ+VALNFQT DL+MQLN G FEYNG  GY LKPEFMRRP++ FDPF+ES +DG++A TL +KI+SGQFLSDKKVGTYVE+DM+GLP DT RK F+T+    N +NP++ ++++ +F+KVVLP LA LRI V+E+ GK IG R+ P   ++ GY +I+LR E N  L+LP++F  +    Y+P+   D+++ALS+P  Y++  E+R  QLA + +E               D PT  K   +   + +EN  + P+ P+          S  S      + +       E   +  ++  L+  K+F +  ++Q +E++ L +KH + +  + K  T    +L   H R
Sbjct:  569 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAI-VFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESK-VDRGVVQPAENGLETPIIPSKPPSLVGPTQSAGSLKPAAKTEDIIQSVLTE--LEAHTVEELKQQKSFVREQRKQYKEMKELVRKHHRKTGEMIKEHTARISELQGQHQR 992          

HSP 2 Score: 349.747 bits (896), Expect = 2.391e-100
Identity = 179/437 (40.96%), Postives = 276/437 (63.16%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVR---FGSKPKEDKICAVL-LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            V + L  G  F ++++DS ++    L  VD  G+F++W  +  +  +LD++ + D R   F   PK+ K+  VL +  +   L++R++T+ SGTD+VNI+Y + ++   EIA  W   L  L  N  + N      L+K + RL L +   G IPV++I + F++ +  K +  +L+   LP G+++ I    FT E +      ICPR +++ IF E+ + S+ ++T E++ E++N  QRDPRLNEIL+P    + V+ ++D  EP+    ++G++S+E F RYL  ++N+ +  ++L+  +DM  PL+HY+INSSHNTYLT  Q  G SSVE+Y+QVLLSGCRCIELDCW G+  ++EP+ITHG  M T+I FK+VI AI + AF TS  PIILSFENH   P QQ K+A+YC  + GD LL +P++K++L   V
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGV 451          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 360.918 bits (925), Expect = 5.782e-104
Identity = 183/428 (42.76%), Postives = 266/428 (62.15%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIV----------DVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAR 3167
            +S +V Y QPVKF  F+ ++ +N  Y MSSF E   L  + +  +  V+YNK QLSRIYP+G RVDS+N+ PQ+FWNAGCQ+VALNFQT DL+MQLN G FEYNG  GY LKPEFMRRP++ FDPF+ES +DG++A TL +KI+SGQFLSDKKVGTYVE+DM+GLP DT RK F+T+    N +NP++ ++++ +F+KVVLP LA LRI V+E+ GK IG R+ P   ++ GY +I+LR E N  L+LP++F  +    Y+P+   D+++ALS+P  Y++  E+R  QLA + +E               D PT  K   +   + +EN  + P+ P+          S  S      + +       E   +  ++  L+  K+F +  ++Q +E++ L +KH + +  + K  T    +L   H R
Sbjct:  569 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAI-VFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESK-VDRGVVQPAENGLETPIIPSKPPSLVGPTQSAGSLKPAAKTEDIIQSVLTE--LEAHTVEELKQQKSFVREQRKQYKEMKELVRKHHRKTGEMIKEHTARISELQGQHQR 992          

HSP 2 Score: 349.747 bits (896), Expect = 3.645e-100
Identity = 179/437 (40.96%), Postives = 276/437 (63.16%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVR---FGSKPKEDKICAVL-LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            V + L  G  F ++++DS ++    L  VD  G+F++W  +  +  +LD++ + D R   F   PK+ K+  VL +  +   L++R++T+ SGTD+VNI+Y + ++   EIA  W   L  L  N  + N      L+K + RL L +   G IPV++I + F++ +  K +  +L+   LP G+++ I    FT E +      ICPR +++ IF E+ + S+ ++T E++ E++N  QRDPRLNEIL+P    + V+ ++D  EP+    ++G++S+E F RYL  ++N+ +  ++L+  +DM  PL+HY+INSSHNTYLT  Q  G SSVE+Y+QVLLSGCRCIELDCW G+  ++EP+ITHG  M T+I FK+VI AI + AF TS  PIILSFENH   P QQ K+A+YC  + GD LL +P++K++L   V
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGV 451          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 352.443 bits (903), Expect = 3.088e-101
Identity = 158/294 (53.74%), Postives = 217/294 (73.81%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGI 2795
