RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30011677
Length (bp)1524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30011677) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30011677) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30011677) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30011677) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011677

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011677SMESG000018666.1 Contig3691newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011677SMESG000018666.1 Contig3691uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011677SMESG000070758.1 Contig3691newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011677SMESG000070758.1 Contig3691uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30011677SMESG000018666.1 SmedASXL_015492SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011677SMESG000018666.1 SmedASXL_015492SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30011677SMESG000018666.1 SmedASXL_015493SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011677SMESG000018666.1 SmedASXL_015493SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011677SMESG000018666.1 SMESG000018665.1 dd_Smed_v4_10611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tail stripeSMED30011677SMESG000018666.1 CUFF.172807.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30011677SMESG000018666.1 CUFF.172807.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30011677SMESG000018666.1 Contig32058newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011677SMESG000018666.1 Contig32058uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011677SMESG000018666.1 SMESG000018665.1 Contig38356newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011677SMESG000018666.1 SMESG000018665.1 Contig38356uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30011677SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30011677SMESG000018666.1 Contig6439_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 119.783 bits (299), Expect = 7.571e-30
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 119.783 bits (299), Expect = 7.571e-30
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 119.783 bits (299), Expect = 8.960e-30
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 125          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 119.398 bits (298), Expect = 2.516e-29
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: DAZL (deleted in azoospermia like [Source:HGNC Symbol;Acc:HGNC:2685])

HSP 1 Score: 83.1889 bits (204), Expect = 1.042e-17
Identity = 42/90 (46.67%), Postives = 61/90 (67.78%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFL 557
            G ++PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ   
Sbjct:   73 GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFFNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLC 158          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: daz-1 (DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20870])

HSP 1 Score: 88.1965 bits (217), Expect = 2.083e-18
Identity = 48/108 (44.44%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRK---QKFLEQFYIMDPCLML 593
            P    LIPNRIFVGG  ++TTE EL+  F  +  +KDVK++    G SKG YGF+TFE ++ AE+I K   + L F+ RKLN+G A+RK     F   + I  P  ++
Sbjct:   58 PPTYELIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKG-YGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATPSQLV 164          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 51.2174 bits (121), Expect = 1.574e-7
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHA 536
            +IFVGG+  +T+++ L  +F  +G I++  +I DR       YGFVT +++ +AE+  K+     I   RK N+  A
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD--PNPIIDGRKANVNLA 110          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 53.1434 bits (126), Expect = 2.166e-7
Identity = 19/59 (32.20%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 482
            ++F+GG+++ +T E++K +F +YG ++D  ++ D+       +GFVTF++ E A+K+ +
Sbjct:  135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCE 193          

HSP 2 Score: 49.6766 bits (117), Expect = 2.961e-6
Identity = 23/90 (25.56%), Postives = 45/90 (50.00%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFL 557
            G+  P ++F+GG++  TT E L+ +F  +G + +  ++ D        +GF+TF +  + +K++ N    L  K+    +    R Q  L
Sbjct:   40 GSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQAKL 129          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 51.2174 bits (121), Expect = 5.329e-7
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNI 527
            +IFVGG+  +T+++ L  +F  +G I++  +I DR       YGFVT +++ +AE+  K+     I   RK N+
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD--PNPIIDGRKANV 107          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: H28G03.1 (pep chromosome:WBcel235:X:5216363:5219095:1 gene:WBGene00019249.1 transcript:H28G03.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H28G03.1)

HSP 1 Score: 51.6026 bits (122), Expect = 5.916e-7
Identity = 22/65 (33.85%), Postives = 39/65 (60.00%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 500
            ++F+GG++ +TT+E+L  +FS +GP+ D  +I D        +GFVTF +  +AE  + +    L
Sbjct:   71 KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKL 135          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076539)

HSP 1 Score: 105.145 bits (261), Expect = 7.065e-26
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076541)

HSP 1 Score: 105.145 bits (261), Expect = 7.065e-26
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076538)

HSP 1 Score: 105.531 bits (262), Expect = 1.142e-25
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0344979)

HSP 1 Score: 105.531 bits (262), Expect = 1.142e-25
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076540)

