SMED30011669

Overview
NameSMED30011669
Smed IDSMED30011669
Length (bp)1565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011669 (SMED30011669) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011669 (SMED30011669) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30011669 (SMED30011669) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30011669 (SMED30011669) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011669

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011669SMESG000017098.1 Contig702GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011669SMESG000068935.1 Contig702GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30011669SMESG000068935.1 SmedASXL_009688SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30011669SMESG000068935.1 dd_Smed_v4_430_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011669SMESG000068935.1 dd_357dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30011669SMESG000068935.1 dd_Smed_v6_430_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011669SMESG000068935.1 OX_Smed_1.0.08964ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011669SMESG000068935.1 dd_Smed_v6_357_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011669SMESG000068935.1 dd_Smed_v4_430_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011669SMESG000068935.1 dd_Smed_v4_430_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011669SMESG000068935.1 dd_Smed_v4_430_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30011669SMESG000068935.1 dd_Smed_v4_430_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30011669 vs. Planmine SMEST
Match: SMESG000068935.1 (SMESG000068935.1)

HSP 1 Score: 493.426 bits (1269), Expect = 1.332e-173
Identity = 292/297 (98.32%), Postives = 292/297 (98.32%), Query Frame = 3
Query:   69 MKYFITLWFLICTSTSRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKISNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSMS--NGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVII 953
            MKYFITLWFLICTSTSRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKISNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLTTTALPASSATSVATSQITTLLTTTIIPKVPIVIGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM   NGSVKAVYTIEVAMNG MTDESLSNNFINATNSAYSS VII
Sbjct:    1 MKYFITLWFLICTSTSRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKISNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLTTTALPASSATSVATSQITTLLTTTIIPKVPIVIGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSMRFVNGSVKAVYTIEVAMNGAMTDESLSNNFINATNSAYSSVVII 297          

HSP 2 Score: 144.436 bits (363), Expect = 1.554e-38
Identity = 110/302 (36.42%), Postives = 165/302 (54.64%), Query Frame = 3
Query:  639 AQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSMSNGSVKAV--YTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXX------------------XXXXXXXXXXXXXXXXXXXXXKEDPV------KPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIINYLS--SGSVKADMTLNVASTSSLSTTDMQNTVTQAAQATYGSSIQI------------------FSISAKQTSAAPKTQSW 1406
            AQPGEYSAS+YLQ+ F+NR+YI +++NV+S ES++ FNEY  NI+S L + KIRVVSAV+  +SNGSV  +  Y +EVA+N TM   +L ++F N T S Y +AV+I+NST                      +++ TS    + TT    + P+      +PGE+S ++ +   F++ TY   +   TS   + F    +    ++L S  IR++  ++N +   +GSVKA  T+ VA   +++   + N    A  + Y S + I                   +ISAKQTSAAPKTQSW
Sbjct:   31 AQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKISNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLTTTALPASSATSVATSQITTLLTTTIIPKVPIVIGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSMRFVNGSVKAVYTIEVAMNGAMTDESLSNNFINATNSAYSSVVIITNSTVLQTSTLVTSTTAPITISAKQTSAAPKTQSW 332          

HSP 3 Score: 111.694 bits (278), Expect = 8.015e-27
Identity = 64/128 (50.00%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  138 PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVIT--KISNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLV 515
            P+ +   AQPGEYSAS+YLQ+ F+NR+YI +++NV+S ES++ FNEY  NI+S L + KIRVVSAV+   +  NGSV  +  Y +EVA+N  M   +L ++F N T S Y + V+I+NST+L+  TLV
Sbjct:  184 PIVIGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSMRFVNGSVKAV--YTIEVAMNGAMTDESLSNNFINATNSAYSSVVIITNSTVLQTSTLV 309          
BLAST of SMED30011669 vs. Planmine SMEST
Match: SMESG000068971.1 (SMESG000068971.1)

HSP 1 Score: 373.244 bits (957), Expect = 1.613e-119
Identity = 227/472 (48.09%), Postives = 290/472 (61.44%), Query Frame = 3
Query:  138 PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAV---------IIXXXXXXXXXXXXXXXXXXXXXXXXXK----EDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIINYLSSGSVKADMTLNVASTSSLSTTDMQNTVTQAAQATYGSSIQIFSISAKQTSAAPKTQSW 1406
            P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +A          I+ + T++  +   T +    T+   T     EDP +  E SY + + CSFTDETYYDDYKTPTS RYI+FK R H KWKAAL  + +RLIEIIIN LSSGSVKADM +N+AS SS+ST D+QNTVTQAAQA YGSS+Q+FSI+A    A+   QSW
Sbjct:  395 PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTACNYNNYFLATILKSPTLVAANQTTTVSLTATTSLPITTLSIIEDPPRKNERSYKIIIKCSFTDETYYDDYKTPTSARYINFKARHHAKWKAALIFKLLRLIEIIINSLSSGSVKADMEMNIASNSSISTADLQNTVTQAAQAAYGSSLQVFSITATSLDASSTDQSW 835          