            +S +V Y QPVKF  F+ ++ +N  Y MSSF E   L  + +  +  V+YNK QLSRIYP+G RVDS+N+ PQ+FWNAGCQ+VALNFQT DL+MQLN G FEYNG  GY LKPEFMRRP++ FDPF+ES +DG++A TL +KI+SGQFLSDKKVGTYVE+DM+GLP DT RK F+T+    N +NP++ ++++ +F+KVVLP LA LRI V+E+ GK IG R+ P   ++ GY +I+LR E N  L+LP++F  +    Y+P+   D+++ALS+P  Y++  E+R  QLA + +
Sbjct:  563 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAI-VFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTL 855          

HSP 2 Score: 348.206 bits (892), Expect = 8.783e-100
Identity = 179/437 (40.96%), Postives = 276/437 (63.16%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVR---FGSKPKEDKICAVL-LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKEL-SNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKP-QQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            V + L  G  F ++++DS ++    L  VD  G+F++W  +  +  +LD++ + D R   F   PK+ K+  VL +  +   L++R++T+ SGTD+VNI+Y + ++   EIA  W   L  L  N  + N      L+K + RL L +   G IPV++I + F++ +  K +  +L+   LP G+++ I    FT E +      ICPR +++ IF E+ + S+ ++T E++ E++N  QRDPRLNEIL+P    + V+ ++D  EP+    ++G++S+E F RYL  ++N+ +  ++L+  +DM  PL+HY+INSSHNTYLT  Q  G SSVE+Y+QVLLSGCRCIELDCW G+  ++EP+ITHG  M T+I FK+VI AI + AF TS  PIILSFENH   P QQ K+A+YC  + GD LL +P++K++L   V
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGV 451          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000042446.1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 [Source:NCBI gene;Acc:101175365])

HSP 1 Score: 350.903 bits (899), Expect = 4.918e-101
Identity = 226/634 (35.65%), Postives = 349/634 (55.05%), Query Frame = 3
Query: 1914 LSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVP-NNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIE-------TSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVL-----------LETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKE 3758
            +S +VNY QP KF  F+ ++     YHMSSF E   L  + +  +  V+YNK QLSRIYP+G RVDS+NFMPQ+FWNAGCQ+VALN+QT DL+MQLN   FEYNG SGY LKPEFMRRP++ FDPF+E+ +DG++A TL +K+ISGQFL++++VG YVEV+M+GLP DT RK  +T+    NN +NP++ D+   +F+KV+LP LA LRI  +E+ GK IG  ++P+  ++ GYR+I LR E N  L LP +F  I    Y+P+   D+++ALS+P  Y++  E+R KQLA + +E       T D  D  T  +   KP     EN     L+P  +        +T             D  K   K +++ L +           L+  K + K  +RQ +EL+ L ++H+K ++ L                RE N K K    + R+ S             E+E+ + +++++++Q   L+    +++ S K  + ++EH      +++  E L  + +E    Q K+LK I ++E KE+K Q  +   +     IN  K K K   +    E+N       +   K   + Q ++  +L  +HD+  +E+     K +  +E++F+E
Sbjct:  532 MSTLVNYVQPTKFNSFEASKKAARCYHMSSFVETKALEHLTKSPVEFVEYNKSQLSRIYPKGTRVDSSNFMPQLFWNAGCQLVALNYQTIDLSMQLNLFMFEYNGRSGYRLKPEFMRRPDKHFDPFTENTVDGIVANTLSVKVISGQFLTERRVGVYVEVEMFGLPADTRRKALKTKTSQNNNAINPVW-DEEPIVFKKVILPTLASLRIAAFEEGGKFIGHHIIPVSAIRPGYRYIGLRNERNQSLMLPAVFVYIEVKDYVPDTFADVIEALSNPIRYVNLLEQRSKQLAALTLEDGEEEAQTEDEADSTTEKRADLKP--ATVENG----LSPTSSQAGHTPAATTPKASSANQQAAAADPAKASVKTEDLVLSVLIEVPPCLLEHLQQSKLYSKEQRRQFKELKELSRRHQKKTSEL---------------LREFNNKYK---KMARQCS------KSRASSSESEKDERLQQLREDQHQQLLALRQEQFYSQK--YLQKEH------IKTLTERLSSLAEESHRGQMKKLKDICDKEKKELKRQMDRKRTEK----INQAKTKEKHLAEEEKIEINKSYVNEVVQNIKRLEETQAKRHDQLVEQHDQLLQEIQDQKLKLQAAVEVEFQE 1122          

HSP 2 Score: 320.087 bits (819), Expect = 2.096e-90
Identity = 169/436 (38.76%), Postives = 266/436 (61.01%), Query Frame = 3