HSP 1 Score: 105.531 bits (262), Expect = 1.142e-25
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.1662 bits (165), Expect = 3.537e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K++
Sbjct:   52 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 135          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.5514 bits (166), Expect = 6.195e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K++
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 108          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.5514 bits (166), Expect = 6.816e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K++
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIV----DPISFKGKKLKLGPAIMKER 107          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.5514 bits (166), Expect = 7.383e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K++
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 108          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 68.5514 bits (166), Expect = 9.514e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K++
Sbjct:   42 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 125          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:394676])

HSP 1 Score: 77.0258 bits (188), Expect = 4.230e-15
Identity = 40/88 (45.45%), Postives = 58/88 (65.91%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G +IPN +FVGGI     E  +   F  YG +KD+KII DRTG+SKG YGFV+F ++   +KI+K++   + F  +KL +G A+RK +
Sbjct:   25 GKVIPNTVFVGGIDITMDEMAIGNLFEKYGKVKDLKIITDRTGVSKG-YGFVSFYDEVDVQKIVKSQ---INFHGKKLKLGPAIRKMQ 108          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: deup1 (deuterosome assembly protein 1 [Source:Xenbase;Acc:XB-GENE-5961526])

HSP 1 Score: 57.7658 bits (138), Expect = 2.331e-8
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  294 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 500
            L   +IFVGGI  +T E  L+ +F SYG I+ ++++ DR    K  + FVTF++ +T +KI+  +  T+
Sbjct:  115 LTVKKIFVGGIKEDTEEYHLRDYFQSYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTI 183          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: rbm24 (RNA binding motif protein 24 [Source:NCBI gene;Acc:394612])

HSP 1 Score: 56.225 bits (134), Expect = 2.524e-8
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
             +IFVGG+  +TT+  L+ +F  +G I++  +I DR TG S+G YGFVT  ++  AE+  K+    +  ++  +N+ +   K + ++
Sbjct:   11 TKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRG-YGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQ 96          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: nxph2 (neurexophilin 2 [Source:Xenbase;Acc:XB-GENE-951506])

HSP 1 Score: 55.8398 bits (133), Expect = 2.920e-8
Identity = 29/87 (33.33%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
             +IFVGG+  +TT+  L+ +F  +G I +  +I DR TG S+G YGFVT  ++  AE+  K+    +  ++  +N+ +   K + L+
Sbjct:   11 TKIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTGKSRG-YGFVTMSDRAAAERACKDPNPIIDGRKANVNLAYLGAKPRNLQ 96          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 55.4546 bits (132), Expect = 1.071e-7
Identity = 24/65 (36.92%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 500
            ++FVGGI  +T E  L+ +F  YG I+ ++II D+    K  +GFVTF++ +  +KI+  +  T+
Sbjct:  101 KLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI 165          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 116.701 bits (291), Expect = 1.446e-30
Identity = 57/91 (62.64%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 125          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 118.242 bits (295), Expect = 1.532e-29
Identity = 57/91 (62.64%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   24 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 112          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 118.627 bits (296), Expect = 1.704e-29
Identity = 57/91 (62.64%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 125          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 85.1149 bits (209), Expect = 9.096e-18
Identity = 42/90 (46.67%), Postives = 61/90 (67.78%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFL 557
            G ++PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ   
Sbjct:   35 GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLC 120          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 82.0333 bits (201), Expect = 4.614e-17
Identity = 41/87 (47.13%), Postives = 59/87 (67.82%), Query Frame = 3
Query:  297 IPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFL 557
            +PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ   
Sbjct:    1 MPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLC 83          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WP23|BOLL_MACFA (Protein boule-like OS=Macaca fascicularis OX=9541 GN=BOLL PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 3.391e-29
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N9W6|BOLL_HUMAN (Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 3.636e-29
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q924M5|BOLL_MOUSE (Protein boule-like OS=Mus musculus OX=10090 GN=Boll PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 1.059e-28
Identity = 57/91 (62.64%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ+
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQ 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q24207|BOULE_DROME (Protein boule OS=Drosophila melanogaster OX=7227 GN=bol PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.145e-24
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ 
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20870|DAZ1_CAEEL (DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN=daz-1 PE=2 SV=3)

