slc1a-5

Overview
Nameslc1a-5 (AKN21395.1)
Smed IDSMED30011663
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc1a-5 (SMED30011663) t-SNE clustered cells

Violin plots show distribution of expression levels for slc1a-5 (SMED30011663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc1a-5 (SMED30011663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc1a-5 (SMED30011663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30011663SMESG000064126.1 SmedASXL_011779SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30011663SMESG000064126.1 dd_Smed_v4_1106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011663SMESG000064126.1 dd_Smed_v4_1106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30011663SMESG000064126.1 dd_Smed_v6_1106_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011663SMESG000064126.1 dd_Smed_v6_1106_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30011663SMESG000064126.1 dd_Smed_v6_1106_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc1a-5 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 498.819 bits (1283), Expect = 3.461e-171
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   35 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 501          
BLAST of slc1a-5 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 498.819 bits (1283), Expect = 3.461e-171
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   35 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 501          
BLAST of slc1a-5 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 499.204 bits (1284), Expect = 3.549e-171
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   41 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 507          
BLAST of slc1a-5 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 499.204 bits (1284), Expect = 4.789e-171
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   41 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 507          
BLAST of slc1a-5 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 498.819 bits (1283), Expect = 4.880e-171
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   35 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 501          
BLAST of slc1a-5 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 511.916 bits (1317), Expect = 1.500e-177
Identity = 268/452 (59.29%), Postives = 347/452 (76.77%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFI--------NVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            + N+L+ LT++SVVLG   G LL+ +  +S + +  I FPGE+LM+MLKM+I+PLI+SSLI+GL+ LDA+ SGK+G  A+ YY+ TT +AV+ GI LV+ IHPG+P IKK +G G+  +     T+D  LDL+RN+ P N+++A F+Q QT Y+       +N     +        +  K  + +    NVLG++ F IA G+ L Q+G+EA +M +FF ++++V+MKLV  +MWYSP GIF LI+GKILEI DLA+TA  L MYMVTVL GL IH  I+L LIFFV T+KNP+V+  G+ QAW+TALGTASSSATLPITF CLEEN GVD+RVTRFVLP+GATINMDGTALYEAVA+IFIAQING++LSFGQ+ T+S+TATLA+IGAASVPSAGLVTM+LVLT+VGLP+ D++LI+AVDWLLDR+RTSINVLGDA GAGIV H  K  L+
Sbjct:    6 RKNLLLVLTVSSVVLGALCGFLLRGLQ-LSPQNIMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGT--EGKTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 454          
BLAST of slc1a-5 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 511.531 bits (1316), Expect = 3.134e-177
Identity = 271/469 (57.78%), Postives = 354/469 (75.48%), Query Frame = 1
Query:  202 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFI--------NVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            M P   +  +++  +  K N+L+ LT++SVVLG   G LL+ +  +S + +  I FPGE+LM+MLKM+I+PLI+SSLI+GL+ LDA+ SGK+G  A+ YY+ TT +AV+ GI LV+ IHPG+P IKK +G G+  +     T+D  LDL+RN+ P N+++A F+Q QT Y+       +N     +        +  K  + +    NVLG++ F IA G+ L Q+G+EA +M +FF ++++V+MKLV  +MWYSP GIF LI+GKILEI DLA+TA  L MYMVTVL GL IH  I+L LIFFV T+KNP+V+  G+ QAW+TALGTASSSATLPITF CLEEN GVD+RVTRFVLP+GATINMDGTALYEAVA+IFIAQING++LSFGQ+ T+S+TATLA+IGAASVPSAGLVTM+LVLT+VGLP+ D++LI+AVDWLLDR+RTSINVLGDA GAGIV H  K  L+
Sbjct:    1 MPPDTRINKEIMVSWIRK-NLLLVLTVSSVVLGALCGFLLRGLQ-LSPQNIMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGT--EGKTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 465          
BLAST of slc1a-5 vs. Ensembl Celegans
Match: glt-5 (Amino acid transporter [Source:UniProtKB/TrEMBL;Acc:O18210])

HSP 1 Score: 417.157 bits (1071), Expect = 1.574e-140
Identity = 228/441 (51.70%), Postives = 316/441 (71.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            N+L+ +T+A +V+G+ +G +L+  A  S   +  +GFPGE+ MNMLK +++PLI +S+++GLS LD K+SG++G  A++YY +TT  AVILGII+V  I PG+P IK+ +G     +  +      FLDL RN  P N++ A F Q QTNY+ +    + NG    +  T  V    +  NVLG++ F I  GL++ ++G+EA+ +   F  L+ V+ ++V LIMW  PIGI  LI  K+LE+ DL  TA  LG+++ TV+LGL I   ITL LI+F+ TR NP+ +  G+ QA +TALGT+SS+A+LP+TF+CL +  G+D RVT+FVLP+GA +NMDGTALYEA ASIFIAQ+NG+ LS GQI T+SITATLA+IGAAS+PSAGLVTM++VLT++GLP NDI+LILAVDW LDR+RTS+NV+GDA G G V H+C   L
Sbjct:   19 NMLLLMTMAGIVMGVIIGGVLR-TADPSPDVIRYVGFPGELFMNMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGDPTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQT---HSNGATHEVLHTGYV----DGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPIGIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKGLGQAIMTALGTSSSAASLPVTFRCLNKL-GIDPRVTKFVLPVGAMVNMDGTALYEATASIFIAQMNGLELSIGQIVTVSITATLASIGAASIPSAGLVTMLIVLTALGLPANDISLILAVDWFLDRLRTSVNVIGDALGCGFVHHICADHL 450          
BLAST of slc1a-5 vs. Ensembl Celegans
Match: glt-6 (Putative sodium-dependent excitatory amino acid transporter glt-6 [Source:UniProtKB/Swiss-Prot;Acc:Q21751])

HSP 1 Score: 405.216 bits (1040), Expect = 4.529e-135
Identity = 221/463 (47.73%), Postives = 326/463 (70.41%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKK---SLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVT-KLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGE 1629
            ++N L+ +T+ SV LG+ +G  L+ +  +S   + LI FPGE+ M +LKM+I+PLI SSLI+ L+ +DAK SG+MG   ++YY+ T ++A ILGI LV  IHPG+P+IK    S  P       +   LD FLDL+RN+ P N+I+A F + QT YV  + +   +NGT   I + K  I   +  N+LG++ F   FG+++ Q+G+ ARI+ +FF +L+ V+M+ V  +MW++P+GI  LI G +LE+ D+++ AS L +Y+ TV  GL +H  IT+ L++F  TR+NP   F GM+QA VTA GTAS  ATLP++ +CLE++ GVD+R++RFVLP+G+TINMDG ALYEAVA IFIAQ+N + LS  ++ T+SITAT+A+IG  SVP AGLV+++L+L +VGLP+ D++++  VDWLLDRVRT++NVLGDAF A +V HL +K+L++    ++     +GE
Sbjct:   14 RENTLLVMTMFSVFLGVVLGFGLRPL-NLSQETLQLINFPGEIFMQVLKMMILPLIFSSLISALAQMDAKESGQMGASTVLYYLSTAVLATILGIFLVTVIHPGDPSIKGTDISEAPSD----GNVSPLDTFLDLVRNMFPENIIQATFERMQTTYVAIRPKIASKNGTSGNI-IVKRSIGMTKGMNILGIIVFCTGFGIVISQLGERARIVVDFFVILDAVIMRWVVTLMWFAPLGITCLICGNLLELDDISDIASVLALYVFTVCAGLILHTIITVPLMYFFITRENPLPIFKGMIQAAVTAFGTASGGATLPMSMQCLEDHCGVDRRISRFVLPLGSTINMDGNALYEAVAVIFIAQLNNVQLSLAEVLTVSITATIASIGLGSVP-AGLVSILLILNTVGLPVRDVSMLFTVDWLLDRVRTAVNVLGDAFAASMVQHLLQKKLDQADARHDYKTELKGE 469          
BLAST of slc1a-5 vs. Ensembl Celegans
Match: glt-3 (Putative sodium-dependent excitatory amino acid transporter glt-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21353])

HSP 1 Score: 393.275 bits (1009), Expect = 1.316e-130
Identity = 224/455 (49.23%), Postives = 317/455 (69.67%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQEST-----NVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDN 1602
            K ++L+ LTI SVVLG+ +G +++     +D  + LIGFPGE+ M +++M+I+PLI+SS+I+ L+ + A+ + ++G+  I+YY++TT +A   GIILV +IHPG+P +   LG G++     +         IRN+ P N+I+A F+Q QT Y+        N T   +N+T  V++ Q  T     NVLGL+ F   FG+IL  +G +AR+M  FF VL+ ++M+ +  +MW  PIGI  L+   I++I +L  TA +L MY+VTV+ GL IH  +TL L++F+ T+K+PF +  GMLQA  TA GTASS ATLP+TF+ LEEN  +D+RVTRFVLP+GATI MDGTALYEAVA IFIAQ++ I LS   + TISIT T+A+IG+ SVP AGL T+++VLT+VGLP  D++L+L VDWLLDR+RTS+NVLGD+FGAGI+ HL +  L E  TD 
Sbjct:    4 KKDLLLVLTIESVVLGVVLGFVIRPFNPSND-TISLIGFPGEIFMQIVEMMILPLIMSSVISALAQVRARDARRIGIVTIIYYMITTFLATFTGIILVSSIHPGDPELIHELGEGTLENTALSTLDTFLDQ-IRNMFPENIIQATFQQVQTEYMPIKPSRVRNATS--MNMTSEVLHKQTLTYTNEMNVLGLIVFCSGFGIILSILGDQARLMINFFIVLDAIIMRWISALMWCYPIGILSLVCKNIIDIDNLTETAQALAMYVVTVICGLMIHSLLTLPLLYFLVTKKSPFAFMTGMLQALATAFGTASSGATLPVTFRALEENLKIDRRVTRFVLPLGATITMDGTALYEAVAVIFIAQLHNIKLSLMDLVTISITTTVASIGSGSVP-AGLDTIVIVLTTVGLPAKDLSLLLTVDWLLDRIRTSVNVLGDSFGAGIIHHLTRSSLLEADTDE 453          
BLAST of slc1a-5 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079800)

HSP 1 Score: 350.132 bits (897), Expect = 1.647e-114
Identity = 206/450 (45.78%), Postives = 292/450 (64.89%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLK-FVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVIN------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            ++NVL   T+  V +G  +G ++K      S R++  I FPGE+ + MLK LI+PL+VSS+ + + GLD   S K+   AI YY VTT+ AVILGI LV  + PG           S+ K +   T D  +DL+RN+   N+I++   Q +T         YEN +   I+  + + N       +E +NVLGLV FS+  G  +G+M ++ +++ +FF  L+E +M +   ++W SP+G+ FLI  KI+E++ +A T  SLG Y +TV++GL +HG  T+ +IFF+ TR+ P+ Y   + Q   TA GT SSSAT+P+T KCL+ N G+D RVTRFV+P+GATINMDGTALYEAVA++FIAQ   +  SFG I  +SITAT A+IGAA +P AGLVTM++VL +VGL   D++LI+AVDWLLDR RT+INV+ DA G  +V+HL K  L
Sbjct:   16 QENVLTMATVIGVFVGGLIGFIIKNSTGEWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRT-------EIYENTS---ISPAQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDL 454          
BLAST of slc1a-5 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079801)