Query:  183 VSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPK---EDKICAVL-LERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHC-SKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAV 1475
            VS  L NG++F ++DED +++ +   + VD  GF+++W  +  + ++LDL+ V DVR G   K   E K+  +L +  +   L++R+VT+ + +DLVN++  + ++   + A  W   L  L+ N   +N+     L K ++RL L +  +G IPV++I + F+S +  K +  +L    LP+G+ D I    FT E +      +CPR ++  IFK    +   ++ +++ E++N  QRDPRLNEIL+P         +++ ++  +   K G +S++ F  YL SD+N  +  ++L+  +DM  P++HY+INSSHNTYLT  Q  G SSVE+YRQVLL+GCRC+ELD W G+  ++EP+ITHG  M ++I FK+VI AI + AF TS  P+ILSFENH  S  QQ K+A+YC  + GD LL  P+DK+ L   V
Sbjct:   18 VSHTLRNGSNFIKWDEDLSTV-TPVTLHVDPNGFYLYWTDQNKDTELLDLTVVKDVRTGRSTKTTKEAKLRELLDVGNLVGRLENRMVTVVTASDLVNVNQLNFIASQEDEAKVWCEELFSLSSNLLSHNLNRDQSLLKAYVRLTLQLNTDGRIPVKNIVRLFSSDR--KRVETALDSCRLPYGRGDSIRVEDFTLEVYKSFLDSLCPRPELGNIFKLQGGNGGMLSIDQMTEFINNKQRDPRLNEILYPPFRPAQTLSLMERHQLDQAELKRGLISLQAFSMYLSSDENGVIPPEKLDQSEDMSFPMSHYFINSSHNTYLTAGQLAGSSSVEMYRQVLLAGCRCVELDVWKGRTAEEEPVITHGFTMTSEISFKEVIEAIAECAFKTSLFPVILSFENHVDSLKQQAKMAEYCRSIFGDALLIDPLDKYPLEAGV 450          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 2384.76 bits (6179), Expect = 0.000e+0
Identity = 1206/1228 (98.21%), Postives = 1207/1228 (98.29%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGK+DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKG                     NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGE--------------------NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 1208          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 2379.75 bits (6166), Expect = 0.000e+0
Identity = 1227/1267 (96.84%), Postives = 1228/1267 (96.92%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE---------------------------------------DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGK+DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE                                       DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYSKSLKEKENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFCFVLMHDYILLLDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYSKSLKEKENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 1267          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 2337.76 bits (6057), Expect = 0.000e+0
Identity = 1206/1267 (95.19%), Postives = 1207/1267 (95.26%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE---------------------------------------DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGK+DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE                                       DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKG                     NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFCFVLMHDYILLLDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGE--------------------NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 1247          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 2331.98 bits (6042), Expect = 0.000e+0
Identity = 1206/1279 (94.29%), Postives = 1207/1279 (94.37%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE---------------------------------------------------DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGK+DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE                                                   DLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKG                     NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFVKYPKFLFFPLNCFVLMHDYILLLDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGE--------------------NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 1259          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 2326.21 bits (6027), Expect = 0.000e+0