HSP 2 Score: 216.468 bits (550), Expect = 3.338e-61
Identity = 152/407 (37.35%), Postives = 210/407 (51.60%), Query Frame = 3
Query:  114 SRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISN-STILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            S T   + P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+N   IL  P                                            AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITN   +                     +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  119 SPTLVAARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFILNNP--------------------------------------------AQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFIL-------------------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 462          

HSP 3 Score: 206.453 bits (524), Expect = 1.451e-57
Identity = 143/378 (37.83%), Postives = 201/378 (53.17%), Query Frame = 3
Query:  198 LNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTLV A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITN   +                     +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:    1 MTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLVAAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFIL-------------------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 328          
BLAST of SMED30011669 vs. Planmine SMEST
Match: SMESG000068971.1 (SMESG000068971.1)

HSP 1 Score: 373.244 bits (957), Expect = 1.669e-119
Identity = 227/472 (48.09%), Postives = 290/472 (61.44%), Query Frame = 3
Query:  138 PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAV---------IIXXXXXXXXXXXXXXXXXXXXXXXXXK----EDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIINYLSSGSVKADMTLNVASTSSLSTTDMQNTVTQAAQATYGSSIQIFSISAKQTSAAPKTQSW 1406
            P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +A          I+ + T++  +   T +    T+   T     EDP +  E SY + + CSFTDETYYDDYKTPTS RYI+FK R H KWKAAL  + +RLIEIIIN LSSGSVKADM +N+AS SS+ST D+QNTVTQAAQA YGSS+Q+FSI+A    A+   QSW
Sbjct:  407 PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTACNYNNYFLATILKSPTLVAANQTTTVSLTATTSLPITTLSIIEDPPRKNERSYKIIIKCSFTDETYYDDYKTPTSARYINFKARHHAKWKAALIFKLLRLIEIIINSLSSGSVKADMEMNIASNSSISTADLQNTVTQAAQAAYGSSLQVFSITATSLDASSTDQSW 847          

HSP 2 Score: 231.876 bits (590), Expect = 1.271e-66
Identity = 162/398 (40.70%), Postives = 225/398 (56.53%), Query Frame = 3
Query:  138 PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITNST+L++ TL  +    +        +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  261 PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIARPFIL-------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 620          

HSP 3 Score: 216.853 bits (551), Expect = 2.686e-61
Identity = 157/407 (38.57%), Postives = 219/407 (53.81%), Query Frame = 3
Query:  114 SRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISN-STILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            S T   + P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+N   IL  P                                            AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITNST+L++ TL  +    +        +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  119 SPTLVAARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFILNNP--------------------------------------------AQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIARPFIL-------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 474          

HSP 4 Score: 206.453 bits (524), Expect = 1.247e-57
Identity = 143/378 (37.83%), Postives = 201/378 (53.17%), Query Frame = 3
Query:  198 LNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTLV A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITN   +                     +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:    1 MTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLVAAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFIL-------------------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 328          
BLAST of SMED30011669 vs. Planmine SMEST
Match: SMESG000068971.1 (SMESG000068971.1)

HSP 1 Score: 357.451 bits (916), Expect = 1.080e-113
Identity = 220/473 (46.51%), Postives = 281/473 (59.41%), Query Frame = 3
Query:  138 PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISN-STILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAV---------IIXXXXXXXXXXXXXXXXXXXXXXXXXK----EDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIINYLSSGSVKADMTLNVASTSSLSTTDMQNTVTQAAQATYGSSIQIFSISAKQTSAAPKTQSW 1406
            P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+N   IL  P                                            AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +A          I+ + T++  +   T +    T+   T     EDP +  E SY + + CSFTDETYYDDYKTPTS RYI+FK R H KWKAAL  + +RLIEIIIN LSSGSVKADM +N+AS SS+ST D+QNTVTQAAQA YGSS+Q+FSI+A    A+   QSW
Sbjct:  395 PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFILNNP--------------------------------------------AQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTACNYNNYFLATILKSPTLVAANQTTTVSLTATTSLPITTLSIIEDPPRKNERSYKIIIKCSFTDETYYDDYKTPTSARYINFKARHHAKWKAALIFKLLRLIEIIINSLSSGSVKADMEMNIASNSSISTADLQNTVTQAAQAAYGSSLQVFSITATSLDASSTDQSW 823          