HSP 1 Score: 88.1965 bits (217), Expect = 2.612e-17
Identity = 48/108 (44.44%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRK---QKFLEQFYIMDPCLML 593
            P    LIPNRIFVGG  ++TTE EL+  F  +  +KDVK++    G SKG YGF+TFE ++ AE+I K   + L F+ RKLN+G A+RK     F   + I  P  ++
Sbjct:   59 PPTYELIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKG-YGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATPSQLV 165          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A172RVQ0 (Boule 1 RNA-binding protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 3.503e-84
Identity = 144/149 (96.64%), Postives = 145/149 (97.32%), Query Frame = 3
Query:  159 ILFFKQSTDSQLTPKVDTLAQEFQVSLXXXXXXXXXXXXXPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYIMDPCLMLYKMV 605
            I    +STDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYIMDPCLMLYKMV
Sbjct:    6 ISMIHRSTDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYIMDPCLMLYKMV 154          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A3P6SII3 (RRM domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2692 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 5.388e-42
Identity = 74/95 (77.89%), Postives = 86/95 (90.53%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQ 563
            PK GTLIPNRIFVGGI SNTTE+ELK +FSS+G +KDVKIINDR G++KGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ+   +
Sbjct:   14 PKFGTLIPNRIFVGGIPSNTTEQELKTYFSSFGQVKDVKIINDRLGVAKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQLFPR 108          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5K3F9R3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.169e-42
Identity = 78/112 (69.64%), Postives = 90/112 (80.36%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYIMDPCLMLYKMV*HC 614
            PK GTLIPNRIFVGGI SNTTE+ELK +FSS+G +KDVKIINDR G+SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ+   +   + P L        C
Sbjct:   38 PKFGTLIPNRIFVGGIPSNTTEQELKTYFSSFGQVKDVKIINDRLGVSKGSYGFVTFESQEVAEKIIKNESETLIFKDRKLNIGHAIRKQQLFPRPADVPPALFFAGGAIPC 149          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A564XYF3 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS987 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 7.136e-42
Identity = 77/103 (74.76%), Postives = 89/103 (86.41%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYIMDPCL 587
            PKIGTLIPNRIFVGGI SNTTE+ELK +FSS+G +KDVKIINDR G++KGSYGFVTFE QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ+   +   + P L
Sbjct:   38 PKIGTLIPNRIFVGGIPSNTTEQELKAYFSSFGQVKDVKIINDRLGVAKGSYGFVTFECQEVAEKIIKNESETLIFKDRKLNIGHAIRKQQLFPRPADVAPTL 140          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5K4EPW2 (Boule-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.331e-41
Identity = 75/93 (80.65%), Postives = 83/93 (89.25%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFL 557
            PK GTLIPNRIFVGGI SNT E+ELK FFSS+G +KDVKIINDR G SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ+  
Sbjct:   36 PKFGTLIPNRIFVGGIPSNTNEQELKSFFSSFGHVKDVKIINDRLGASKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQIF 128          

HSP 2 Score: 38.5058 bits (88), Expect = 2.331e-41
Identity = 15/36 (41.67%), Postives = 27/36 (75.00%), Query Frame = 2
Query:  542 KTEISGTVLYNG-PVPYALQNGLTLFQVPGQDYSVL 646
            + E++ T+L+ G  +PY+ QNG+ +F +PGQ+Y +L
Sbjct:  130 RPELTTTLLFTGSAIPYSFQNGMAVFPLPGQEYPIL 165          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000005184.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:7750630:7761219:-1 gene:ENSAMXG00000005058.2 transcript:ENSAMXT00000005184.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 8.302e-25
Identity = 49/87 (56.32%), Postives = 67/87 (77.01%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 548
            GT+IPNRIFVGGI     E +L+ FFS YG I++V I+ DR G+SKG YGFVTFE QE A+KI+ ++A+ L F+++++N+G A RKQ
Sbjct:   32 GTVIPNRIFVGGIGGKAKENDLRCFFSEYGVIREVNIVTDRDGISKG-YGFVTFETQEDAQKIL-HDADRLSFRDKRINVGQAFRKQ 116          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:103038434])