Identity = 1189/1228 (96.82%), Postives = 1197/1228 (97.48%), Query Frame = 3
Query:  108 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVXXXXXXXXXXXXXXXXXXXXXEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNXXXXXXXEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYXXXXXXXXXXXXDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIXXXXXXXXXXXXXTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 3791
            MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGK+DEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAE+   H+HMSSF+E V LG ++ + I  V+YNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKG                     NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKEQSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFVNYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGE--------------------NEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEVVSAIDKERHLLEMKFKEDLLATKRATAI 1208          
The following BLAST results are available for this feature:
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+054.83phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB40.000e+054.83phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB40.000e+055.12phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB40.000e+055.12phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB40.000e+055.12phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-80.000e+046.671-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-80.000e+045.041-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-80.000e+046.231-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-80.000e+045.321-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-80.000e+045.731-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
norpA5.924e-17354.73gene:FBgn0262738 transcript:FBtr0343599[more]
norpA5.924e-17354.73gene:FBgn0262738 transcript:FBtr0100670[more]
norpA5.924e-17354.73gene:FBgn0262738 transcript:FBtr0100671[more]
norpA9.860e-17154.73gene:FBgn0262738 transcript:FBtr0070651[more]
norpA9.860e-17154.73gene:FBgn0262738 transcript:FBtr0301475[more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+052.08phospholipase C beta 4 [Source:NCBI gene;Acc:10053... [more]
plcb30.000e+036.39phospholipase C, beta 3 (phosphatidylinositol-spec... [more]
plcb30.000e+036.83phospholipase C, beta 3 (phosphatidylinositol-spec... [more]
CABZ01072157.16.709e-8851.23pep chromosome:GRCz11:17:2348540:2386569:-1 gene:E... [more]
BX936422.11.122e-8531.91phospholipase C, eta 1 [Source:NCBI gene;Acc:56647... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16b0.000e+054.92protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b0.000e+054.75protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b0.000e+054.75protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b0.000e+054.66protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b0.000e+054.66protein phosphatase 1 regulatory subunit 16B [Sour... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plcb40.000e+055.04phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb40.000e+055.04phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb40.000e+057.42phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb40.000e+062.35phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb15.805e-11245.43phospholipase C, beta 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15147|PLCB4_HUMAN0.000e+055.121-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q9QW07|PLCB4_RAT0.000e+055.041-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q07722|PLCB4_BOVIN0.000e+055.121-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|G5EBH0|PLCB_CAEEL3.523e-14245.291-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|P13217|PIPA_DROME9.884e-17054.731-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P0N30.000e+065.231-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A4Z2CYF80.000e+065.721-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A5K4F0P80.000e+064.86Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0R3U5L30.000e+061.611-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A074ZXA50.000e+064.661-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+054.89phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
PLCB40.000e+053.91phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
PLCB40.000e+052.981-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
PLCB40.000e+051.891-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plcb30.000e+036.561-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+051.89phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB13.874e-10745.32phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB11.707e-10056.08phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
plcd3b2.929e-4737.70phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000003983.13.140e-4652.80pep scaffold:Pmarinus_7.0:GL481506:4806:23311:-1 g... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PLC11.751e-2244.83Phospholipase C; hydrolyzes phosphatidylinositol 4... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422370.000e+042.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438130.000e+047.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382291.562e-5438.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465621.202e-5138.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465468.535e-5037.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+053.00phospholipase C beta 4 [Source:NCBI gene;Acc:10004... [more]
PLCB15.585e-10442.76phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
PLCB15.782e-10442.76phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
PLCB13.088e-10153.74phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000042446.14.918e-10135.651-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049234.10.000e+098.21SMESG000049234.1[more]
SMESG000049234.10.000e+096.84SMESG000049234.1[more]
SMESG000049234.10.000e+095.19SMESG000049234.1[more]
SMESG000049234.10.000e+094.29SMESG000049234.1[more]
SMESG000049234.10.000e+096.82SMESG000049234.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011684 ID=SMED30011684|Name=1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=4174bp
TTTTATATCACTGTTTGTTTTCATTTATCAATTCTTTTTAATTTTTTATT
GTCAAATGTAATTCCATTTGCATTATGCAAAACATAGAATTATTCTGAAG
TGCAAATATGACTTCGGATATTGCTAAACGCCAACGAACTGTACCTTCGT
CTAAAGCATTTGAATTCAATTGGCGTCAACCTGTTTCAGATGACCTTATA