HSP 1 Score: 350.132 bits (897), Expect = 1.647e-114
Identity = 206/450 (45.78%), Postives = 292/450 (64.89%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLK-FVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVIN------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            ++NVL   T+  V +G  +G ++K      S R++  I FPGE+ + MLK LI+PL+VSS+ + + GLD   S K+   AI YY VTT+ AVILGI LV  + PG           S+ K +   T D  +DL+RN+   N+I++   Q +T         YEN +   I+  + + N       +E +NVLGLV FS+  G  +G+M ++ +++ +FF  L+E +M +   ++W SP+G+ FLI  KI+E++ +A T  SLG Y +TV++GL +HG  T+ +IFF+ TR+ P+ Y   + Q   TA GT SSSAT+P+T KCL+ N G+D RVTRFV+P+GATINMDGTALYEAVA++FIAQ   +  SFG I  +SITAT A+IGAA +P AGLVTM++VL +VGL   D++LI+AVDWLLDR RT+INV+ DA G  +V+HL K  L
Sbjct:   16 QENVLTMATVIGVFVGGLIGFIIKNSTGEWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRT-------EIYENTS---ISPAQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDL 454          
BLAST of slc1a-5 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0303876)

HSP 1 Score: 350.132 bits (897), Expect = 1.647e-114
Identity = 206/450 (45.78%), Postives = 292/450 (64.89%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLK-FVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVIN------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            ++NVL   T+  V +G  +G ++K      S R++  I FPGE+ + MLK LI+PL+VSS+ + + GLD   S K+   AI YY VTT+ AVILGI LV  + PG           S+ K +   T D  +DL+RN+   N+I++   Q +T         YEN +   I+  + + N       +E +NVLGLV FS+  G  +G+M ++ +++ +FF  L+E +M +   ++W SP+G+ FLI  KI+E++ +A T  SLG Y +TV++GL +HG  T+ +IFF+ TR+ P+ Y   + Q   TA GT SSSAT+P+T KCL+ N G+D RVTRFV+P+GATINMDGTALYEAVA++FIAQ   +  SFG I  +SITAT A+IGAA +P AGLVTM++VL +VGL   D++LI+AVDWLLDR RT+INV+ DA G  +V+HL K  L
Sbjct:   16 QENVLTMATVIGVFVGGLIGFIIKNSTGEWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRT-------EIYENTS---ISPAQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDL 454          
BLAST of slc1a-5 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079802)

HSP 1 Score: 350.132 bits (897), Expect = 1.647e-114
Identity = 206/450 (45.78%), Postives = 292/450 (64.89%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLK-FVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVIN------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            ++NVL   T+  V +G  +G ++K      S R++  I FPGE+ + MLK LI+PL+VSS+ + + GLD   S K+   AI YY VTT+ AVILGI LV  + PG           S+ K +   T D  +DL+RN+   N+I++   Q +T         YEN +   I+  + + N       +E +NVLGLV FS+  G  +G+M ++ +++ +FF  L+E +M +   ++W SP+G+ FLI  KI+E++ +A T  SLG Y +TV++GL +HG  T+ +IFF+ TR+ P+ Y   + Q   TA GT SSSAT+P+T KCL+ N G+D RVTRFV+P+GATINMDGTALYEAVA++FIAQ   +  SFG I  +SITAT A+IGAA +P AGLVTM++VL +VGL   D++LI+AVDWLLDR RT+INV+ DA G  +V+HL K  L
Sbjct:   16 QENVLTMATVIGVFVGGLIGFIIKNSTGEWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRT-------EIYENTS---ISPAQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDL 454          
BLAST of slc1a-5 vs. Ensembl Fly
Match: Eaat2 (gene:FBgn0026438 transcript:FBtr0078043)

HSP 1 Score: 308.145 bits (788), Expect = 3.592e-97
Identity = 192/464 (41.38%), Postives = 303/464 (65.30%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTK---LEHFYE----------NGTKVFINVTKIV-----INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
             +N+++ +T++ V+LG+ +GL L+ +    D  + LI +PGE+ M +LK++I+PL++SSLI G + L+AK +GK+ L  +VY+  T+     LGI LV+ IHPGNP++  +    +  +  +       L   RN+ P NL +A  +Q+ T Y+ K   L  F E             ++  ++T+ V     I ++  TN LG+V F + FG  LG +G++ +++ +FF  + EV+MK+V  +MW +P+GI  +I GKIL + DL    S L  ++VTV +G+ I+  + +  I+FV  R+NPF ++ G++QA +TA  TAS++A LPITF+C+ E   VD R+TRFVLPIG  INMDGTALY AVASIFIAQ++G+ L FG++ T+ +T+T A++ +ASVPSA LV +++VLT++  P+ D+TL+ AVDW +DR+RT+ N+LGD + A +V+ L +K+L  L
Sbjct:   31 SENLMLLVTLSGVLLGVILGLSLRPLNLHGD-SIMLISYPGELFMRVLKLMILPLVISSLIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLIHPGNPDLHNADDRSTDRRAVNLLDSLLDLG--RNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRLSEDLTEDVVLVRDIQYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKELMAL 491          
BLAST of slc1a-5 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 510.76 bits (1314), Expect = 1.839e-176
Identity = 273/464 (58.84%), Postives = 356/464 (76.72%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLE-------------HFYENGTK---VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V++G   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A +LG+ILV+ IHPGNP +K++LG G   +  +  +LDAF DLIRNL P NL++ACF+Q QT  V K+E              +  N TK   +F +  K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M +FF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+ L
Sbjct:   32 KMRKNLLLTLTVMGVIMGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG--LENDEVSSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPDLDDTNSTMSEYLSNATKPPPIFKD--KKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDAL 490          
BLAST of slc1a-5 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 510.76 bits (1314), Expect = 5.615e-176
Identity = 273/464 (58.84%), Postives = 356/464 (76.72%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLE-------------HFYENGTK---VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V++G   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A +LG+ILV+ IHPGNP +K++LG G   +  +  +LDAF DLIRNL P NL++ACF+Q QT  V K+E              +  N TK   +F +  K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M +FF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+ L
Sbjct:   31 KMRKNLLLTLTVMGVIMGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG--LENDEVSSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPDLDDTNSTMSEYLSNATKPPPIFKD--KKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDAL 489          
BLAST of slc1a-5 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 510.76 bits (1314), Expect = 6.064e-176
Identity = 273/464 (58.84%), Postives = 356/464 (76.72%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLE-------------HFYENGTK---VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V++G   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A +LG+ILV+ IHPGNP +K++LG G   +  +  +LDAF DLIRNL P NL++ACF+Q QT  V K+E              +  N TK   +F +  K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M +FF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+ L
Sbjct:   32 KMRKNLLLTLTVMGVIMGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG--LENDEVSSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPDLDDTNSTMSEYLSNATKPPPIFKD--KKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDAL 490          
BLAST of slc1a-5 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 510.76 bits (1314), Expect = 7.713e-176
Identity = 273/464 (58.84%), Postives = 356/464 (76.72%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLE-------------HFYENGTK---VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V++G   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A +LG+ILV+ IHPGNP +K++LG G   +  +  +LDAF DLIRNL P NL++ACF+Q QT  V K+E              +  N TK   +F +  K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M +FF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+ L
Sbjct:   34 KMRKNLLLTLTVMGVIMGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG--LENDEVSSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPDLDDTNSTMSEYLSNATKPPPIFKD--KKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDAL 492          
BLAST of slc1a-5 vs. Ensembl Zebrafish
Match: slc1a2a (solute carrier family 1 member 2a [Source:ZFIN;Acc:ZDB-GENE-100422-11])

HSP 1 Score: 494.967 bits (1273), Expect = 5.704e-170
Identity = 264/440 (60.00%), Postives = 342/440 (77.73%), Query Frame = 1
Query:  292 VLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLE--------HFYENGTKVFIN-VTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            + G   G+LL++ + +    + +I FPG++LM MLKM+I+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A +LG+ILV+ IHPGNP +K +LG G   K  +  +LDAF DLIRNL P NL++ACF+Q QT   TK+E         F  N TK     V K  +  +   NVLG++ F +AFG+ +G+MG++A++M +FF  LNE+VM+LV +IMWYSPIGI  LI GKI+ I DL   A  LGMYMVTV++GL IHG I L LI+FV  RKNPF +F G+ QAWVTALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+
Sbjct:   46 ITGSVAGILLRYASPLPADVIMVIAFPGDILMRMLKMVILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTVIAAVLGVILVLLIHPGNPKLKANLGEGK--KNDEVSSLDAFFDLIRNLFPENLVQACFQQIQT-VTTKVEIAPPPPPTRFGRNATKGAAKYVIKKSLQFKSGMNVLGIIGFFVAFGICMGKMGEKAKLMVDFFNTLNEIVMRLVGMIMWYSPIGIACLICGKIISINDLEMVAKQLGMYMVTVIVGLIIHGGIFLPLIYFVIVRKNPFKFFMGLFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIELDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVIGDSYGAGIVYHLSKDELD 482          
BLAST of slc1a-5 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 511.916 bits (1317), Expect = 2.903e-176
Identity = 284/504 (56.35%), Postives = 374/504 (74.21%), Query Frame = 1
Query:  181 VQKSTITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV------------------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKS 1638
            V + T   SP + +  K+      + N+L++LT+  V++G   G LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A ILG+ILV+AIHPG+P +KK LG G   +  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK +   E  T+   NVT  V                  +  ++  NVLG++ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L L++FV TRK+PF +  G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +LE L   +    +E  + +S
Sbjct:   24 VTEETRPRSPCLRICDKI------RGNLLLSLTVFGVIMGAVSGGLLRMASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQ--ENDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAHQEIEMTKTQS 516          
BLAST of slc1a-5 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 511.531 bits (1316), Expect = 3.414e-176
Identity = 284/504 (56.35%), Postives = 374/504 (74.21%), Query Frame = 1
Query:  181 VQKSTITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV------------------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKS 1638
            V + T   SP + +  K+      + N+L++LT+  V++G   G LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A ILG+ILV+AIHPG+P +KK LG G   +  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK +   E  T+   NVT  V                  +  ++  NVLG++ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L L++FV TRK+PF +  G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +LE L   +    +E  + +S
Sbjct:   24 VTEETRPRSPCLRICDKI------RGNLLLSLTVFGVIMGAVSGGLLRMASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQ--ENDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAHQEIEMTKTQS 516          
BLAST of slc1a-5 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 511.916 bits (1317), Expect = 3.926e-176
Identity = 284/504 (56.35%), Postives = 374/504 (74.21%), Query Frame = 1
Query:  181 VQKSTITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV------------------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKS 1638
            V + T   SP + +  K+      + N+L++LT+  V++G   G LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A ILG+ILV+AIHPG+P +KK LG G   +  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK +   E  T+   NVT  V                  +  ++  NVLG++ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L L++FV TRK+PF +  G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +LE L   +    +E  + +S
Sbjct:   24 VTEETRPRSPCLRICDKI------RGNLLLSLTVFGVIMGAVSGGLLRMASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQ--ENDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAHQEIEMTKTQS 516          
BLAST of slc1a-5 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 511.916 bits (1317), Expect = 4.248e-176
Identity = 284/504 (56.35%), Postives = 374/504 (74.21%), Query Frame = 1
Query:  181 VQKSTITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV------------------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKS 1638
            V + T   SP + +  K+      + N+L++LT+  V++G   G LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A ILG+ILV+AIHPG+P +KK LG G   +  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK +   E  T+   NVT  V                  +  ++  NVLG++ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L L++FV TRK+PF +  G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +LE L   +    +E  + +S
Sbjct:   28 VTEETRPRSPCLRICDKI------RGNLLLSLTVFGVIMGAVSGGLLRMASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQ--ENDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAHQEIEMTKTQS 520          
BLAST of slc1a-5 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 500.745 bits (1288), Expect = 2.020e-171
Identity = 284/506 (56.13%), Postives = 372/506 (73.52%), Query Frame = 1
Query:  181 VQKSTITMSPKVNVPPKLLKFFKNKDNVLVALTI--ASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV------------------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKS 1638
            V + T   SP + +  K+      + N+L++LT+   S V     G LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A++YY+ TT++A ILG+ILV+AIHPG+P +KK LG G   +  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK +   E  T+   NVT  V                  +  ++  NVLG++ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L L++FV TRK+PF +  G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +LE L   +    +E  + +S
Sbjct:   46 VTEETRPRSPCLRICDKI------RGNLLLSLTVFGKSTV----SGGLLRMASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQ--ENDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAHQEIEMTKTQS 536          
BLAST of slc1a-5 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 520.39 bits (1339), Expect = 1.317e-179
Identity = 285/470 (60.64%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   44 NLLLSLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 509          
BLAST of slc1a-5 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 520.005 bits (1338), Expect = 2.139e-179
Identity = 285/470 (60.64%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   41 NLLLSLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 506          
BLAST of slc1a-5 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 519.62 bits (1337), Expect = 2.188e-179
Identity = 285/470 (60.64%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   41 NLLLSLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 506          
BLAST of slc1a-5 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 519.62 bits (1337), Expect = 3.857e-179
Identity = 285/470 (60.64%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   44 NLLLSLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 509          
BLAST of slc1a-5 vs. Ensembl Mouse
Match: Slc1a3 (solute carrier family 1 (glial high affinity glutamate transporter), member 3 [Source:MGI Symbol;Acc:MGI:99917])