HSP 1 Score: 70.0922 bits (170), Expect = 2.201e-13
Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G L PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I++ +   + FK +KL +G A+ K++
Sbjct:   26 GKLTPNTLFVGGIDMKVEENEIRDFFARYGAVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVEQQ---ISFKGKKLKLGPAIMKER 109          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016054.2 (RNA binding motif protein 38 [Source:NCBI gene;Acc:103039930])

HSP 1 Score: 55.8398 bits (133), Expect = 1.815e-8
Identity = 29/86 (33.72%), Postives = 51/86 (59.30%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
            +IFVGG+  +T +  L+ +F +YG I +  +I DR TG S+G YGFVT  ++  AE+  K+    +  ++  +N+ +   K + L+
Sbjct:   27 KIFVGGLPYHTNDASLRKYFEAYGDIDEAVVITDRQTGKSRG-YGFVTMTDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQ 111          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:103027480])

HSP 1 Score: 54.6842 bits (130), Expect = 4.056e-8
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
             +IFVGG+  +TT+  L+ +F  +G I++  +I DR TG S+G YGFVT  ++  A++  K+    +  ++  +N+ +   K + ++
Sbjct:   11 TKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRG-YGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQ 96          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:103027480])

HSP 1 Score: 55.0694 bits (131), Expect = 4.749e-8
Identity = 27/87 (31.03%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
             +IFVGG+  +TT+  L+ +F  +G I++  +I DR TG S+G YGFVT  ++  A++  K+    +  ++  +N+ +   K + ++
Sbjct:   32 TKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRG-YGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQ 117          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 118.242 bits (295), Expect = 3.416e-30
Identity = 57/91 (62.64%), Postives = 74/91 (81.32%), Query Frame = 3
Query:  279 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            P+ GT+IPNRIFVGGI     E ELK +F+ +G +KDVKIINDR G+SKG YGFVTFE+QE A+K I+ EAE +++K++KLNIG A+RKQ+
Sbjct:   34 PRYGTVIPNRIFVGGIDFKVNEAELKKYFTQFGVVKDVKIINDRAGVSKG-YGFVTFESQEDAQK-IQQEAEKIMYKDKKLNIGPAIRKQQ 122          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 60.077 bits (144), Expect = 4.728e-10
Identity = 25/65 (38.46%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 500
            +IFVGGI  NT E+ L+ +FS YG ++ V ++ DR    K  +GFVTF + +  +K++  +  T+
Sbjct:  125 KIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTI 189          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 57.3806 bits (137), Expect = 7.791e-10
Identity = 24/65 (36.92%), Postives = 42/65 (64.62%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 500
            +IFVGGI  +T E+ L+ +F  YG ++  +++ DR+   K  +GFVTF + +T +K+I  +  T+
Sbjct:  101 KIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTI 165          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 57.7658 bits (138), Expect = 9.730e-10
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNI 527
             +IFVGG+  +TT+  L+ FF ++G I +  +I DR +G S+G YGFVT  ++ +AE+  K+     I   RK N+
Sbjct:   12 TKIFVGGLPYHTTDASLRAFFEAFGEIDEAVVITDRQSGKSRG-YGFVTMADRASAERACKD--PNPIIDGRKANV 84          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 57.3806 bits (137), Expect = 3.769e-9
Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  285 IGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVR 542
            +G   P ++FVGG+  +TTE+ L+  FS YG + DV ++ DR T LS+G + FVTF N E A K  + +A   + + R + +  A +
Sbjct:    1 MGEADPGKLFVGGLNIDTTEKALEATFSKYGRVADVLLMKDRETNLSRG-FAFVTFANPEDA-KEAERDANGKVLEGRAMRVDQATK 85          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 53.9138 bits (128), Expect = 3.521e-8
Identity = 29/78 (37.18%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHA 536
            +IFVGGI  +   +E + FFS +G I D +++ D+ TG S+G +GFVT+++ +  +++ +N+   + FK+RK+ I  A
Sbjct:  244 KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRG-FGFVTYDSADAVDRVCQNKF--IDFKDRKIEIKRA 318          