AATGGAGCTCATTTCGATCGATATGATGAAGACAGTAACAGCCTTGAATC
TAATTGCCTAGTGAGAGTGGATGAATATGGATTTTTTGTCCACTGGAAAA
GCGAACAAGGAGAAGGACAAGTACTTGACCTATCACAAGTCAGTGACGTC
AGATTTGGTTCAAAACCTAAAGAAGACAAAATCTGTGCAGTGTTATTGGA
ACGGATCAGTAACCCATTAGATGATCGAATTGTTACTATTTGCAGTGGTA
CAGATCTAGTAAATATATCATATACTCATATGGTGTCTCAAGATAATGAA
ATTGCAACTTTTTGGATCAATAATTTGAGGCCCCTGACTCACAATACAAA
AATGAACAATGTTTGTCCAATGATTCAATTGAAAAAACATTGGTTGAGAC
TTTGTTTGGGAGTGAAGGCCAATGGAATGATTCCAGTTCGATCAATCAGC
AAAACATTTGCATCCGGGAAGACAGAAAAAATTATCTTTCAGAGTTTAAA
AGAGCTGGGCCTTCCATTTGGAAAGAGTGATGAGATAGATCCGTCGTCAT
TCACATTTGAGAAATTCTACGAACTTTACCACAAAATCTGTCCAAGGACT
GATATCGAGGAAATTTTCAAGGAATTGTCAAACAGTAAGGATTTCATCAC
CACCGAAAAGATTATCGAATACTTGAATGAGGTTCAACGAGATCCGAGAT
TGAATGAGATTCTATTTCCATTTGCCAACAAAGACACCGTCAAATATATA
CTAGATAATAACGAGCCTTCGGAAGAGTATAGGAAGGAAGGTAAATTATC
GATAGAGTGCTTCTATCGCTACCTCATGTCTGATGACAATGCTCCAGTGT
TCCTTGATCGGCTCAACATTTGTCAAGATATGGATCAACCCCTAGCTCAT
TATTATATCAACTCGTCACATAACACCTATCTCACCGGGAGACAATTTGG
TGGCAAATCCTCAGTGGAAATATACCGCCAAGTGCTTCTGTCAGGGTGTC
GATGTATCGAGTTAGATTGTTGGGACGGCAAAGGTGAAGACCAAGAACCA
ATCATAACTCACGGGAAAGCAATGTGTACAGATATTTTATTCAAGGATGT
TATCTATGCGATTCGCGACACAGCCTTTGTGACATCAGAGATGCCAATTA
TCCTCTCCTTTGAAAATCATTGCAGTAAACCTCAACAGTACAAGTTGGCC
AAATATTGTGAGGACGTCCTCGGAGACTTGCTGCTAACGAAACCCATCGA
CAAACATGAGTTATCCCAAGCAGTTCCTTTACCGTCTCCTCTTAAATTAA
GAAAAAAAATTCTCATAAAAAACAAACGATTGAAACCCGAAGTTGAAAAA
CAACAATTGGAAATGTTCCTGAAAGGTCAAACAGAAATAATCCAAGAAGA
AAATGAGAATGCAGAAGATCCTGATCCTTTAGTAATGGTTGACGGTGAAG
ATGGTCCGATGAATGAAATAAATCCTACAATCATTGTAAAAAATGACACA
GATCCCCATCCGGAAATGCATAAAACTGAACTCAACGGCTTATTGAAAGT
CAAAGAACAAAGCGATACTCAGTTGAACATTAAAGTCAAAGAAGAGAAAG
AACCCGATTCAAGAAAAAATGCTTCAAAAAAAGGAAGTCTGACCGCAGAA
GAAGAGCAGGCCATGTTGGCACAATATCACTACATCGGTGCTACTACTAA
TATTCATCCTTATTTGTCAGCAATGGTTAATTATACTCAACCAGTTAAAT
TTCAGGGATTCGATATTGCAGAGGATTTAAATATTCACTATCACATGTCG
TCTTTTAATGAAAATGTGGGCTTGGGTCTGATTCGTCGTGATTGCATTGC
TTTAGTTGACTATAATAAACGCCAACTGAGTCGAATTTATCCTCGTGGAA
ATCGGGTGGACTCCGCAAATTTCATGCCCCAGATATTTTGGAATGCTGGT
TGTCAAATGGTAGCTCTCAATTTCCAAACCCCTGATTTAGCAATGCAACT
TAATCAGGGGAAATTCGAATATAACGGAAATTCTGGTTACCTTTTGAAAC
CGGAGTTTATGAGACGTCCTGAACGTTCCTTTGACCCATTTTCTGAATCC
CCTATGGATGGAGTTATCGCTGCTACACTAGAAATCAAAATCATATCTGG
TCAGTTTTTGTCAGATAAAAAAGTTGGAACCTATGTAGAGGTTGACATGT
ATGGTCTTCCTACTGATACTTTCAGGAAAGAATTTAGAACAAGAGTTGTT
CCCAATAATGGTCTCAATCCTATTTACGGAGACGATAGTGTCTTTCTTTT
TAGAAAAGTCGTTCTTCCAGACCTGGCTGTTTTAAGGATAGGTGTTTATG
AAGATACTGGCAAATTAATTGGTCAGAGAGTATTACCTTTGGAAGGTTTA
CAATCTGGTTACAGACATATCTCTTTAAGAACCGAAGGAAACTTTCCCTT
GAGTTTACCCACCATATTTTGTAAAATTACTCAAACCACCTACATTCCAG
AAGGCTTAGTCGATTTGGTAGACGCTCTTTCTGATCCCCGAGCATATCTT
AGTAAAGAAGAGAAGCGAATGAAACAACTTGCTGATATGGGTATTGAAAC
ATCAGATATTGTCGATGTGCCAACCACTGGAAAACCTTTTAAAAAACCTC
CTGATAAAAAATCGGAGAATTCTAATCAAGAACCATTAACTCCTAATTTG
GCAAATAAATCGGGGCAATCTAATAATTCTACTGTTTCTACTCCCGTTGT
CGGATTCTCAAACAATAAAAAGGATGATAAGAAAGACGAACCGAAATTTG
ACAACATCTCACTGGTTTTGTTAGAAACCGATAAAACATTCCAGAAATTG
ATCAAACGTCAAACACGAGAATTGGAAAACCTGCGGAAAAAGCACGAAAA
AGATTCAGCTATATTGCACAAATCTCAAACAATCGTTACGGATAAATTAA
ACGCAAATCACGCCAGGGAGATCAACAAAAAAGTCAAAGTGAAAGGGTCA
TTAATGCGAAAAATAAGTCACTATAATTGTTTATATTCCAAGTCACTAAA
AGAAAAGGAAAATGAAGAAAGTGACATGATTGAGGAAGTTCAGAAAAACC
AAATGGTAGATTTGGTAAAAACTCATACCGATGAATGGACATCGATGAAG
TTGCAGCACCGGAAAGAAGAACATGACTTATGTATGTCGTTTTTGGAGAG
TCGGCAGGAACTCTTGCTAAAGGTAATGAAGGAAGTTCAAGAAGATCAAA
AGAAAGAATTAAAAATTATTCAAGAAAGAGAAATAAAAGAAATGAAAGCC
CAACAGACTAAAGCCTCCATAGATGCAAATAAAAATGTAATCAACGACAG
AAAACTGAAGAACAAAGCGGAACGAGATCGACGGATCAGAGAATTAAATG
ACATCAACACAAAAAGATTCATCGATCAAAGAAAAGCTCAAGCTCAAAAA
CAAGATAGACAAACTCAGGAGTTAAACCGGAAGCACGATGAGCAGGAAAA
GGAAGTTGTATCAGCAATTGATAAAGAGCGCCATTTGTTAGAAATGAAAT
TCAAGGAAGACCTTCTTGCAACGAAAAGAGCAACTGCCATCTAATGGAAG
TATTTGTCTATTATTCAATCAGAGATCCTATTTGACCAAACAATATGATA
TCATCTTGAACCTTTAAACACGAACATGCAATTCATATCGTAATTATCTA
CGCCTGTGACAGACGACTGTATTTAATGTCTCGCAATCATCGCAATCTTT
CATCTACATCAAATCTCGCACGATTACACAACTGAATAATTCCGTGGCAA
TTTTCTCGCTGGTTTTGCTGATTTCTTCAATTTTCATCTCAACTGCATCC
CAACTGCATCCGGATTGCATCTGTTATGCACATTGATTGCATTCAATTAC
TGTAACACTGATTATCACCGATTGTAATCAAATTGTGATAAGCAATATTC
TATAATAATAATAATAATAATAAT
back to top

protein sequence of SMED30011684-orf-1

>SMED30011684-orf-1 ID=SMED30011684-orf-1|Name=SMED30011684-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1229bp
MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNC
LVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERI
SNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMN
NVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKEL
GLPFGKSDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTE
KIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIE
CFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGK
SSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIY
AIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKH
ELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENE
NAEDPDPLVMVDGEDGPMNEINPTIIVKNDTDPHPEMHKTELNGLLKVKE
QSDTQLNIKVKEEKEPDSRKNASKKGSLTAEEEQAMLAQYHYIGATTNIH
PYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALV
DYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQ
GKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQF
LSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRK
VVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSL
PTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSD
IVDVPTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNSTVSTPVVGF
SNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDS
AILHKSQTIVTDKLNANHAREINKKVKVKGSLMRKISHYNCLYSKSLKEK
ENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQ
ELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKL
KNKAERDRRIRELNDINTKRFIDQRKAQAQKQDRQTQELNRKHDEQEKEV
VSAIDKERHLLEMKFKEDLLATKRATAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042531PLC-beta_C_sf
IPR035892C2_domain_sf
IPR037862PLC-beta_PH
IPR001192PI-PLC_fam
IPR001711PLipase_C_Pinositol-sp_Y
IPR000909PLipase_C_PInositol-sp_X_dom
IPR000008C2_dom
IPR009535PLC-beta_CS
IPR011993PH-like_dom_sf
IPR016280PLC-beta
IPR015359PLC_EF-hand-like
IPR017946PLC-like_Pdiesterase_TIM-brl
IPR011992EF-hand-dom_pair
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006629lipid metabolic process
GO:0007165signal transduction
GO:0016042lipid catabolic process
Vocabulary: molecular function
TermDefinition
GO:0004435phosphatidylinositol phospholipase C activity
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0008081phosphoric diester hydrolase activity
GO:0004871signal transducer activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1172..1206
NoneNo IPR availableCOILSCoilCoilcoord: 1044..1064
NoneNo IPR availableCOILSCoilCoilcoord: 975..1002
NoneNo IPR availableCOILSCoilCoilcoord: 1104..1124
NoneNo IPR availableGENE3DG3DSA:2.30.29.240coord: 13..228
e-value: 4.0E-71
score: 240.8
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 229..319
e-value: 1.1E-29
score: 104.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1178..1199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 557..579
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 921..951
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 557..577
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 903..959
NoneNo IPR availablePANTHERPTHR10336:SF1061-PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE PHOSPHODIESTERASE BETA-4coord: 20..1010
NoneNo IPR availablePROSITEPS50007PIPLC_X_DOMAINcoord: 323..473
score: 59.877
NoneNo IPR availableCDDcd08591PI-PLCc_betacoord: 322..706
e-value: 1.71494E-174
score: 513.039
NoneNo IPR availableCDDcd00275C2_PLC_likecoord: 740..858
e-value: 1.7972E-39
score: 140.754
NoneNo IPR availableSUPERFAMILYSSF69989C-terminal domain of PLC-betacoord: 962..1223
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 740..858
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 25..151
IPR001192Phosphoinositide phospholipase C familyPRINTSPR00390PHPHLIPASECcoord: 354..374
score: 60.92
coord: 826..836
score: 48.03
coord: 328..346
score: 72.79
coord: 457..474
score: 54.19
coord: 657..678
score: 57.8
coord: 678..696
score: 64.25
IPR001192Phosphoinositide phospholipase C familyPANTHERPTHR10336PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C FAMILY PROTEINcoord: 20..1010
IPR000008C2 domainSMARTSM00239C2_3ccoord: 740..840
e-value: 3.5E-12
score: 56.5
IPR000008C2 domainPROSITEPS50004C2coord: 726..825
score: 20.21
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainSMARTSM00149plcy_3coord: 603..719
e-value: 5.5E-69
score: 245.2
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainPFAMPF00387PI-PLC-Ycoord: 603..717
e-value: 2.7E-41
score: 140.5
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainPROSITEPS50008PIPLC_Y_DOMAINcoord: 603..719
score: 53.395
IPR000909Phosphatidylinositol-specific phospholipase C, X domainSMARTSM00148plcx_3coord: 323..473
e-value: 2.1E-78
score: 276.4
IPR000909Phosphatidylinositol-specific phospholipase C, X domainPFAMPF00388PI-PLC-Xcoord: 325..473
e-value: 1.5E-59
score: 199.8
IPR042531Phospholipase C-beta, C-terminal domain superfamilyGENE3DG3DSA:1.20.1230.10coord: 963..1220
e-value: 6.6E-7
score: 31.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 732..900
e-value: 5.5E-51
score: 174.6
IPR037862PLC-beta, PH domainPFAMPF17787PH_14coord: 26..151
e-value: 1.8E-39
score: 134.6
IPR037862PLC-beta, PH domainCDDcd13361PH_PLC_betacoord: 30..154
e-value: 3.01013E-46
score: 160.043
IPR015359Phosphoinositide-specific phospholipase C, EF-hand-like domainPFAMPF09279EF-hand_likecoord: 224..311
e-value: 2.1E-8
score: 34.5
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilyGENE3DG3DSA:3.20.20.190coord: 320..511
e-value: 7.3E-75
score: 254.1
coord: 517..730
e-value: 3.1E-52
score: 179.8
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilySUPERFAMILYSSF51695PLC-like phosphodiesterasescoord: 323..720
IPR009535Phospholipase C-beta, conserved sitePFAMPF06631DUF1154coord: 961..1005
e-value: 7.9E-13
score: 48.2
IPR016280Phosphatidylinositol-4, 5-bisphosphate phosphodiesterase betaPIRSFPIRSF000956PLC-betacoord: 10..1227
e-value: 0.0
score: 1550.8
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 152..322