HSP 1 Score: 469.159 bits (1206), Expect = 8.390e-160
Identity = 252/480 (52.50%), Postives = 341/480 (71.04%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTK------------LEHFYENGTKVFINVTKI------VINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELG--IVEQGERKS 1638
            N  V LT+ +V++G  +G  L+    +S R+V    FPGE+LM ML+ML++PLI+SSL+TG++ LD+K+SGKMG+ A+VYY+ TT++AV++GII+V+ IHPG    +     G + + T  D        IRN+ P NL+EACF+Q +T+Y  +            L     N ++    +T+I      V       N LGLV FS+ FG ++G M ++ + + EFF  LNE +M+LV +IMWY+P+GI FLI GKI+E++D+      L MY VTV++GL IH  I L L++F+ TRKNP+V+  G+LQA +TALGT+SSSATLPITFKCLEENNGVDKR+TRFVLP+GATINMDGTALYEA+A+IFIAQ+N   L+FGQI TISITAT A+IGAA +P AGLVTM++VLTSVGLP +DITLI+AVDW LDR+RT+ NVLGD+ GAGIV+HL + +L+    D E+G  ++E+ E K 
Sbjct:   48 NAFVLLTVTAVIVGTILGFALR-PYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDL---IRNMFPPNLVEACFKQFKTSYEKRSFKVPIQSNETLLGAVINNVSEAMETLTRIREEMVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFDLNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKN--RDVEMGNSVIEENEMKK 521          
BLAST of slc1a-5 vs. UniProt/SwissProt
Match: sp|P31596|EAA2_RAT (Excitatory amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc1a2 PE=1 SV=2)

HSP 1 Score: 520.39 bits (1339), Expect = 1.182e-178
Identity = 286/470 (60.85%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  A I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   44 NLLLSLTVFGVILGAVCGGLLRLAAPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISLLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 509          
BLAST of slc1a-5 vs. UniProt/SwissProt
Match: sp|P43006|EAA2_MOUSE (Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 2.698e-178
Identity = 285/470 (60.64%), Postives = 365/470 (77.66%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL-----EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L++LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK           N TK  I++           TKIVI      ++  NVLGL+ F IAFG+ +G+MG++A++M EFF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLE+N G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA+IGAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   44 NLLLSLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRM 509          
BLAST of slc1a-5 vs. UniProt/SwissProt
Match: sp|Q10901|EAA1_CAEEL (Excitatory amino acid transporter OS=Caenorhabditis elegans OX=6239 GN=glt-1 PE=1 SV=2)

HSP 1 Score: 511.531 bits (1316), Expect = 3.987e-176
Identity = 271/469 (57.78%), Postives = 354/469 (75.48%), Query Frame = 1
Query:  202 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFI--------NVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            M P   +  +++  +  K N+L+ LT++SVVLG   G LL+ +  +S + +  I FPGE+LM+MLKM+I+PLI+SSLI+GL+ LDA+ SGK+G  A+ YY+ TT +AV+ GI LV+ IHPG+P IKK +G G+  +     T+D  LDL+RN+ P N+++A F+Q QT Y+       +N     +        +  K  + +    NVLG++ F IA G+ L Q+G+EA +M +FF ++++V+MKLV  +MWYSP GIF LI+GKILEI DLA+TA  L MYMVTVL GL IH  I+L LIFFV T+KNP+V+  G+ QAW+TALGTASSSATLPITF CLEEN GVD+RVTRFVLP+GATINMDGTALYEAVA+IFIAQING++LSFGQ+ T+S+TATLA+IGAASVPSAGLVTM+LVLT+VGLP+ D++LI+AVDWLLDR+RTSINVLGDA GAGIV H  K  L+
Sbjct:    1 MPPDTRINKEIMVSWIRK-NLLLVLTVSSVVLGALCGFLLRGLQ-LSPQNIMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGT--EGKTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 465          
BLAST of slc1a-5 vs. UniProt/SwissProt
Match: sp|Q25605|EAAT_ONCVO (Excitatory amino acid transporter OS=Onchocerca volvulus OX=6282 GN=GLT-1 PE=2 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 1.162e-172
Identity = 264/452 (58.41%), Postives = 344/452 (76.11%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFI--------NVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            + N+L+ LT++SVVLG   G LL+ +  +S + +  I FPGE+LM+MLKM+I+PLI+SSLI+GL+ LDA+ SGK+G  A+ YY+ TT +AV+ GI LV+ IHPG+P IKK +G G+  +     T+D  LDL+RN+ P N+++A F+Q QT Y+       +N     +        +  K  + +    NVLG++ F IA G+ L Q+G+EA +M +FF ++++V+MKLV  +MWYSP GI  LI+GKILEI DLA+TA  L MYMVTVL GL IH  I+L LIFFV T+KNP+V+  G+ QAW+T LGTASSS TLPIT+ CLEEN GVD+RVTRFVLP+GATINMDGTALYEAVA+IFIAQING++LSFGQ+ T+S+TATLA+IGAASVPSAGLVTM+LVLT+VGLP+ D++LI+AVDWLLDR+RTSINVLGDA GAGIV H  K  L+
Sbjct:    6 RKNLLLVLTVSSVVLGALCGFLLRGLQ-LSPQNIMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGT--EGKTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGILCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITGLGTASSSDTLPITYICLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 454          
BLAST of slc1a-5 vs. UniProt/SwissProt
Match: sp|P43004|EAA2_HUMAN (Excitatory amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC1A2 PE=1 SV=2)

HSP 1 Score: 498.819 bits (1283), Expect = 3.189e-170
Identity = 282/471 (59.87%), Postives = 362/471 (76.86%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKL------EHFYENGTKVFINV-----------TKIVINH----QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ LT+  V+LG   G LL+  + I    V LI FPG++LM MLKMLI+PLI+SSLITGLSGLDAK+SG++G  A+VYY+ TT++A +LG+ILV+AIHPGNP +KK LGPG   K  +  +LDAFLDLIRNL P NL++ACF+Q QT  VTK            N T   +++           TK+VI      ++  NVLGL+ F IAFG+ +G+MG +A++M +FF +LNE+VMKLV +IMWYSP+GI  LI GKI+ IKDL   A  LGMYMVTV++GL IHG I L LI+FV TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL K +L+ + + + +
Sbjct:   44 NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGK--KNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT--VTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRV 510          
BLAST of slc1a-5 vs. TrEMBL
Match: A0A0H3YEU5 (Amino acid transporter OS=Schmidtea mediterranea OX=79327 GN=slc1a-5 PE=2 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 482/482 (100.00%), Postives = 482/482 (100.00%), Query Frame = 1
Query:  202 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL 1647
            MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL
Sbjct:    1 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL 482          
BLAST of slc1a-5 vs. TrEMBL
Match: A0A0X3P8S7 (Excitatory amino acid transporter 2 OS=Schistocephalus solidus OX=70667 GN=EAA2 PE=4 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 291/463 (62.85%), Postives = 372/463 (80.35%), Query Frame = 1
Query:  238 KFFKNK---DNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGT---KVFINVTKIVIN-HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNE 1605
            + F+ +   DN++V  T+ +V+ G+ +G+LLKFVA+ + RQ+YLI FPGE+LMNMLKMLIIPLI+SSL+TGL+GLDAKSSGK+G YA++YYV+TT MAVILGI+LV++IHPG+ +IK+S+  G + K+  +          RN+ P N+++AC  Q Q+ +   +     NGT     + ++ +I++  ++ STNVLGLV+FSIA GLI+GQMG++A IM +FF +LNE+VM+LVK+IMWYSP+GIFFLI+GK+L+I DL  TA SLG YM+TV+LGL IH   TL L++ V  RKNPF ++ G+ QAW+TALGTASS+ATLPITF+CLEEN G+DKRVTRFVLPIGATINMDGTALYEAVASIFIAQING  L+  ++  +S+TATLAAIGAASVPSAGLVTM+LVLTSVGLP NDIT+ILAVDWLLDR+RTS+NV+GDA GAGIVDHLCKK L  L  D E
Sbjct:   51 RTFRKRCSADNLIVTFTVIAVIAGMGLGILLKFVASPTSRQIYLISFPGELLMNMLKMLIIPLIISSLVTGLAGLDAKSSGKIGSYAMIYYVLTTAMAVILGIVLVLSIHPGSTSIKESVEVGKVDKRVTSTLDSFLDL-FRNIFPENIVQACLEQQQSEH-KNITRRRRNGTLPNMTYNSIEEIIVPVYKSSTNVLGLVTFSIAIGLIMGQMGEQALIMVQFFVILNEIVMRLVKIIMWYSPLGIFFLILGKVLDIDDLERTAYSLGKYMLTVVLGLAIHSLGTLTLLYTVICRKNPFRFYKGIFQAWITALGTASSAATLPITFRCLEENLGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGRDLALSEVIIVSVTATLAAIGAASVPSAGLVTMMLVLTSVGLPTNDITMILAVDWLLDRIRTSVNVIGDAIGAGIVDHLCKKDL--LARDEE 509          
BLAST of slc1a-5 vs. TrEMBL
Match: A0A3Q0KCR1 (Amino acid transporter OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 302/490 (61.63%), Postives = 381/490 (77.76%), Query Frame = 1
Query:  229 KLLKFFK---NKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVT--KLEHFYE-----NGTKVFINVTKIV------INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL--EELPTDNELG-IVEQGERKSS 1641
            KL KF K   N DN+ V  T+ +V+LG+ +GLL+K  AT S R +YL+ FPGE+LMNMLKMLIIPLIVSSLI GL+GLD KSSGK+G YA++YYVVTT++AVILGI LV+ IHPG+ +IK  +G G++ ++            +RNL P N+++AC +Q Q++YVT  K   +       NGT    N T ++        + +STNVLGLVSFSI FG+ILGQMG  A IM +FF VLNEVVM++V++IM YSP GIFFLI+GK+LEI++L++TA +LG+YMVTV+ GL IH   TL L+++  TRKNPFV++ G+ QAW+TALGTASS+ATLPITF+CLE+N G+DKRVTRFVLPIGATINMDGTALYEAVASIFIAQING YL+  ++F +S+TATLAAIGAASVPSAGLVTM+LVLTSVGLP  DI+LILAVDWLLDR+RTSINV+GDA GAGIV+HLC K+L  ++   D E+  +VE+  R+ S
Sbjct:   45 KLSKFKKWIFNLDNLFVTFTVLAVILGMTIGLLVKIYATPSPRTIYLLSFPGELLMNMLKMLIIPLIVSSLIAGLAGLDPKSSGKIGSYALIYYVVTTMLAVILGIGLVLCIHPGDTSIKDEIGEGTIEERRPETLDSLLDL-LRNLFPENVVQACLQQQQSSYVTIVKRPKYVRLTDGTNGTLNMNNKTNLISYEAIKAKYVDSTNVLGLVSFSIIFGIILGQMGDRAVIMVQFFSVLNEVVMRMVQVIMLYSPFGIFFLILGKMLEIENLSDTAKALGLYMVTVISGLAIHLLGTLALLYYAVTRKNPFVFYKGLFQAWITALGTASSAATLPITFRCLEQNLGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGKYLTIIEVFIVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWLLDRIRTSINVMGDAVGAGIVNHLCSKELAQKDAEIDKEIDEVVEEYTRELS 533          
BLAST of slc1a-5 vs. TrEMBL
Match: H2KSH0 (Excitatory amino acid transporter OS=Clonorchis sinensis OX=79923 GN=glt-1 PE=4 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 290/480 (60.42%), Postives = 367/480 (76.46%), Query Frame = 1
Query:  238 KFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEH--FYENGTKVFINVTKIVIN-------------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGER 1632
            ++F + DN+ V LT+A+VVLG+ +GL +K  A  S R +YL+ FPGE+LMNM KMLIIPLIVSSL+ GL+ LD KSSGK+G YA++YYVVTTL+A +LGI+LV++IHPGNPNI+K+LG G++ ++            +RNL P NLI+AC +Q Q+ YV    H  +        +N +++  N             + +STNVLGLVSFSI FGLILGQMG +A +M +FF +L+EV+M +VK +M YSP GIFFLI+GK+LEI++L  TA+SLGMYM+TV+ GL IH   TL L++FVFTRKNPF ++ G+ QAW+TALGT+SS+ATLPITF+CLE N  +DKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN   LS  ++  +S+TATLAAIGAASVPSAGLVTM+LVLTSVGLP  DI+LILAVDW+LDR+RTSINV+GDA GAGIVDHLC+K+LE    + E  + E  E 
Sbjct:   49 RWFCDFDNIFVLLTVAAVVLGMTIGLAVKVYADPSRRTIYLVSFPGELLMNMFKMLIIPLIVSSLVAGLANLDPKSSGKIGSYALIYYVVTTLLATVLGIVLVLSIHPGNPNIRKNLGEGTIEERRPETLDSVMDL-LRNLFPENLIQACIQQQQSFYVNVTAHPKYLPAIRDALLNSSELADNLGEPVTEEIVKPRYMDSTNVLGLVSFSIMFGLILGQMGDKAVVMVQFFSILSEVIMHMVKAVMLYSPFGIFFLILGKVLEIENLKETATSLGMYMLTVISGLAIHCLGTLALLYFVFTRKNPFKFYRGVFQAWITALGTSSSAATLPITFRCLENNLKIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINAKELSVVEVIVVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWMLDRIRTSINVMGDAVGAGIVDHLCRKELEAKDAEIERELDEAVEE 527          
BLAST of slc1a-5 vs. TrEMBL
Match: A0A4S2L4X4 (Amino acid transporter OS=Opisthorchis felineus OX=147828 GN=CRM22_010362 PE=3 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 296/480 (61.67%), Postives = 373/480 (77.71%), Query Frame = 1
Query:  238 KFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEH--FYENGTKVFINVTKIVIN-------------HQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGER 1632
            ++F + DN+ V LT+A+VVLG+ +GL +K  A  S R +YL+ FPGE+LMNM KMLIIPLIVSSL+ GL+ LD KSSGK+G YA++YYVVTTL+A +LGI LV++IHPGNPNI+K+LG G+ T++   +TLD+ +DL+RNL P NLI+AC +Q Q+ YV    H  +         N +++  N             + +STNVLGLVSFSI FGLILGQMG +A +M +FF +L+EVVM +VK +M YSP GIFFLI+GK+LEI++L  TA+SLGMYM+TV+ GL IH   TL L++FVFTRKNPF ++ G+ QAW+TALGT+SS+ATLPITF+CLE N  +DKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN   LS  ++  +S+TATLAAIGAASVPSAGLVTM+LVLTSVGLP  DI+LILAVDW+LDR+RTS+NV+GDA GAGIVDHLC+K+LE    + E  + E  E 
Sbjct:   49 RWFCDFDNIFVLLTVAAVVLGMTIGLAVKIYADPSRRTIYLVSFPGELLMNMFKMLIIPLIVSSLVAGLANLDPKSSGKIGCYALIYYVVTTLLATVLGIALVLSIHPGNPNIRKNLGEGT-TEERRPETLDSVMDLLRNLFPENLIQACIQQQQSFYVNVTAHPKYLPAIRDALFNSSELADNLGEPVTEEIVKPRYMDSTNVLGLVSFSIMFGLILGQMGDKAVVMVQFFSILSEVVMHMVKAVMLYSPFGIFFLILGKVLEIENLKETATSLGMYMLTVISGLAIHCLGTLALLYFVFTRKNPFKFYRGVFQAWITALGTSSSAATLPITFRCLENNLKIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINAKDLSVVEVIVVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWMLDRIRTSVNVMGDAVGAGIVDHLCRKELEAKDAEIERELDEAVEE 527          
BLAST of slc1a-5 vs. Ensembl Cavefish
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:103022057])

HSP 1 Score: 506.908 bits (1304), Expect = 1.793e-174
Identity = 275/461 (59.65%), Postives = 353/461 (76.57%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQT------------NYVTKLEHFYENGTKVF-INVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V+LG   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A+VYY+ TT++A ILG+ILV+ IHPGNP +K++LG G   +  D  +LDAF DLIRNL P NL++ACF+Q QT            +  + ++ F    TK   I   K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +LE L
Sbjct:   31 KMRKNLLLTLTVLGVILGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTIIAAILGVILVLIIHPGNPKLKENLGEG--LQNDDVSSLDAFFDLIRNLFPENLVQACFQQIQTVVKKVEVQPDFDDSNSTMDEFLSGATKPPPIFKQKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFTFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELEAL 489          
BLAST of slc1a-5 vs. Ensembl Cavefish
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:103022057])

HSP 1 Score: 506.908 bits (1304), Expect = 2.361e-174
Identity = 275/461 (59.65%), Postives = 353/461 (76.57%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQT------------NYVTKLEHFYENGTKVF-INVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            K + N+L+ LT+  V+LG   G+LL+  + I D  V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A+VYY+ TT++A ILG+ILV+ IHPGNP +K++LG G   +  D  +LDAF DLIRNL P NL++ACF+Q QT            +  + ++ F    TK   I   K  +  +   NVLGL+ F IAFG+ +G+MG++AR+M EFF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F   RKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +LE L
Sbjct:   36 KMRKNLLLTLTVLGVILGAVSGMLLRVASPIDDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTIIAAILGVILVLIIHPGNPKLKENLGEG--LQNDDVSSLDAFFDLIRNLFPENLVQACFQQIQTVVKKVEVQPDFDDSNSTMDEFLSGATKPPPIFKQKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFTFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELEAL 494          
BLAST of slc1a-5 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 494.197 bits (1271), Expect = 6.323e-168
Identity = 268/451 (59.42%), Postives = 354/451 (78.49%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTK-VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ALT+  V+ G  +GLLL+++  +    + LI FPG++LM MLKMLI+PLI+SSLITGL+GLDA+SSG+MG  A+VYY+ TT++A +LG+ILV+ IHPGNP ++ +    S  K  +  +LDAFLDLIRNL P NL++ACF+Q QT  + K+    +N T+ + IN  K+    +   NVLGL+ F I FG+ +G+MG++ ++M +FF +LNE++MK+V +IMWYSP+GI  LI GKI  I DL   A  LGMYMVTV++GL IHG I L +IFF  TRKNPFV++ G+ QAW+TALGTASS+ TLP+TF+CLEEN  +DKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N I L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTSINV+GD+FGAGIVD L + +L ++  D E+
Sbjct:   51 NLLLALTVLGVIGGTVLGLLLRYLPELDADILMLIAFPGDILMRMLKMLILPLIISSLITGLAGLDARSSGRMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQA-RSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQT-VLKKVAVPVDNQTEPILINKKKL--EFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI--DGEI 495          
BLAST of slc1a-5 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 493.812 bits (1270), Expect = 7.728e-168
Identity = 268/451 (59.42%), Postives = 354/451 (78.49%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTK-VFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ALT+  V+ G  +GLLL+++  +    + LI FPG++LM MLKMLI+PLI+SSLITGL+GLDA+SSG+MG  A+VYY+ TT++A +LG+ILV+ IHPGNP ++ +    S  K  +  +LDAFLDLIRNL P NL++ACF+Q QT  + K+    +N T+ + IN  K+    +   NVLGL+ F I FG+ +G+MG++ ++M +FF +LNE++MK+V +IMWYSP+GI  LI GKI  I DL   A  LGMYMVTV++GL IHG I L +IFF  TRKNPFV++ G+ QAW+TALGTASS+ TLP+TF+CLEEN  +DKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N I L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTSINV+GD+FGAGIVD L + +L ++  D E+
Sbjct:   46 NLLLALTVLGVIGGTVLGLLLRYLPELDADILMLIAFPGDILMRMLKMLILPLIISSLITGLAGLDARSSGRMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQA-RSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQT-VLKKVAVPVDNQTEPILINKKKL--EFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI--DGEI 490          
BLAST of slc1a-5 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 483.026 bits (1242), Expect = 2.132e-165
Identity = 265/457 (57.99%), Postives = 348/457 (76.15%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQ---ESTNVL----GLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            N+L+ALT+  V+ G  +GLLL+++  +    + LI FPG++LM MLKMLI+PLI+SSLITGL+GLDA+SSG+MG  A+VYY+ TT++A +LG+ILV+ IHPGNP ++ +    S  K  +  +LDAFLDLIRNL P NL++ACF+Q Q +              +F  +    IN Q   E +N L    GL+ F I FG+ +G+MG++ ++M +FF +LNE++MK+V +IMWYSP+GI  LI GKI  I DL   A  LGMYMVTV++GL IHG I L +IFF  TRKNPFV++ G+ QAW+TALGTASS+ TLP+TF+CLEEN  +DKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N I L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTSINV+GD+FGAGIVD L + +L ++  D E+
Sbjct:   35 NLLLALTVLGVIGGTVLGLLLRYLPELDADILMLIAFPGDILMRMLKMLILPLIISSLITGLAGLDARSSGRMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSS-NKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQLS--------------LFAPLYPSEINRQFILELSNCLCLCSGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI--DGEI 474          
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Match: slc1a4 (solute carrier family 1 member 4 [Source:ZFIN;Acc:ZDB-GENE-030616-566])

HSP 1 Score: 372.089 bits (954), Expect = 1.036e-123
Identity = 194/426 (45.54%), Postives = 283/426 (66.43%), Query Frame = 1
Query:  346 RQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXX-XXXXIRNLLPVNLIEACFRQSQTNYVT---KLEHFYENGTKVFINVTKIVI-NHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNEL 1608
            R +    FPGE+L+ MLKM+IIPL+V SL++G + LD +S G++G  AI++++VTTL+A  +G+     + PG   +K ++  G++      + +D+      RN+ P NL+ A F+   T Y T   K+    ENGT   I   K+ + +  +  N+LGLV F+I FG+ L ++G E   +  FF   NE  M LV  IMWY+P+GI FL+  KI+E+ DL    SSLG Y++  +LG  +HG I L LI+F  TR+NP+ +  G++    TA GTASSSATLP+  KC+EENNGVDK+++RF+LPIGAT+NMDG AL++ VA++FIA +N + L  GQIFTI +TAT +++GAA +P+ G++T+ ++L +V LP NDI+LILAVDWL+DR  T INV GDA GAGI+  L ++  ++   + EL
Sbjct:   10 RLLTYFSFPGELLIRMLKMIIIPLVVCSLVSGAASLDPRSLGRLGGLAILFFLVTTLIASSVGVAFAFMLKPGAGGVKPAVYTGAVALPQSKEAVDSFLDLASRNIFPANLVSAAFQSYATTYETVFIKMNLTTENGTMEIIKQEKVPVGSDADGMNILGLVMFAICFGIALRKLGPEGEALIGFFNSFNEATMVLVSWIMWYAPLGIMFLVASKIVEMDDLVQLISSLGKYILCCILGHAMHGGIILPLIYFACTRQNPYRFLLGIITPLTTAFGTASSSATLPLMIKCIEENNGVDKKISRFILPIGATVNMDGAALFQCVAAVFIAYMNNVTLDAGQIFTILVTATASSVGAAGIPAGGVLTLAIILEAVSLPTNDISLILAVDWLVDRTCTVINVEGDAIGAGILHVLSQRDQKKRGREEEL 435          
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010766.1 (pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 gene:ENSPMAG00000009750.1 transcript:ENSPMAT00000010766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 331.257 bits (848), Expect = 3.970e-109
Identity = 188/382 (49.21%), Postives = 252/382 (65.97%), Query Frame = 1
Query:  289 VVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTN--------------------VLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSA-TLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISIT 1371
            V++G+ +G++ +    +    + +I FPGE+LM MLKMLI+PLI+SSLITGLSGLDA+SSG+MG  A+VYY+ T++ A ILGI+LV+AIHPG+P++K     G   +     + DA LDLIRN+ P NL++AC +Q       + E       +V ++        + STN                     L LV F IAFG++LG+MG EA  M +FF +LNE+VM+L+ +++WYSPIGI  LI GKI E+ DL      LGMYM+TV++GL IHG + L L++FV TRKNP  +F G+ Q+   A      SA TLP+TF+CLEEN  +DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI  +  T
Sbjct:    1 VIMGVLLGVVFRRAGQLQPNTILIISFPGEILMRMLKMLILPLIISSLITGLSGLDAQSSGRMGCRALVYYMATSVTAAILGIVLVLAIHPGDPSLKPD--KGHEEELQAVSSFDAILDLIRNVFPENLVQACMQQQDFGLHGRHERSGSANVRVTLSERSPTGREKNSTNQVTEQRGGCISAGEHVIGTATLRLVCFVIAFGVVLGKMGDEATPMLKFFSILNEIVMRLIIIVIWYSPIGIASLICGKIAELSDLHVVMRQLGMYMLTVIVGLLIHGAVILPLVYFVITRKNPLKFFVGIFQSLTDARALCGRSAGTLPVTFRCLEENLKIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVVVRYT 380          
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 223.016 bits (567), Expect = 4.548e-70
Identity = 101/141 (71.63%), Postives = 130/141 (92.20%), Query Frame = 1
Query: 1168 SSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            S+ TLP+TF+CLEEN G+DKR+TRFVLP+GATINMDGTALYEAVA+IFIAQ+NG+ L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP +DI+L++AVDWLLDR+RTS+NV+GD+FGAGIV HL + +L+ +
Sbjct:    1 SAGTLPVTFRCLEENLGIDKRITRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTSDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSRAELDAI 141          
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Match: slc1a1 (solute carrier family 1 member 1 [Source:ZFIN;Acc:ZDB-GENE-040718-414])

HSP 1 Score: 192.971 bits (489), Expect = 1.206e-56
Identity = 130/324 (40.12%), Postives = 185/324 (57.10%), Query Frame = 1
Query:  253 KDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLG-PGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVT-KLEHFYENGTKVFINVT---------------KIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLG--LTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTAS 1167
            +  +++  T   V  G+  GLLL+  A  +   +    FPG++LM MLK++I+PLIVSS+ITGL+ LD+  SGK+G  A+ YY+ TT++AV+LGI LV+ I PG       +   GS     +  T+D  LDL+RN+ P NL++ACF+Q +T       E    N T   +  T               ++   +    NVLGL+ F +AFG ++ +MG    I+  FF  LNE  M++V +IMWY PIGIFFL+ GKI+E+ D       LG+YM TVL G  L IH  + L LI+F+  R+NPF Y  G+  A  TAL  +S
Sbjct:   16 RKKIVICGTAICVGTGIGTGLLLREFANFNSLDIVYFSFPGDVLMRMLKLIILPLIVSSMITGLASLDSNVSGKIGGLAVAYYLSTTVLAVLLGIALVLLIKPGVSQSTDEIDRTGS---TPNATTVDTLLDLVRNMFPENLVQACFQQYRTRRSEIDPEVVIVNSTASPVTTTLSMALSTNVTVIKEFRLTGEYSSGINVLGLIVFCVAFGSVIRRMGPSGEILAAFFDALNEATMRIVAIIMWYMPIGIFFLVAGKIMEVDDW-EIFRKLGLYMATVLSGSSLAIHSLVVLPLIYFIVVRRNPFSYIAGLTHAITTALMISS 335          
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 187.578 bits (475), Expect = 5.950e-56
Identity = 101/225 (44.89%), Postives = 137/225 (60.89%), Query Frame = 1
Query:  556 HPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQT-------------------NYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSS 1173
            HPGNP +KK LG G + ++  +      L  IRNL P NL++ACF+Q  T                   N V+          ++ + +  ++  +  S     L+ F IAFG+I+G+MG +A++M EFF +LNE++M+LV +IMWYSP GI  LI GKI +IKDL   A  LGMYM+TV++GL IHG I L LI+F  TRKNPF +F G+ QAW+TALGTAS S
Sbjct:   10 HPGNPKLKKQLGKGQLNEEVSSLDAFLDL--IRNLFPENLVQACFQQVWTISSIRSAMVLCAPRAVAVGNGVSADLPAAHREMRITLPLMSLIPANTPSYWATRLIGFFIAFGIIMGKMGDQAKLMVEFFSILNEIIMRLVIMIMWYSPFGIASLICGKISDIKDLEVVARQLGMYMITVIVGLIIHGAIILPLIYFSITRKNPFKFFVGIFQAWITALGTASRS 232          
BLAST of slc1a-5 vs. Ensembl Nematostella
Match: EDO39457 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W7])

HSP 1 Score: 364.385 bits (934), Expect = 4.339e-120
Identity = 214/484 (44.21%), Postives = 306/484 (63.22%), Query Frame = 1
Query:  259 NVLVALTIASVVLGLAMGLL----LKFVATISDRQ--VYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYV-TKLEHFYENGTKVFINVTKIVINHQ---------------------------------ESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            N+LV L    ++LG  +G L    LK + +  DR+  + LIGFPGE+ MNMLK+L++PL+V+S+I  L+ LD +SS ++     VYY+ TTL+AVI+G++LV  + PG+    K  G G   K +    LDA LDLIR+  P N+I A F Q +T+Y  T  +  Y N T    N+++  +N                                   E+ N+LGL+ FS+ FG +LG+MG+    +   F  LNEV++K++ L+MW++PIG+  LI  ++  ++D+  + S LG+YM TV+ GL  H    L L+F + TR+NP  +  GM  A +TA GT+SS+ATLP T +CLE+ N VD R++RFVLP+G+T+NMDGTALYE VA++FIAQI+GI L    +    +TAT A+IGA+ +P AGLVTM++VLT+V LP  DI LIL+VDW +DR+RT++NVLGDA GAGIV+HL +  L  L
Sbjct:    7 NLLVFLIFIGILLGFVIGFLVNSPLKNLRSDEDRKTNIMLIGFPGELFMNMLKLLMVPLVVASVICALAALDGRSSNRVSRRTFVYYLATTLLAVIIGVVLVTFMKPGS--YGKPEGKG--LKPSFYRPLDAVLDLIRSCFPSNIITAAFMQQRTHYTSTAAKVSYVNRTVNVHNMSQAELNSMRILSNGTHNYTTTPQAIRAASNTVPDGSKADSGENANILGLLVFSLVFGAVLGRMGERGVPLKALFESLNEVILKMLALVMWFAPIGVCSLIAAQMASMEDIMGSLSMLGLYMATVIAGLLAHALFILPLLFIIATRRNPLTFICGMRDALLTAFGTSSSTATLPCTIRCLEDRNRVDARISRFVLPLGSTVNMDGTALYEVVAAVFIAQIHGIELGLDDLAITCLTATAASIGASGIPQAGLVTMVMVLTAVNLPTEDIGLILSVDWFIDRIRTTVNVLGDAIGAGIVEHLSRDDLMNL 486          
BLAST of slc1a-5 vs. Ensembl Nematostella
Match: EDO33620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRP9])

HSP 1 Score: 350.903 bits (899), Expect = 2.083e-114
Identity = 217/508 (42.72%), Postives = 311/508 (61.22%), Query Frame = 1
Query:  241 FFKNKDNVLVALTIASVVLGLAMGLLL----KFVATISDRQ--VYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGN--PNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFY-----ENGTKVFINVTKIVINH-------------------------QESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPT-DNELGIVEQGERKSSRL 1647
            F K K ++L+A  I   VLG  +G ++    + + T  DR+  + LIGFPGE+ MNMLK++I+PLIV+SLI+ L+ +D K++GK+G   +++Y +TT+ A ILG+ILV+AI PG     ++K   P S        T+D+FLDL+R+L P N++EACF Q +T Y      +      EN T +   VT  +I++                            TNVLG+  F + FG+IL +MG +A  +  FF  LN+ VM+LV +IMW SPIGI  ++  K+ E+ D+    S +G +M+TV+  + IHG   L L++FV TRKNP+ +  GM  A VTA G +SSSATLP T +C EE  GVD+R+ +FVLP+GAT+NMDG AL+E+   IFIAQING+ +    +F   + A   ++GAA +PSAG +  ++VL SVGLP+ D+ L+L ++WLLDR RT++NV GDA GAGIV+H+ K  L  +     E G V  G   S  L
Sbjct:   20 FRKFKSDLLLAFIILGAVLGFVIGAIINKPIEQILTPEDRKTTIMLIGFPGELFMNMLKLVILPLIVASLISALACMDPKATGKIGRRVLLFYFLTTISAAILGLILVLAIRPGRVVKPVEKQGQPVS------YRTMDSFLDLLRSLFPNNIVEACFIQYKTKYAYDPGKYMSYNTTENITSITSRVTTTIISNGTHNITTVVKEVYPPSNLIPSGRQASSGTNVLGIAMFCLVFGIILSRMGAKAEPLRAFFCSLNDAVMRLVMIIMWLSPIGICSIVAAKVGEMGDIVGVLSMVGYFMLTVISSILIHGLFVLPLMYFVMTRKNPYKFMLGMGDALVTAFGISSSSATLPTTIRCAEET-GVDERIAKFVLPLGATVNMDGGALFESCVVIFIAQINGVPMEAAFLFNTVLMAAAISVGAAGIPSAGFIYPVIVLQSVGLPVEDLALVLPIEWLLDRFRTTVNVWGDAVGAGIVNHMSKADLVAMDALQMEQGHVSPGSPSSDHL 520          
BLAST of slc1a-5 vs. Ensembl Nematostella
Match: EDO37906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED2])

HSP 1 Score: 330.487 bits (846), Expect = 7.289e-108
Identity = 203/420 (48.33%), Postives = 280/420 (66.67%), Query Frame = 1
Query:  385 MNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPN------IKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQEST----------NVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPT 1596
            M MLKMLI+PLI++SLI  L  LD+ ++GK+G   ++YY+ TTL+AV+LGI +V  I PG  +      I++S GP           LD+FLDLIR+L P N++EA F Q +     ++ +   NGT     +   +    E+           NVLG+V FSI FG++LG+MG+    +  FF  LNEV+M+++ ++MW SPIGI  LI   ++++ D+ +   +LGM++ T L  L IHG + L L++F+ TR+NPF Y   ++ A VTA GT SSSATLP T +C EE N VDKR+ RFVLP+GAT+NMDGTALYE V  ++IAQ+NGI L  G+I T  +TAT AAIGAA +PSAGLVTM++VL +VGLP +DI LI +VDW +DR RT +N+ GDA+GAG+V+HL  K L  LP+
Sbjct:    1 MAMLKMLILPLIMASLICALGVLDSSATGKIGRRTVLYYLCTTLIAVLLGIAMVSIIQPGKGDKPKGERIEQSAGP--------RRNLDSFLDLIRSLFPNNIVEATFMQMEY----RIRNAKINGTHNITTLRNTIYGPSETIPDGYSRTWGLNVLGIVMFSIVFGIVLGRMGERGAPLKSFFETLNEVIMQMITIVMWLSPIGICSLIAKNLVQMGDIPSAFKALGMFIGTSLAALLIHGLVILPLVYFICTRRNPFKYMFNLVDALVTAFGTDSSSATLPTTIRCCEEENHVDKRIVRFVLPLGATVNMDGTALYEGVCCLWIAQMNGIELGPGEIVTTVLTATAAAIGAAGIPSAGLVTMLIVLQAVGLPTDDIALIWSVDWFIDRFRTMVNITGDAYGAGVVEHLSLK-LRLLPS 407          
BLAST of slc1a-5 vs. Ensembl Nematostella
Match: EDO32707 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA1])

HSP 1 Score: 294.664 bits (753), Expect = 2.031e-95
Identity = 162/324 (50.00%), Postives = 220/324 (67.90%), Query Frame = 1
Query:  652 RNLLPVNLIEACFRQSQTNYVTKLE---HFYENGTKVFINVTKIVINHQE------------STNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQ 1578
            R + P N+ EA F Q  TN + ++      + NGT     + ++V    +            S NVLGLV FSI  G +L +MG +   +  FF  LN+VVM++V L+MWYSP+GI  LI  K+  + D+A +   LGM+M+T +LG+ +H  ITL +I++V T+KNPF +  GM  A VT  GTASS+ATLP T +C EENNG+D R+TRFVLP+GAT+NMDGTALYE V +I+IAQIN I L+ GQI T S+TAT AAIGAA+VPSAGL+TM++V  ++ +P +DI LI AVDW +DR R   N++GD++GAGIV HL K++
Sbjct:    3 RQVFPPNIAEATFNQVSTNTIKQVFFTIKIFSNGTHNLTTIRQLVHRAYDQIPGGTFPTPGSSMNVLGLVMFSIVLGAMLSKMGDKGLPLKCFFQALNDVVMRMVTLVMWYSPVGICSLIASKVAGMGDIALSLKLLGMFMLTSILGILLHTLITLPIIYYVMTKKNPFKFMKGMSDALVTVWGTASSAATLPTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKEE 326          
BLAST of slc1a-5 vs. Ensembl Nematostella
Match: EDO28941 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T521])

HSP 1 Score: 165.622 bits (418), Expect = 1.383e-48
Identity = 90/143 (62.94%), Postives = 114/143 (79.72%), Query Frame = 1
Query: 1153 LGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQL 1581
            LG   S+ATLP T +C EENNG+D R+TRFVLP+GAT+NMDGTALYE V +I+IAQIN I L+ GQI T S+TAT AAIGAA+VPSAGL+TM++V  ++ +P +DI LI AVDW +DR R   N++GD++GAGIV HL K +L
Sbjct:   11 LGFFHSAATLPTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKDEL 153          
BLAST of slc1a-5 vs. Ensembl Medaka
Match: slc1a2a (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:101160301])

HSP 1 Score: 510.375 bits (1313), Expect = 2.681e-176
Identity = 277/473 (58.56%), Postives = 362/473 (76.53%), Query Frame = 1
Query:  175 VSVQKSTITMSPKVNVPPKLLKFFKNK--DNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVT-KIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLE 1584
            V V+     + P V+ P      F +K   N+++ LTI  V LG   G+LL+ ++ +    + +I FPGE+LM MLKMLI+PL+VSSL+TGL+GLDAKSSG++G  A+VYY+ TT++A +LG+ILV+ IHPGNP ++ +LG G   K  +  ++DAF DLIRNL P NL++ACF+Q QT  +TK++    N T+     T K  +  +   NVLGL+ F +AFG+I+G+MG++A++M EFF VLNE+VMKLV  IMWYSP GI  LI GKI+ I DL   A  LGMYMVTV++GL IHG I L LI+FV  +KNPF +F G+ QAWVTALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NGI L +GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+
Sbjct:    5 VEVRMGENHLEPSVDSPENPCAGFCDKIMKNMVLTLTILGVFLGSIAGMLLRHISPLPPDVIMIIAFPGEILMRMLKMLILPLVVSSLVTGLAGLDAKSSGRLGTRAMVYYMSTTVIAAVLGVILVLLIHPGNPKLRANLGLGK--KNDEVSSVDAFFDLIRNLFPENLVQACFQQIQT-VITKVQ-VPTNRTRAPPQFTIKRSLQFKSGMNVLGLIGFFVAFGVIMGKMGEKAKLMLEFFNVLNEIVMKLVGAIMWYSPFGIACLICGKIISIADLEVVARQLGMYMVTVIVGLIIHGGIFLPLIYFVIVKKNPFTFFMGIFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDWGQIITVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKDELD 473          
BLAST of slc1a-5 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 506.523 bits (1303), Expect = 6.229e-175
Identity = 281/479 (58.66%), Postives = 359/479 (74.95%), Query Frame = 1
Query:  196 ITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTK-------VFINVT-------KIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            I   P+        K FKN   +L+ LT+  V+LG   G+LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A+VYY+ TT++A +LG+ILV+ IHPGNP +K++LG G   K  D  +LDAF DLIRNL P NL++ACF+Q QT  VTK     E           + +N+T       K  +  +   NVLGL+ F IAFG+ +G+MG+ AR+M EFF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F  TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG++L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+EL
Sbjct:   17 IEARPQSKCAKICSKMFKN---LLLTLTVLGVILGAVSGMLLRVASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGE--KNEDVSSLDAFFDLIRNLFPENLVQACFQQIQT--VTKKVEVIEEEVNTTTSMGGLLVNITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDEL 488          
BLAST of slc1a-5 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 506.523 bits (1303), Expect = 9.072e-175
Identity = 281/479 (58.66%), Postives = 359/479 (74.95%), Query Frame = 1
Query:  196 ITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTK-------VFINVT-------KIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            I   P+        K FKN   +L+ LT+  V+LG   G+LL+  + I    V +I FPG++LM MLKMLI+PLI+SSLITGL+GLDAKSSG++G  A+VYY+ TT++A +LG+ILV+ IHPGNP +K++LG G   K  D  +LDAF DLIRNL P NL++ACF+Q QT  VTK     E           + +N+T       K  +  +   NVLGL+ F IAFG+ +G+MG+ AR+M EFF +LNE+VMKLV +IMWYSP GI  LI GKI+ IKDL   A  LGMYM+TV++GL IHG I L  I+F  TRKNPF +F G+ QAW+TALGTASS+ TLP+TF+CLEEN G+DKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+NG++L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR RTS+NV+GD++GAGIV HL K +L+EL
Sbjct:   22 IEARPQSKCAKICSKMFKN---LLLTLTVLGVILGAVSGMLLRVASPIHPDIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGE--KNEDVSSLDAFFDLIRNLFPENLVQACFQQIQT--VTKKVEVIEEEVNTTTSMGGLLVNITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDEL 493          
BLAST of slc1a-5 vs. Ensembl Medaka
Match: slc1a9 (excitatory amino acid transporter 2 [Source:NCBI gene;Acc:101167791])

HSP 1 Score: 469.159 bits (1206), Expect = 2.599e-158
Identity = 259/448 (57.81%), Postives = 343/448 (76.56%), Query Frame = 1
Query:  247 KNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEEL 1590
            ++  N+L+ LT+  VV+G+  G+LL+++       + ++ FPGE+LM MLKMLI+PLI+SSLITGL+GLDA+SSG+MG  A+VYY+ TT++A +LG+ILV+ IHPGNP ++      + TK  +  +LDAFLDLIRNL P NL++AC +Q QT   T       +     ++V K  + ++   NVLGL+ F I FG+ +G+MG+  +IM +FF +LNE++M +V +IMWYSP+GI  LI GKI  I DL   A  LGMYMVTV++GL IHG + L  IFF  TRK+PF ++ G+ QAW+TALGTASS+ TLP+TF+CLEEN  +DKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N I L  GQI T+S+TATLA++GAAS+PSAGLVTM+L+LT+VGLP  DI+L++AVDWLLDR+RTSINV+GD+FGAGIV HL K +L +L
Sbjct:   37 RSTHNLLLGLTVLGVVMGVVFGMLLRYMMVTDLSALTMVSFPGEVLMRMLKMLILPLIISSLITGLAGLDARSSGRMGSRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGRTA-STATKNQEVSSLDAFLDLIRNLFPENLVQACIQQVQTVVKTVQ--VVPSNQSEAVSVVKKKLEYKWGMNVLGLIGFFITFGICMGRMGERGKIMCDFFNILNEIIMTMVSMIMWYSPVGISSLIAGKIAAIGDLETVARQLGMYMVTVIVGLVIHGGLILPAIFFAITRKSPFAFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDINLDSGQIVTVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVYHLSKGELADL 481          
BLAST of slc1a-5 vs. Ensembl Medaka
Match: SLC1A3 (solute carrier family 1 member 3 [Source:NCBI gene;Acc:101170607])

HSP 1 Score: 456.833 bits (1174), Expect = 2.144e-155
Identity = 258/482 (53.53%), Postives = 345/482 (71.58%), Query Frame = 1
Query:  241 FFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTK-----IVINHQE---------STNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELG--IVEQGERKS 1638
            FFK   N  V  T+A+VVLG+ +G  L+    +S R+V    FPGE+LM ML+ML++PL+VSSLITG++ LD+K+SGKMG+ A++YY+ TT++AV +GI++V+ IHPG  +  +    G           DAFLDLIRN+ P NL++AC +Q +T Y  +  H        F N T      + I  +E           N LGLV FS+ FGLI+G M ++ +++ EFF  LNE +M+LV +IMWY+PIGI FLI GKI+E+ DL      LGMY +TV++GL IH  + L +++FV TR+NPFV+  G+LQA VTALGT+SSSATLP+TFKCLEENN +DKR+TRFVLP+GATINMDGTALYEA+A+IFIAQ+N + ++FGQI TISITAT A+IGAA +P AGLVTM++VLTSVGLP +DITLI+AVDW LDR+RT+ NVLGD+ GAGI++ L + +L     D E+G  ++E+ ERK 
Sbjct:   30 FFKK--NAFVLFTVAAVVLGVILGFSLR-PYKMSYREVKYFSFPGEVLMRMLQMLVLPLLVSSLITGMAALDSKASGKMGMRAVIYYMTTTIIAVFIGILIVLIIHPGKGSKAEF---GKQQTIEQISPADAFLDLIRNMFPPNLVQACTQQFKTKYGKRTVHLTVTINDTFFNSTNNTQEVMEITREEMIPIPGQVNGLNALGLVVFSMCFGLIIGNMKEQGQLLREFFDGLNEAIMQLVAIIMWYAPIGILFLIAGKIVEMDDLTQMGGQLGMYTITVIIGLMIHAVLILPMLYFVITRQNPFVFIAGLLQALVTALGTSSSSATLPVTFKCLEENNKIDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNMEMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSRHELRS--KDVEMGNAVLEEKERKK 503          
BLAST of slc1a-5 vs. Planmine SMEST
Match: SMESG000064126.1 (SMESG000064126.1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 481/482 (99.79%), Postives = 482/482 (100.00%), Query Frame = 1
Query:  202 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL 1647
            MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTK+VINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL
Sbjct:    1 MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKMVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNELGIVEQGERKSSRL 482          
BLAST of slc1a-5 vs. Planmine SMEST
Match: SMESG000022787.1 (SMESG000022787.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 301/482 (62.45%), Postives = 373/482 (77.39%), Query Frame = 1
Query:  187 KSTITMSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV--------INHQ-------ESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEE 1587
            +S   MS K  +  K+   FKN DN+LV+LT+ SVVLG+ +GL++K      D  V LI FPGE+LMNMLKMLIIPLIVSSLI+GL+GLD KSSG++G +A++YY  TT+MAV+LGIILVV IHPGN +IKK LG G+  K+    TLD+FLDL+RN+ P N+I+A  +Q  + YV K +   +   K  ++  K          I ++       +STNVLG+V+FS+ FGL+L QMG++A IM +FF +LNEVVMK+VK+IMWYSPIGIF L++GK+L+I+ L  TA++LGMYM+TV+ GL IH C TL LI+ V  RK+P  +F G+ QAW+TALGTASS+ATLPITF+CLEE  G+DKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN   L   QIFT+SITATLAAIGAASVPSAGLVTMI+VLTSVGLP +DI+LIL VDWLLDR+RTSINVLGDA+GA +V HLCKK L+E
Sbjct:   32 RSPSNMSTKTCLD-KVKGAFKNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNMLKMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGT-NKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDE 511          
BLAST of slc1a-5 vs. Planmine SMEST
Match: SMESG000064127.1 (SMESG000064127.1)

HSP 1 Score: 454.907 bits (1169), Expect = 6.650e-157
Identity = 241/372 (64.78%), Postives = 301/372 (80.91%), Query Frame = 1
Query:  496 YYVVTTLMXXXXXXXXXXXXHPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEE--LPTDNE 1605
            YY+ TTLMAVI+GIILVV+IHPG+P +K +L P    +K    TLDAFLDLIRN+ PVNLI +CFRQ+ T YV+++E    NGT   +N+T I   +Q++TN+LGL+SFSI FGL++G +GKEA ++ + F +LN  +MK+V +IMWYSP GI FLI+GKI+EI+DL  T  SLG YM+TVLLGL IH  I LNL++F+  RKNP +YF GMLQA +TALGT+SSSATLP+T KC+EE N +DKR++R VLPIGATINMDGTALYEAVASIFIAQIN I L+FGQI TISITATLAA+GAAS+PS GL+TMI+VLTSVGLPI+DI+L+++VDWLLDR RT++NVLGDA+GAGIV  LC+       LP DN+
Sbjct:    3 YYLFTTLMAVIIGIILVVSIHPGDPTVKDNLEPSKPGRKIPPKTLDAFLDLIRNIFPVNLISSCFRQASTFYVSEVEKILLNGTLKDVNITNIRHGYQDATNILGLLSFSIVFGLVIGNIGKEADVLIKIFHILNIAIMKIVNMIMWYSPFGIMFLIMGKIIEIRDLRTTVQSLGWYMLTVLLGLLIHAGIVLNLLYFIIVRKNPALYFRGMLQAVITALGTSSSSATLPVTIKCVEEINQIDKRISRLVLPIGATINMDGTALYEAVASIFIAQINAIPLNFGQILTISITATLAAVGAASIPSGGLITMIIVLTSVGLPIDDISLLISVDWLLDRFRTAVNVLGDAYGAGIVGSLCQVDSANTVLPVDNQ 374          
BLAST of slc1a-5 vs. Planmine SMEST
Match: SMESG000064127.1 (SMESG000064127.1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.250e-154
Identity = 225/352 (63.92%), Postives = 282/352 (80.11%), Query Frame = 1
Query:  556 HPGNPNIKKSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEE--LPTDNE 1605
            HPG+P +K +L P    +K    TLDAFLDLIRN+ PVNLI +CFRQ+ T YV+++E    NGT   +N+T I   +Q++TN+LGL+SFSI FGL++G +GKEA ++ + F +LN  +MK+V +IMWYSP GI FLI+GKI+EI+DL  T  SLG YM+TVLLGL IH  I LNL++F+  RKNP +YF GMLQA +TALGT+SSSATLP+T KC+EE N +DKR++R VLPIGATINMDGTALYEAVASIFIAQIN I L+FGQI TISITATLAA+GAAS+PS GL+TMI+VLTSVGLPI+DI+L+++VDWLLDR RT++NVLGDA+GAGIV  LC+       LP DN+
Sbjct:   14 HPGDPTVKDNLEPSKPGRKIPPKTLDAFLDLIRNIFPVNLISSCFRQASTFYVSEVEKILLNGTLKDVNITNIRHGYQDATNILGLLSFSIVFGLVIGNIGKEADVLIKIFHILNIAIMKIVNMIMWYSPFGIMFLIMGKIIEIRDLRTTVQSLGWYMLTVLLGLLIHAGIVLNLLYFIIVRKNPALYFRGMLQAVITALGTSSSSATLPVTIKCVEEINQIDKRISRLVLPIGATINMDGTALYEAVASIFIAQINAIPLNFGQILTISITATLAAVGAASIPSGGLITMIIVLTSVGLPIDDISLLISVDWLLDRFRTAVNVLGDAYGAGIVGSLCQVDSANTVLPVDNQ 365          
BLAST of slc1a-5 vs. Planmine SMEST
Match: SMESG000064122.1 (SMESG000064122.1)

HSP 1 Score: 430.639 bits (1106), Expect = 7.760e-147
Identity = 231/383 (60.31%), Postives = 292/383 (76.24%), Query Frame = 1
Query:  232 LLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMXXXXXXXXXXXXHPGNPNIK-----KSLGPGSMXXXXXXXXXXXXXXXIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTIS 1365
            L KF  N +N+L  LT+ SV  GL  G  +K    +++ Q+YLI FPGEMLMNMLKMLI+PL+ SSLITGLS L+ KSSGK+GLY + YY +TT +++I+G++LVV IHPGNP IK     ++ GP S     +   L++  DLIRN+ P NLIE CFRQ  TNY  + E+ Y+N T+   N++K+ I   ESTN+LGLV FSI FGLILGQ+G + + MF+FF VLN+V+M +V  IMWY PIGIFFLI+GKILEIK+L + ASSLG+Y++TVLLGL IHG I L L++F+  +KNP+ +F  + QAW+ + GTASS+ATLPITFKCLE N  V K+VTRFVLPIGATINMDGTALYEAVASIFIAQING+ LSFGQIF++S
Sbjct:    6 LKKFLSNNENILFVLTVFSVFTGLLAGFFIKSTFIVNEYQIYLISFPGEMLMNMLKMLILPLLTSSLITGLSVLETKSSGKIGLYTVFYYGITTSISLIMGMVLVVTIHPGNPKIKNLQPLENTGPTS-----NIGALESIFDLIRNIFPPNLIEGCFRQVATNYAIEKENIYKNFTEFPRNISKLTITMVESTNILGLVFFSITFGLILGQLGNKGKKMFQFFEVLNQVIMTMVTYIMWYFPIGIFFLIIGKILEIKNLESAASSLGLYIMTVLLGLFIHGGIVLPLMYFIVCKKNPYWFFRALPQAWLASFGTASSTATLPITFKCLESNKLVSKKVTRFVLPIGATINMDGTALYEAVASIFIAQINGMVLSFGQIFSMS 383          
The following BLAST results are available for this feature:
BLAST of slc1a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A23.461e-17159.87solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A23.461e-17159.87solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A23.549e-17159.87solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A24.789e-17159.87solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A24.880e-17159.87solute carrier family 1 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glt-11.500e-17759.29Excitatory amino acid transporter [Source:UniProt... [more]
glt-13.134e-17757.78Excitatory amino acid transporter [Source:UniProt... [more]
glt-51.574e-14051.70Amino acid transporter [Source:UniProtKB/TrEMBL;A... [more]
glt-64.529e-13547.73Putative sodium-dependent excitatory amino acid tr... [more]
glt-31.316e-13049.23Putative sodium-dependent excitatory amino acid tr... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eaat11.647e-11445.78gene:FBgn0026439 transcript:FBtr0079800[more]
Eaat11.647e-11445.78gene:FBgn0026439 transcript:FBtr0079801[more]
Eaat11.647e-11445.78gene:FBgn0026439 transcript:FBtr0303876[more]
Eaat11.647e-11445.78gene:FBgn0026439 transcript:FBtr0079802[more]
Eaat23.592e-9741.38gene:FBgn0026438 transcript:FBtr0078043[more]
back to top
BLAST of slc1a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2b1.839e-17658.84solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b5.615e-17658.84solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b6.064e-17658.84solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b7.713e-17658.84solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2a5.704e-17060.00solute carrier family 1 member 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A22.903e-17656.35solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A23.414e-17656.35solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A23.926e-17656.35solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A24.248e-17656.35solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A22.020e-17156.13solute carrier family 1 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc1a21.317e-17960.64solute carrier family 1 (glial high affinity gluta... [more]
Slc1a22.139e-17960.64solute carrier family 1 (glial high affinity gluta... [more]
Slc1a22.188e-17960.64solute carrier family 1 (glial high affinity gluta... [more]
Slc1a23.857e-17960.64solute carrier family 1 (glial high affinity gluta... [more]
Slc1a38.390e-16052.50solute carrier family 1 (glial high affinity gluta... [more]
back to top
BLAST of slc1a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31596|EAA2_RAT1.182e-17860.85Excitatory amino acid transporter 2 OS=Rattus norv... [more]
sp|P43006|EAA2_MOUSE2.698e-17860.64Excitatory amino acid transporter 2 OS=Mus musculu... [more]
sp|Q10901|EAA1_CAEEL3.987e-17657.78Excitatory amino acid transporter OS=Caenorhabditi... [more]
sp|Q25605|EAAT_ONCVO1.162e-17258.41Excitatory amino acid transporter OS=Onchocerca vo... [more]
sp|P43004|EAA2_HUMAN3.189e-17059.87Excitatory amino acid transporter 2 OS=Homo sapien... [more]
back to top
BLAST of slc1a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEU50.000e+0100.00Amino acid transporter OS=Schmidtea mediterranea O... [more]
A0A0X3P8S70.000e+062.85Excitatory amino acid transporter 2 OS=Schistoceph... [more]
A0A3Q0KCR10.000e+061.63Amino acid transporter OS=Schistosoma mansoni OX=6... [more]
H2KSH00.000e+060.42Excitatory amino acid transporter OS=Clonorchis si... [more]
A0A4S2L4X40.000e+061.67Amino acid transporter OS=Opisthorchis felineus OX... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2b1.793e-17459.65solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2b2.361e-17459.65solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a96.323e-16859.42excitatory amino acid transporter 2-like [Source:N... [more]
slc1a97.728e-16859.42excitatory amino acid transporter 2-like [Source:N... [more]
slc1a92.132e-16557.99excitatory amino acid transporter 2-like [Source:N... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a41.036e-12345.54solute carrier family 1 member 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010766.13.970e-10949.21pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 ge... [more]
SLC1A24.548e-7071.63solute carrier family 1 member 2 [Source:HGNC Symb... [more]
slc1a11.206e-5640.12solute carrier family 1 member 1 [Source:ZFIN;Acc:... [more]
SLC1A25.950e-5644.89solute carrier family 1 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc1a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394574.339e-12044.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336202.083e-11442.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379067.289e-10848.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327072.031e-9550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289411.383e-4862.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc1a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2a2.681e-17658.56excitatory amino acid transporter 2-like [Source:N... [more]
slc1a2b6.229e-17558.66solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2b9.072e-17558.66solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a92.599e-15857.81excitatory amino acid transporter 2 [Source:NCBI g... [more]
SLC1A32.144e-15553.53solute carrier family 1 member 3 [Source:NCBI gene... [more]
back to top
BLAST of slc1a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064126.10.000e+099.79SMESG000064126.1[more]
SMESG000022787.10.000e+062.45SMESG000022787.1[more]
SMESG000064127.16.650e-15764.78SMESG000064127.1[more]
SMESG000064127.14.250e-15463.92SMESG000064127.1[more]
SMESG000064122.17.760e-14760.31SMESG000064122.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011663
GenBankAKN21395.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011663 ID=SMED30011663|Name=slc1a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
GTGAAATTTGCCAAAATTTTCTCACATTTTGTCTCGGTTTCACGAGGTCA
TTCGAAGTTTTAACGGAAGTTCGATTCGGTTGACGAACAAATTATCATAT
ATTGTACAGGCTTAACGCGAAAATCTTATTGTACATATAAATAATAAAGT
CACTAGTCAAAGAAATAACAATTTGTATCTGTTCAAAAATCAACGATAAC
GATGAGTCCAAAAGTAAATGTTCCACCAAAGTTACTGAAATTTTTTAAAA
ACAAAGACAATGTATTGGTGGCACTTACGATTGCTTCTGTGGTGCTCGGT
TTGGCAATGGGGCTCCTGTTAAAATTTGTGGCCACAATAAGTGACCGACA
AGTCTATCTCATTGGATTTCCGGGAGAGATGTTAATGAATATGCTGAAAA
TGCTAATTATTCCTTTAATAGTTTCTAGTTTAATAACAGGATTATCTGGT
TTGGATGCCAAATCCAGTGGTAAAATGGGACTTTACGCCATTGTCTATTA
TGTGGTGACAACTTTGATGGCCGTTATCCTTGGTATTATTCTTGTCGTAG
CAATTCATCCAGGAAATCCGAATATTAAGAAATCACTTGGACCCGGATCT
ATGACTAAAAAAACTGACACAGATACTTTAGATGCGTTTCTTGATTTAAT
AAGAAATTTACTGCCAGTCAATCTTATTGAAGCCTGTTTCCGACAATCTC
AGACAAACTACGTTACGAAATTGGAACATTTTTATGAAAATGGAACGAAA
GTGTTCATAAATGTTACAAAAATTGTAATTAATCATCAAGAATCTACCAA
TGTTCTAGGTTTGGTATCGTTTTCCATCGCTTTTGGATTGATTCTTGGTC
AAATGGGAAAGGAAGCAAGAATAATGTTCGAATTTTTCGGTGTCTTGAAT
GAAGTTGTAATGAAATTAGTTAAGTTAATTATGTGGTACTCACCAATTGG
TATTTTCTTTTTAATTGTTGGTAAGATTCTCGAGATCAAAGACCTTGCAA
ATACAGCTTCTTCATTGGGAATGTATATGGTTACTGTTCTACTCGGATTA
ACCATTCACGGTTGTATTACATTGAATTTAATATTCTTTGTTTTTACCAG
AAAGAACCCATTTGTATATTTTCATGGAATGTTACAAGCATGGGTAACTG
CTTTAGGTACAGCATCGAGCTCAGCAACTCTACCTATTACATTCAAATGT
CTGGAGGAAAACAATGGTGTAGATAAACGAGTTACAAGATTTGTTTTACC
GATAGGCGCCACAATTAATATGGATGGAACTGCACTTTATGAGGCCGTGG
CATCAATTTTTATTGCCCAAATCAATGGAATATATCTTTCTTTTGGCCAG
ATATTCACCATTAGCATTACAGCTACTTTAGCGGCAATCGGTGCAGCGAG
TGTACCAAGTGCTGGACTGGTTACTATGATTCTAGTACTGACTTCGGTTG
GACTGCCAATTAATGATATAACTTTAATTCTAGCTGTAGATTGGCTTCTA
GATCGAGTTAGAACTTCAATAAATGTTCTTGGTGATGCATTTGGAGCCGG
AATCGTTGATCATTTGTGCAAAAAACAATTGGAAGAACTTCCAACTGACA
ATGAATTAGGAATAGTTGAACAAGGAGAGAGGAAATCTTCACGTTTATAA
CCGAAAAGTTTCAAAAATGATTGAAATAATTTTATTAATATTAGAAAATT
TATTATCTATATTGGAAAGTGATTTAGCATTTGAAAAAAACTATTATAAA
TATATTCTTATTACTTCTTTTAAA
back to top

protein sequence of SMED30011663-orf-1

>SMED30011663-orf-1 ID=SMED30011663-orf-1|Name=SMED30011663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MSPKVNVPPKLLKFFKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQ
VYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYY
VVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLI
RNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIVINHQESTN
VLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIG
IFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTR
KNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLP
IGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAAS
VPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAG
IVDHLCKKQLEELPTDNELGIVEQGERKSSRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036458Na:dicarbo_symporter_sf
IPR001991Na-dicarboxylate_symporter
IPR018107Na-dicarboxylate_symporter_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00173EDTRNSPORTcoord: 196..218
score: 47.59
coord: 280..299
score: 49.46
coord: 20..40
score: 42.08
coord: 64..84
score: 65.51
coord: 347..373
score: 86.09
coord: 409..429
score: 62.42
coord: 243..262
score: 65.0
coord: 93..118
score: 54.37
coord: 382..401
score: 67.7
NoneNo IPR availablePANTHERPTHR11958SODIUM/DICARBOXYLATE SYMPORTER-RELATEDcoord: 18..471
NoneNo IPR availableTMHMMTMhelixcoord: 234..256
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 309..331
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 277..299
NoneNo IPR availableTMHMMTMhelixcoord: 22..44
NoneNo IPR availableTMHMMTMhelixcoord: 200..219
IPR001991Sodium:dicarboxylate symporterPFAMPF00375SDFcoord: 22..454
e-value: 1.5E-127
score: 425.9
IPR018107Sodium:dicarboxylate symporter, conserved sitePROSITEPS00713NA_DICARBOXYL_SYMP_1coord: 57..71
IPR018107Sodium:dicarboxylate symporter, conserved sitePROSITEPS00714NA_DICARBOXYL_SYMP_2coord: 350..373
IPR036458Sodium:dicarboxylate symporter superfamilySUPERFAMILYSSF118215Proton glutamate symport proteincoord: 22..454