HSP 2 Score: 53.1434 bits (126), Expect = 5.986e-8
Identity = 23/62 (37.10%), Postives = 44/62 (70.97%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIIND-RTGLSKGSYGFVTFENQETAEKIIKNE 488
            ++F+GG+  +TTE+ L+ +F  YG + D+KI+ D  TG S+G +GF++FE   + ++++K +
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRG-FGFLSFEKPSSVDEVVKTQ 220          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 47.7506 bits (112), Expect = 2.616e-6
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 3
Query:  309 IFVGGITSNTTEEEL-KIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
            IFVG +  N TE +L ++F + Y      KI++D+ TG+SKG YGFV F N +  +++  +E + +    R + +G    +Q+ + 
Sbjct:  165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKG-YGFVKFTNSD-EQQLALSEMQGVFLNGRAIKVGPTSGQQQHVS 248          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: RIE1 (Putative RNA binding protein; localizes to stress granules induced by glucose deprivation; interacts with Rbg1p in a two-hybrid assay; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003482])

HSP 1 Score: 47.7506 bits (112), Expect = 3.023e-6
Identity = 26/67 (38.81%), Postives = 34/67 (50.75%), Query Frame = 3
Query:  282 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 482
            K     P  IFVGGI  + +  EL   FS YGPI  +K+I D+T      YGF+++     A   IK
Sbjct:  188 KHALTYPGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO40536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6X1])

HSP 1 Score: 81.6481 bits (200), Expect = 3.373e-18
Identity = 42/86 (48.84%), Postives = 61/86 (70.93%), Query Frame = 3
Query:  294 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIIND-RTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 548
            + P R+FVGG+   TTE EL+ FFS++GP+ DV+I+ D RTGL+KG +GF+TF  +E A+K+I  E   + FK R L +  A+RK+
Sbjct:   14 IYPTRVFVGGLARGTTELELETFFSNFGPVADVRIVCDRRTGLNKG-FGFITFSLEEPAKKLI--EQNNIDFKGRSLRLRQAIRKK 96          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO45185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC5])

HSP 1 Score: 78.5666 bits (192), Expect = 7.140e-17
Identity = 42/91 (46.15%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  300 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQFYI 572
            PNRIFVGG+   TT  EL+  F SYG ++DVKI  D  G+S+G YGFVTF   + A+K+ K    T+ +K ++L IG A RK +F    ++
Sbjct:    9 PNRIFVGGVAFQTTAIELRELFESYGAVRDVKIARDGEGVSRG-YGFVTFFRDDDAKKVFK--LGTVFYKGKRLVIGEAYRKLQFTYHSHV 96          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO43157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ6])

HSP 1 Score: 75.0998 bits (183), Expect = 1.015e-15
Identity = 39/88 (44.32%), Postives = 57/88 (64.77%), Query Frame = 3
Query:  285 IGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 548
            +G   PN+IFVGG+   TT EEL  FF+++G + + K+I D  G+SKG YGFV+F +QE    +      TL  + +KLN+G AV+K+
Sbjct:    7 LGKRYPNKIFVGGLPPLTTAEELANFFANFGHVVESKVIFDHDGISKG-YGFVSFRSQEDVSCV--KAMGTLFLRNKKLNLGPAVKKE 91          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO31802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW5])

HSP 1 Score: 65.0846 bits (157), Expect = 1.568e-13
Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  297 IPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAE 470
            I  RIFV G    TTE EL+ FF  YG +K+ KI+ D+ G+SKG Y F+TFE+QE A+
Sbjct:    6 ISKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKG-YAFITFESQEVAD 62          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 56.6102 bits (135), Expect = 1.753e-9
Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKE 512
            +IF+GG+  NTTEE LK +FS +G I D  +I  R G S+G +GFVT+E+ ++  +++K +   L  +E
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDC-VIMKRDGRSRG-FGFVTYESSDSVNEVLKKKDHVLDDRE 67          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: boll (boule homolog, RNA binding protein [Source:NCBI gene;Acc:100302724])