HSP 2 Score: 216.468 bits (550), Expect = 3.424e-61
Identity = 152/407 (37.35%), Postives = 210/407 (51.60%), Query Frame = 3
Query:  114 SRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISN-STILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            S T   + P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+N   IL  P                                            AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITN   +                     +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  119 SPTLVAARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFILNNP--------------------------------------------AQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFIL-------------------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 462          

HSP 3 Score: 206.068 bits (523), Expect = 1.603e-57
Identity = 143/378 (37.83%), Postives = 201/378 (53.17%), Query Frame = 3
Query:  198 LNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTLV A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITN   +                     +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:    1 MTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLVAAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYKYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNWPFIL-------------------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 328          
BLAST of SMED30011669 vs. Planmine SMEST
Match: SMESG000067845.1 (SMESG000067845.1)

HSP 1 Score: 231.876 bits (590), Expect = 8.990e-68
Identity = 166/413 (40.19%), Postives = 231/413 (55.93%), Query Frame = 3
Query:  111 TSRTEAQSP------PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            T+ T  +SP      P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITNST+L++ TL  +    +        +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  112 TNSTILKSPTLEIARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIARPFIL-------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 486          

HSP 2 Score: 229.565 bits (584), Expect = 6.522e-67
Identity = 166/413 (40.19%), Postives = 228/413 (55.21%), Query Frame = 3
Query:  111 TSRTEAQSP------PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            T+ T  +SP      P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITNST+L++ TL               E   +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:  258 TNSTILKSPTLEIARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTL---------------EIATQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 624          

HSP 3 Score: 220.32 bits (560), Expect = 1.506e-63
Identity = 142/323 (43.96%), Postives = 185/323 (57.28%), Query Frame = 3
Query:  111 TSRTEAQSP------PVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVII 953
            T+ T  +SP      P  L+NPAQPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL                                        +A QPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVII
Sbjct:  404 TNSTILKSPTLEIARPFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTL---------------------------------------EIATQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVII 687          

HSP 4 Score: 202.216 bits (513), Expect = 6.026e-57
Identity = 147/378 (38.89%), Postives = 209/378 (55.29%), Query Frame = 3
Query:  198 LNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKIS-----------------NGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVGANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAAQPGEYSASLYLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVVNSM-------------------SNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIIXXXXXXXXXXXXXXXXXXXXXXXXXKEDPVKPGEHSYAVAMICSFTDETYYDDYKTPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIIN 1223
            + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL  A                                P ++   AQPGEYSAS+ L + F+NR+YIQAF NV S E+ +FFNEYYRNI+S L+  KIR+ SAV+NSM                   ++  + +  ++E+A++ TM  E+L+++F N T + + +AVIITNST+L++ TL  +    +        +P +PGE+S ++ ++ +F + +Y   +    SP   +F    +    + L    IR+   +IN
Sbjct:    1 MTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIAR-------------------------------PFILNNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTLEIARPFIL-------NNPAQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVIN 340          

