Chromosome 22 open reading frame 39

Overview
NameChromosome 22 open reading frame 39
Smed IDSMED30011650
Length (bp)590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 22 open reading frame 39 (SMED30011650) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 22 open reading frame 39 (SMED30011650) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome 22 open reading frame 39 (SMED30011650) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome 22 open reading frame 39 (SMED30011650) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011650

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011650h1SMcG0002885 SmedASXL_019611SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Human
Match: C22orf39 (chromosome 22 open reading frame 39 [Source:HGNC Symbol;Acc:HGNC:27012])

HSP 1 Score: 61.6178 bits (148), Expect = 4.232e-12
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+   +  + Y+  G+ P C QW+ D  +C D     N EA+Q L +SE  R +   + I    VW  R++PP DW  PLP
Sbjct:   11 RPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHI---LVWAPRQSPPPDWHLPLP 100          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Human
Match: C22orf39 (chromosome 22 open reading frame 39 [Source:HGNC Symbol;Acc:HGNC:27012])

HSP 1 Score: 61.2326 bits (147), Expect = 1.141e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+   +  + Y+  G+ P C QW+ D  +C D     N EA+Q L +SE  R +   + I    VW  R++PP DW  PLP
Sbjct:   48 RPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHI---LVWAPRQSPPPDWHLPLP 137          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Human
Match: C22orf39 (chromosome 22 open reading frame 39 [Source:HGNC Symbol;Acc:HGNC:27012])

HSP 1 Score: 61.2326 bits (147), Expect = 1.141e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+   +  + Y+  G+ P C QW+ D  +C D     N EA+Q L +SE  R +   + I    VW  R++PP DW  PLP
Sbjct:   48 RPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHI---LVWAPRQSPPPDWHLPLP 137          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Fly
Match: CG15908 (gene:FBgn0033085 transcript:FBtr0086114)

HSP 1 Score: 72.4034 bits (176), Expect = 5.152e-16
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:   68 IKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNC----IDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEI-MKFREIKSKSC 412
            I+PC  YKEE+ +C     RF++Y   GK  DCSQW  DY+NC      +  ++ A + +++SE +R + RL        W+ R+ PP DW +PLPD ++   E+  + +K +E+  ++ 
Sbjct:   25 IRPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEERRRIRLRAHFANDTWQKRKKPPLDWAAPLPDWMEKRNENTYLELKQKELSGQAA 144          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Zebrafish
Match: si:ch211-51h9.6 (si:ch211-51h9.6 [Source:NCBI gene;Acc:563100])

HSP 1 Score: 77.411 bits (189), Expect = 2.338e-18
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 2
Query:   77 CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTN--LEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPL 340
            C  Y  E   CK L NRF+EY+  G+ PDC QW++DY+NC D   N   +AK+ L +SE KR  ++ +      VWELR+ PP DW  PL
Sbjct:   14 CDIYCSELKHCKSLRNRFHEYYTYGRAPDCQQWKQDYQNCKDWEKNHSTQAKESLQESERKRLADQRKFT---PVWELRQKPPSDWHLPL 100          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Xenopus
Match: erlin1 (ER lipid raft associated 1 [Source:Xenbase;Acc:XB-GENE-5794201])

HSP 1 Score: 66.6254 bits (161), Expect = 4.137e-14
Identity = 39/93 (41.94%), Postives = 51/93 (54.84%), Query Frame = 2
Query:   77 CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID-SFTNLE-AKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDK 349
            C  Y  E+  CK L N F+ Y+  GK P+C +W+ DY  C D   T  E  K+ L QSE  R + +    NN  VW LR+ PP DW+ PL D+
Sbjct:   13 CDDYWSEWKHCKSLRNHFHNYYTHGKAPECQEWKRDYMTCRDWEKTKSELLKETLQQSERTRLEGKR---NNSPVWTLRKNPPPDWYLPLDDR 102          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Mouse
Match: 2510002D24Rik (RIKEN cDNA 2510002D24 gene [Source:MGI Symbol;Acc:MGI:1919557])

HSP 1 Score: 62.3882 bits (150), Expect = 1.256e-12
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNC--IDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+ + +  + Y+  GK PDC QW  D  NC   +   + EA++ L +SE  R +       +  VW LR+ PP DW  PLP
Sbjct:   11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQA---AQKHTLVWALRQRPPTDWNLPLP 100          
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Match: sp|Q0P3X7|CV039_DANRE (UPF0545 protein C22orf39 homolog OS=Danio rerio OX=7955 PE=3 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 3.456e-17
Identity = 41/90 (45.56%), Postives = 53/90 (58.89%), Query Frame = 2
Query:   77 CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTN--LEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPL 340
            C  Y  E   CK L NRF+EY+  G+ PDC QW++DY+NC D   N   +AK  L +SE KR  ++ +      VWELR+ PP DW  PL
Sbjct:   14 CDIYCSELKHCKSLRNRFHEYYTYGRAPDCQQWKQDYQNCKDWEKNHSTQAKDSLQESERKRLADQRKFT---PVWELRQKPPSDWHLPL 100          
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Match: sp|A2BD89|CV039_XENLA (UPF0545 protein C22orf39 homolog OS=Xenopus laevis OX=8355 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.321e-14
Identity = 40/91 (43.96%), Postives = 50/91 (54.95%), Query Frame = 2
Query:   77 CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLET-INNESVWELRETPPDDWFSPL 340
            C  Y  E+  CK L NRF+ Y+  GK P+C +W+ DY  C D     +   K+ L QSE    K RLE   NN  VW LR+ PP DW+ PL
Sbjct:   13 CDDYWSEWKHCKSLRNRFHNYYTYGKAPECQEWKRDYMTCRDWEKTKSNNLKEALQQSE----KTRLEGKQNNSPVWTLRKNPPPDWYLPL 99          
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Match: sp|Q3U595|CV039_MOUSE (UPF0545 protein C22orf39 homolog OS=Mus musculus OX=10090 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.784e-12
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNC--IDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+ + +  + Y+  GK PDC QW  D  NC   +   + EA++ L +SE  R +       +  VW LR+ PP DW  PLP
Sbjct:   11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCESEQVRVQA---AQKHTLVWALRQRPPTDWNLPLP 100          
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Match: sp|Q6P5X5|CV039_HUMAN (UPF0545 protein C22orf39 OS=Homo sapiens OX=9606 GN=C22orf39 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 5.479e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+   +  + Y+  G+ P C QW+ D  +C D     N EA+Q L +SE  R +   + I    VW  R++PP DW  PLP
Sbjct:   48 RPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHI---LVWAPRQSPPPDWHLPLP 137          
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Match: sp|Q5RE30|CV039_PONAB (UPF0545 protein C22orf39 homolog OS=Pongo abelii OX=9601 PE=3 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.717e-10
Identity = 32/93 (34.41%), Postives = 49/93 (52.69%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCID--SFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLP 343
            +PC  Y+ E+  C+   +  + Y+  G+ P C QW+ D  +C D     + EA+Q L +SE  R +   + I    VW  R++PP DW  PLP
Sbjct:   11 RPCESYRAEWKLCRSARHFVHHYYVHGERPACEQWQRDLASCRDWEERRSAEAQQSLCESERARVRAARKHI---LVWAPRQSPPPDWHLPLP 100          
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Match: A0A023G732 (Uncharacterized protein (Fragment) OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.443e-20
Identity = 44/106 (41.51%), Postives = 67/106 (63.21%), Query Frame = 2
Query:   41 ENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTN--LEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKL 352
            E+I +    ++PC WY EE  +CK +  +F++Y   G   DCSQW+EDY NC+    N  ++A + +++SE KR  +RL+   +  VWELR  PP++W +PLPD L
Sbjct:   24 ESIPQNAWMVRPCEWYSEEHADCKGIRGKFHQYFVHGVTLDCSQWKEDYSNCMLWRKNKDIDALKAVVESEEKRKHDRLKASYDNDVWELRSKPPENWNAPLPDWL 129          
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Match: A0A023G132 (Uncharacterized protein (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.457e-20
Identity = 46/121 (38.02%), Postives = 72/121 (59.50%), Query Frame = 2
Query:   41 ENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCI--DSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEIMKFREI 397
            E + K    ++PC WY EE  +CK +  +F++Y   G   DCSQWR+DY NC+   +  +L+A + +++SE KR  +RL+   +  +WELR  PP++W +PLPD L    E   I   R++
Sbjct:   19 EVVPKNAWMVRPCEWYSEEHADCKSIKGKFHQYFVHGTTLDCSQWRKDYDNCMLWRNKKDLDALKAVVESEEKRRHDRLKASYDNDIWELRSKPPENWNAPLPDWLNKKFEHSYIAVSRKL 139          
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Match: G3MSG2 (Uncharacterized protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.532e-20
Identity = 44/106 (41.51%), Postives = 67/106 (63.21%), Query Frame = 2
Query:   41 ENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTN--LEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKL 352
            E+I +    ++PC WY EE  +CK +  +F++Y   G   DCSQW+EDY NC+    N  ++A + +++SE KR  +RL+   +  VWELR  PP++W +PLPD L
Sbjct:   24 ESIPQNAWMVRPCEWYSEEHADCKGIRGKFHQYFVHGVTLDCSQWKEDYSNCMLWRKNKDIDALKAVVESEEKRKHDRLKASYDNDVWELRSKPPENWNAPLPDWL 129          
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Match: A0A1W0XD18 (Uncharacterized protein OS=Hypsibius dujardini OX=232323 GN=BV898_20133 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.976e-20
Identity = 40/106 (37.74%), Postives = 67/106 (63.21%), Query Frame = 2
Query:   65 FIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTNL--EAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKE 376
             I+PC  YKEE+ +C  + +RF++    G   DCSQW+ DY+NC+    N   EA +  +QSE +R   R+ T+ +  +W+LR+TPP++W +PLP+ L+   + ++
Sbjct:    1 MIRPCELYKEEYRDCTMVRSRFHQLFTTGVKRDCSQWKTDYENCLLWRKNADPEAAKKAIQSESRRVAYRIATVMDNEIWQLRDTPPENWNAPLPEALERLRQSRQ 106          
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Match: A0A0P4WPV0 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 8.196e-20
Identity = 47/123 (38.21%), Postives = 73/123 (59.35%), Query Frame = 2
Query:   44 NIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTN---LEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEI-MKFREIK 400
            ++  F   ++PC +YKEE+ +C  +  +F++Y   G+  DCSQW+ DY  C+  F N   +EA   +++SE +R ++RL    N  VWE RE PP+DW  PLP+ LQ   +   I +K +E K
Sbjct:   12 SLPSFSWLVRPCEYYKEEYSDCSSIKAKFHQYFIHGETRDCSQWKVDYNQCL-KFRNQKDMEALSSVIESEKERRQDRLRGHYNNDVWERREAPPEDWNKPLPEYLQKDNQSSYIALKLQEAK 133          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Cavefish
Match: si:ch211-51h9.6 (chromosome 6 C22orf39 homolog [Source:NCBI gene;Acc:111192674])

HSP 1 Score: 67.781 bits (164), Expect = 1.987e-14
Identity = 39/98 (39.80%), Postives = 53/98 (54.08%), Query Frame = 2
Query:   59 ESFIKP--CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNC--IDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPL 340
            ES+  P  C  Y  EF  CK L +RF+ Y+  G  P C QW+EDY+ C   +   +  AK+ L +SE  R     E  N   VW++R+ PP DW +PL
Sbjct:   34 ESWRPPRLCDTYWSEFRHCKSLRHRFHHYYTYGTTPMCQQWKEDYEACREWEKTQSAHAKECLQKSERSRVS---EQRNFTPVWKMRDKPPSDWHTPL 128          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Sea Lamprey
Match: C22orf39 (chromosome 22 open reading frame 39 [Source:HGNC Symbol;Acc:HGNC:27012])

HSP 1 Score: 60.077 bits (144), Expect = 1.469e-12
Identity = 34/92 (36.96%), Postives = 45/92 (48.91%), Query Frame = 2
Query:   77 CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCI--DSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPD 346
            C  Y+ E   CK L NRF+  +  G+ P+CS W  D   C   ++  N  AK+ L  +E  R     E   +  VW+LR  PP DW  PL D
Sbjct:    6 CEMYRAELRLCKSLSNRFHHVYVYGETPNCSHWGRDLDLCREWETTGNERAKEALRANERDRVA---EQRKHPPVWKLRSRPPVDWHLPLAD 94          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Nematostella
Match: EDO42092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D1])

HSP 1 Score: 46.595 bits (109), Expect = 3.237e-7
Identity = 31/108 (28.70%), Postives = 59/108 (54.63%), Query Frame = 2
Query:   20 LMDNFSDENIVKFESFIKP-CSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTNLE--AKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFS 334
            ++D    +N  +   F  P C  + E++  C    N+F++Y+  GKF DCS +++D +NC+   T     +KQ L+++ ++R + +  + +   +WE RE P + W S
Sbjct:    5 ILDEKQQDNSPENADFKAPACLKFFEKWRFCSSSSNQFHQYYIYGKFKDCSVYKDDMQNCVVYKTTKSETSKQALIEA-MRRDEIKFSSAD---IWERRENPSEYWNS 108          
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Medaka
Match: si:ch211-51h9.6 (chromosome 9 C22orf39 homolog [Source:NCBI gene;Acc:101172821])

HSP 1 Score: 70.4774 bits (171), Expect = 6.504e-16
Identity = 41/92 (44.57%), Postives = 50/92 (54.35%), Query Frame = 2
Query:   71 KPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNC--IDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPL 340
            + C  Y  EF  CK L NRF+ Y+  G  P C QW+EDY NC   +   + E K+ L +SE KR     E  N + VWELR  PP DW  PL
Sbjct:    3 RACDTYWSEFWHCKSLVNRFHHYYTYGTTPSCHQWKEDYYNCREWEKSRSTETKEALQRSERKRV---AEQKNFDPVWELRCEPPKDWNLPL 91          
BLAST of Chromosome 22 open reading frame 39 vs. Planmine SMEST
Match: SMESG000067409.1 (SMESG000067409.1)

HSP 1 Score: 270.396 bits (690), Expect = 4.161e-94
Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 2
Query:   23 MDNFSDENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEIMKFREIKSKSCT 415
            MDNFSDENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEIMKFREIKSKSCT
Sbjct:    1 MDNFSDENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQWREDYKNCIDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPDDWFSPLPDKLQVTEEDKEIMKFREIKSKSCT 131          
The following BLAST results are available for this feature:
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C22orf394.232e-1235.48chromosome 22 open reading frame 39 [Source:HGNC S... [more]
C22orf391.141e-1135.48chromosome 22 open reading frame 39 [Source:HGNC S... [more]
C22orf391.141e-1135.48chromosome 22 open reading frame 39 [Source:HGNC S... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG159085.152e-1634.17gene:FBgn0033085 transcript:FBtr0086114[more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-51h9.62.338e-1845.56si:ch211-51h9.6 [Source:NCBI gene;Acc:563100][more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
erlin14.137e-1441.94ER lipid raft associated 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
2510002D24Rik1.256e-1235.48RIKEN cDNA 2510002D24 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P3X7|CV039_DANRE3.456e-1745.56UPF0545 protein C22orf39 homolog OS=Danio rerio OX... [more]
sp|A2BD89|CV039_XENLA5.321e-1443.96UPF0545 protein C22orf39 homolog OS=Xenopus laevis... [more]
sp|Q3U595|CV039_MOUSE8.784e-1235.48UPF0545 protein C22orf39 homolog OS=Mus musculus O... [more]
sp|Q6P5X5|CV039_HUMAN5.479e-1135.48UPF0545 protein C22orf39 OS=Homo sapiens OX=9606 G... [more]
sp|Q5RE30|CV039_PONAB1.717e-1034.41UPF0545 protein C22orf39 homolog OS=Pongo abelii O... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023G7321.443e-2041.51Uncharacterized protein (Fragment) OS=Amblyomma tr... [more]
A0A023G1321.457e-2038.02Uncharacterized protein (Fragment) OS=Amblyomma pa... [more]
G3MSG21.532e-2041.51Uncharacterized protein OS=Amblyomma maculatum OX=... [more]
A0A1W0XD183.976e-2037.74Uncharacterized protein OS=Hypsibius dujardini OX=... [more]
A0A0P4WPV08.196e-2038.21Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-51h9.61.987e-1439.80chromosome 6 C22orf39 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C22orf391.469e-1236.96chromosome 22 open reading frame 39 [Source:HGNC S... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420923.237e-728.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-51h9.66.504e-1644.57chromosome 9 C22orf39 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Chromosome 22 open reading frame 39 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000067409.14.161e-94100.00SMESG000067409.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011650 ID=SMED30011650|Name=Chromosome 22 open reading frame 39|organism=Schmidtea mediterranea sexual|type=transcript|length=590bp
TCAATTTGTTTAAATATTGCTAATGGATAATTTTAGTGATGAGAATATTG
TTAAATTTGAGTCATTTATTAAACCATGTAGTTGGTACAAAGAAGAGTTT
CATGAATGTAAAAAATTGTATAACAGATTTTATGAATATCATGCAATGGG
AAAATTTCCGGATTGTTCACAGTGGAGAGAGGATTATAAAAATTGTATTG
ATTCTTTTACCAATTTAGAAGCTAAACAGTTATTATTACAAAGTGAAATA
AAGCGTGCTAAAAATAGACTCGAGACAATAAATAATGAATCTGTCTGGGA
ACTAAGAGAAACTCCTCCAGATGATTGGTTTTCACCACTACCAGATAAAT
TACAAGTCACAGAAGAAGATAAAGAAATTATGAAATTCCGTGAAATAAAA
TCTAAAAGTTGTACATTATTATAATTTAGATGGAAATTTTTGTAATTTAG
GAATATAATAATATTTAATTATAAATAGCAAGATTACGTTATTTGATCTT
TTATCTGACATAACTGATTATGCAGTTAACAGAGTTTTAATTAGTGATTA
AAATGCTGAGAATACTTTCCACTTGTCAACAAGAAAATTT
back to top

protein sequence of SMED30011650-orf-1

>SMED30011650-orf-1 ID=SMED30011650-orf-1|Name=SMED30011650-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MDNFSDENIVKFESFIKPCSWYKEEFHECKKLYNRFYEYHAMGKFPDCSQ
WREDYKNCIDSFTNLEAKQLLLQSEIKRAKNRLETINNESVWELRETPPD
DWFSPLPDKLQVTEEDKEIMKFREIKSKSCTLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR021475DUF3128
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 62..89
IPR021475Protein of unknown function DUF3128PFAMPF11326DUF3128coord: 19..95
e-value: 2.7E-9
score: 37.3