HSP 1 Score: 84.7297 bits (208), Expect = 2.296e-17
Identity = 41/88 (46.59%), Postives = 60/88 (68.18%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            GT+IPNRIFVGG+    TE  L   FS YG + +VKI+ +R+G+SKG YGFVTFE  E    I+ ++A  + ++++K +I  AV+K +
Sbjct:   35 GTIIPNRIFVGGVDYKVTENHLHHIFSHYGTVTEVKIVTNRSGMSKG-YGFVTFEAPEDVVNIL-SKANRICYRDKKFSISQAVQKSQ 120          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 64.6994 bits (156), Expect = 1.783e-11
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+K
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKEK 110          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 64.6994 bits (156), Expect = 1.783e-11
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+K
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKEK 110          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 64.3142 bits (155), Expect = 2.013e-11
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  288 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+K
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKEK 110          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbm24b (RNA-binding protein 24 [Source:NCBI gene;Acc:101161576])

HSP 1 Score: 54.6842 bits (130), Expect = 4.408e-8
Identity = 27/87 (31.03%), Postives = 53/87 (60.92%), Query Frame = 3
Query:  303 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE 560
             +IFVGG+  +TT+  L+ +F  +G I++  +I DR TG S+G YGFVT  ++ +A++  K+    +  ++  +N+ +   K + ++
Sbjct:   12 TKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRG-YGFVTMADRASADRACKDPNPIIDGRKANVNLAYLGAKPRVIQ 97          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000018666.1 (SMESG000018666.1)

HSP 1 Score: 226.098 bits (575), Expect = 2.166e-75
Identity = 124/129 (96.12%), Postives = 125/129 (96.90%), Query Frame = 3
Query:  177 STDSQLTPKVDTLAQEFQVSLXXXXXXXXXXXXXPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQ 563
            STDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ    +
Sbjct:    2 STDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPR 130          

HSP 2 Score: 76.6406 bits (187), Expect = 2.166e-75
Identity = 36/38 (94.74%), Postives = 37/38 (97.37%), Query Frame = 2
Query:  542 KTEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQ 655
            + EISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQ
Sbjct:  130 RQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQ 167          

HSP 3 Score: 131.339 bits (329), Expect = 3.571e-33
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
Query: 1183 SPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNXXXXXXXXXXXXWYTLAGLTAAPXXXXXXXXXXXXXXXAQTLRWAATTGSQ 1473
            SPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNGPGSAGSAAAAPWYTLAGLTAAPQSSSQISSNNSSNSIAQTLRWAATTGSQ
Sbjct:  168 SPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNGPGSAGSAAAAPWYTLAGLTAAPQSSSQISSNNSSNSIAQTLRWAATTGSQ 264          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 134.035 bits (336), Expect = 4.561e-35
Identity = 64/89 (71.91%), Postives = 73/89 (82.02%), Query Frame = 3
Query:  282 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 548
            KI TLIPNRIFVGG   NTTEEELK FF  YG IKDVKII D+ G +KGSYGFVTF +QE AE+II  +AETL+F++RKLNIG AV+KQ
Sbjct:   24 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQ 112          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.296e-25
Identity = 49/66 (74.24%), Postives = 53/66 (80.30%), Query Frame = 3
Query:  282 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKII 479
            KI TLIPNRIFVGG   NTTEEELK FF  YG IKDVKII D+ G +KGSYGFVTF +QE AE+II
Sbjct:   24 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERII 89          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 64.3142 bits (155), Expect = 4.682e-12
Identity = 35/83 (42.17%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            +IFVGG+  +TT+E L++FF  +GPI++  +I DR +G S+G YGFVT  N E A + I N    +    RK N+  A+   K
Sbjct:   35 KIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRG-YGFVTMVNCEDAYRAISNPNPCI--DGRKANVNLAILGAK 114          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.905e-11
Identity = 35/83 (42.17%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  306 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQK 551
            +IFVGG+  +TT+E L++FF  +GPI++  +I DR +G S+G YGFVT  N E A + I N    +    RK N+  A+   K
Sbjct:   35 KIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRG-YGFVTMVNCEDAYRAISNPNPCI--DGRKANVNLAILGAK 114          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL7.571e-3063.74boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL7.571e-3063.74boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL8.960e-3063.74boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL2.516e-2963.74boule homolog, RNA binding protein [Source:HGNC Sy... [more]
DAZL1.042e-1746.67deleted in azoospermia like [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daz-12.083e-1844.44DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
sup-121.574e-733.77SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
msi-12.166e-732.20MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
sup-125.329e-733.78SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
H28G03.15.916e-733.85pep chromosome:WBcel235:X:5216363:5219095:1 gene:W... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bol7.065e-2654.95gene:FBgn0011206 transcript:FBtr0076539[more]
bol7.065e-2654.95gene:FBgn0011206 transcript:FBtr0076541[more]
bol1.142e-2554.95gene:FBgn0011206 transcript:FBtr0076538[more]
bol1.142e-2554.95gene:FBgn0011206 transcript:FBtr0344979[more]
bol1.142e-2554.95gene:FBgn0011206 transcript:FBtr0076540[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl3.537e-1340.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl6.195e-1340.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl6.816e-1340.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl7.383e-1340.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl9.514e-1340.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl4.230e-1545.45deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
deup12.331e-837.68deuterosome assembly protein 1 [Source:Xenbase;Acc... [more]
rbm242.524e-832.18RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
nxph22.920e-833.33neurexophilin 2 [Source:Xenbase;Acc:XB-GENE-951506... [more]
hnrnpa2b11.071e-736.92heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Boll1.446e-3062.64boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll1.532e-2962.64boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll1.704e-2962.64boule homolog, RNA binding protein [Source:MGI Sym... [more]
Dazl9.096e-1846.67deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
Dazl4.614e-1747.13deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WP23|BOLL_MACFA3.391e-2963.74Protein boule-like OS=Macaca fascicularis OX=9541 ... [more]
sp|Q8N9W6|BOLL_HUMAN3.636e-2963.74Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL... [more]
sp|Q924M5|BOLL_MOUSE1.059e-2862.64Protein boule-like OS=Mus musculus OX=10090 GN=Bol... [more]
sp|Q24207|BOULE_DROME1.145e-2454.95Protein boule OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q20870|DAZ1_CAEEL2.612e-1744.44DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVQ03.503e-8496.64Boule 1 RNA-binding protein OS=Schmidtea mediterra... [more]
A0A3P6SII35.388e-4277.89RRM domain-containing protein (Fragment) OS=Diboth... [more]
A0A5K3F9R36.169e-4269.64Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564XYF37.136e-4274.76RRM domain-containing protein OS=Hymenolepis dimin... [more]
A0A5K4EPW22.331e-4180.65Boule-related OS=Schistosoma mansoni OX=6183 PE=4 ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005184.28.302e-2556.32pep primary_assembly:Astyanax_mexicanus-2.0:10:775... [more]
dazl2.201e-1342.05deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000016054.21.815e-833.72RNA binding motif protein 38 [Source:NCBI gene;Acc... [more]
rbm24a4.056e-831.03RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
rbm24a4.749e-831.03RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL3.416e-3062.64boule homolog, RNA binding protein [Source:HGNC Sy... [more]
HNRNPA04.728e-1038.46heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA07.791e-1036.92heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
rbm24a9.730e-1039.47RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
rbmx3.769e-937.93RNA binding motif protein X-linked [Source:NCBI ge... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HRP13.521e-837.18Subunit of cleavage factor I; cleavage factor I is... [more]
NAM82.616e-632.56RNA binding protein, component of the U1 snRNP pro... [more]
RIE13.023e-638.81Putative RNA binding protein; localizes to stress ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405363.373e-1848.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451857.140e-1746.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431571.015e-1544.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318021.568e-1353.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.753e-942.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boll2.296e-1746.59boule homolog, RNA binding protein [Source:NCBI ge... [more]
dazl1.783e-1146.59deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl1.783e-1146.59deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl2.013e-1146.59deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
rbm24b4.408e-831.03RNA-binding protein 24 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018666.12.166e-7596.12SMESG000018666.1[more]
SMESG000061507.14.561e-3571.91SMESG000061507.1[more]
SMESG000061507.14.296e-2574.24SMESG000061507.1[more]
SMESG000006741.14.682e-1242.17SMESG000006741.1[more]
SMESG000006741.11.905e-1142.17SMESG000006741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011677 ID=SMED30011677|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1524bp
AACCAATCAATGCTAAGGATTGAAAATTAGTGTGTATGCAAACAAAATGG
TAAGTCTTTGTTAAATTTCATAACTTTATTTATAATGAAATCAATCAATA
TCAGTATGATTCATCGCGTATCCTTAATTTTTTTATCAAAATTTAAAATC
TAACCGCCATTTTATTTTTTAAACAGTCAACTGATAGTCAACTTACGCCT
AAAGTAGATACACTAGCTCAAGAATTTCAAGTTTCACTTGCTGCTGTTAA
TCAAGCAACGATGACTGCTGCTGCAAACCCTAAAATCGGTACTCTGATAC
CAAATCGAATATTTGTTGGTGGAATCACGTCAAATACGACAGAAGAAGAA
TTGAAAATATTTTTTTCAAGTTACGGTCCAATTAAGGATGTTAAAATAAT
AAATGATCGTACTGGATTATCCAAAGGGAGTTATGGGTTTGTTACATTTG
AAAATCAAGAAACTGCTGAAAAAATAATCAAAAATGAAGCAGAAACACTG
ATATTTAAGGAACGGAAATTAAACATAGGACACGCTGTTAGAAAACAGAA
ATTTCTGGAACAGTTTTATATAATGGACCCGTGCCTTATGCTTTACAAAA
TGGTTTAACATTGTTCCAAGTTCCTGGACAAGACTATTCAGTTTTAGCGT
CACAAGTGAGTAATTTTAAAATTACATTTATCAATCTCTTTTATTAGCTT
TGATAATGTTTTGGCTACTTCAAGTTAAATTATAATCATTTCAAAAAATA
TGAAGAGAACGTAATAAAATATTCTTATGAAAAGTTCTTATTTTCAAAAT
TGGATAATTTTAAATAATGCCATGATCCAAATTGTCACATACTTTTTCAG
TTCCGAGCTTTAGTATTTTTACTTGATTTTGAGATCAAATGTCTCTTATA
AAAAATTCATTTGGGATTATTCGTGTTTTTCATAATCTTTTAGTTATTGA
ATAAATATACTTCTGATTTTAGATTCAGAAAATAAAAAAATTTGTAATAA
AGTAATAAACACGTAAGTCATTGCTTATAAAAAATCCCACACTGGTTCTT
TTAGAGTAACTAGGTAGATGCTCACTGTAGGAAAAAAACTACAAGTAGTG
CTTTTTATAGCTTACTCTACAGCATTCTTGAAATCGAAAAAATACGATAC
TGTTTCATTTTTTAAAAATCAAGTTTTATATTTCTCCTCAATACGCAACT
ATGATGTTACCTCAACCGACTACGGCTATGTATTTACCGCAACCACAATA
TGCTTATCAAACGCCTACTGCTGTGATTCCTTCCCCTAACAACGGACAAC
AAGTAACATTTACTCAAAACGGTCCTGGATCAGCAGGATCAGCAGCTGCT
GCACCATGGTACACTTTAGCTGGATTAACGGCAGCACCACAATCATCTTC
ACAAATTTCAAGCAACAATAGTTCAAATTCAATTGCTCAAACTTTAAGAT
GGGCGGCTACAACTGGATCACAAGTTTATAATATATTAAACATTTTAATC
TATTAGGTGCTTTAGAGTCCTCCG
back to top

protein sequence of SMED30011677-orf-1

>SMED30011677-orf-1 ID=SMED30011677-orf-1|Name=SMED30011677-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR
TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLE
QFYIMDPCLMLYKMV*
back to top

protein sequence of SMED30011677-orf-2

>SMED30011677-orf-2 ID=SMED30011677-orf-2|Name=SMED30011677-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNGPGSAGSAAA
APWYTLAGLTAAPQSSSQISSNNSSNSIAQTLRWAATTGSQVYNILNILI
Y*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 16..90
e-value: 1.5E-19
score: 81.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 17..78
e-value: 6.9E-19
score: 67.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 15..94
score: 16.261
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 9..103
e-value: 1.4E-25
score: 91.3
NoneNo IPR availablePANTHERPTHR11176:SF14PROTEIN BOULEcoord: 4..99
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 4..99
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 15..97