HSP 5 Score: 138.272 bits (347), Expect = 1.756e-34
Identity = 82/151 (54.30%), Postives = 100/151 (66.23%), Query Frame = 3
Query:  111 TSRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRSYIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKI-----------------SNGSVFILSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTL 512
            T+ T  +SP + ++   QPGEYSASI L + F NRSYI ++ NV SPE+ N FNEY  NISSGL  YKIR+ SAVI  +                  N S  I S+  LE+AI+ATMDS TL SSFNNVTF+V+MTAV+I+NSTILK PTL
Sbjct:  550 TNSTILKSPTLEIA--TQPGEYSASINLLMTFANRSYIQAFDNVFSPETANFFNEYYRNISSGLLLYKIRIASAVINSMRFVYNYNIYIDFMDKNYRNASADIYSNISLELAISATMDSETLTSSFNNVTFTVFMTAVIITNSTILKSPTL 698          
The following BLAST results are available for this feature:
BLAST of SMED30011669 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011669 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068935.11.332e-17398.32SMESG000068935.1[more]
SMESG000068971.11.613e-11948.09SMESG000068971.1[more]
SMESG000068971.11.669e-11948.09SMESG000068971.1[more]
SMESG000068971.11.080e-11346.51SMESG000068971.1[more]
SMESG000067845.18.990e-6840.19SMESG000067845.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011669 ID=SMED30011669|Name=SMED30011669|organism=Schmidtea mediterranea sexual|type=transcript|length=1565bp
GTGGACGGCAACTGTATAAAAGGTGAAGCTTGACCAAGTTTTTTCAATTT
TGAATCAGTTTTATAATAATGAAATATTTCATAACTCTTTGGTTTCTCAT
CTGTACATCAACATCGCGTACAGAAGCACAAAGTCCACCCGTTAATCTAA
GTAATCCGGCCCAGCCGGGTGAATATTCCGCTTCCATCTATTTGCAACTG
AATTTCACAAATCGTTCATATATTGCATCATATGCCAATGTCTCTTCACC
GGAATCCCTTAATTTATTTAATGAATATAACGCAAATATCAGTTCAGGTT
TATCAGCGTATAAAATCCGAGTTGTCAGTGCTGTGATTACCAAAATAAGT
AATGGAAGTGTATTTATACTCTCGGATTATATTCTCGAGGTCGCGATCAA
CGCTACAATGGACAGTGCGACTTTGGTTAGTTCCTTCAACAATGTCACAT
TTTCTGTGTATATGACTGCGGTAGTTATTAGTAATTCAACGATCTTGAAA
GAACCAACATTAGTGGGAGCGAATCTAACAACTACAGCACTTCCTGCATC
ATCAGCAACGAGCGTAGCAACAAGTCAAATTACAACTCTTCTTACAACCA
CGATCATACCAAAAGTCCCGATTGTCATTGGTATGGCGGCCCAGCCGGGG
GAATATTCCGCCTCGCTCTACTTGCAAATTTTATTCTCAAATCGGACATA
TATTCAAGCATTTTCCAATGTCACTTCATCGGAATCTGTGAGTTTCTTCA
ATGAATATTACAGAAATATCAATTCAAGTTTAATGTCGAATAAAATCCGA
GTCGTCAGTGCTGTGGTTAACTCAATGAGTAACGGAAGTGTAAAAGCTGT
TTATACTATCGAGGTCGCGATGAATGGTACAATGACCGACGAAAGTTTGT
CAAATAATTTCATCAACGCCACAAATTCTGCGTATTCGTCTGCTGTAATA
ATTACTAATTCTACGGTCTTGCAAACTTCAACTTTAGTGACAAGTACAAC
AGCTCCTATAACAACAACTATATCAACTAAAGAAGATCCTGTAAAACCAG
GGGAACATTCCTACGCAGTTGCTATGATATGTTCATTTACAGATGAAACA
TATTATGATGACTATAAAACTCCGACCTCCCCAAGATATATTGACTTTAA
AGGGAGGACTCATGTGAAATGGAAAGCGGCCCTTAGTTCGAGATATATAA
GATTGATAGAAATTATTATCAACTACCTATCTTCAGGAAGTGTAAAAGCC
GACATGACATTGAATGTTGCATCCACTTCATCTCTCTCAACTACTGATAT
GCAAAATACAGTAACGCAGGCAGCCCAAGCCACCTATGGTAGCAGTATCC
AAATATTTTCAATATCGGCTAAACAAACGAGTGCTGCACCAAAAACTCAA
TCGTGGTTAGCCGCTGCTGTCCTTGTTCCGGTTGTCGTGGTCATCGTTGG
ATTAGATTAACACTTATTTATTTCATTTTAATCAGGATTTTTACAACATT
ATCATTACATTTGTCTTAGTATTTCAATAAAAACTTTTTAGTGTGATTAA
ATTTGTTTCTTCATC
back to top

protein sequence of SMED30011669-orf-1

>SMED30011669-orf-1 ID=SMED30011669-orf-1|Name=SMED30011669-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MKYFITLWFLICTSTSRTEAQSPPVNLSNPAQPGEYSASIYLQLNFTNRS
YIASYANVSSPESLNLFNEYNANISSGLSAYKIRVVSAVITKISNGSVFI
LSDYILEVAINATMDSATLVSSFNNVTFSVYMTAVVISNSTILKEPTLVG
ANLTTTALPASSATSVATSQITTLLTTTIIPKVPIVIGMAAQPGEYSASL
YLQILFSNRTYIQAFSNVTSSESVSFFNEYYRNINSSLMSNKIRVVSAVV
NSMSNGSVKAVYTIEVAMNGTMTDESLSNNFINATNSAYSSAVIITNSTV
LQTSTLVTSTTAPITTTISTKEDPVKPGEHSYAVAMICSFTDETYYDDYK
TPTSPRYIDFKGRTHVKWKAALSSRYIRLIEIIINYLSSGSVKADMTLNV
ASTSSLSTTDMQNTVTQAAQATYGSSIQIFSISAKQTSAAPKTQSWLAAA
VLVPVVVVIVGLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis