Phospholipid scramblase

Overview
NamePhospholipid scramblase
Smed IDSMED30011648
Uniprot Best hitPhospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1 (E=1.00867e-11)
Length (bp)882
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid scramblase (SMED30011648) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30011648) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid scramblase (SMED30011648) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30011648) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011648

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011648SMESG000062579.1 dd_Smed_v4_11132_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30011648SMESG000062579.1 dd_Smed_v4_11132_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 69.707 bits (169), Expect = 2.590e-13
Identity = 58/203 (28.57%), Postives = 87/203 (42.86%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R              CC   + +       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S+ E+                 V G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE++
Sbjct:   46 NKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPL----RCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC----------------VVGKISKHW-TGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFEST 227          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 67.781 bits (164), Expect = 2.242e-12
Identity = 67/242 (27.69%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  102 QSNINCLLSFKIQQNLD-------IDIKDYCKG-NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            Q  +NC    +    +D       I++ +   G  + N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R      C   CC          GV       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S+ E+                 V G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE++
Sbjct:   83 QPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGV------PIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC----------------VVGKISKHW-TGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFEST 301          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 67.781 bits (164), Expect = 2.490e-12
Identity = 67/242 (27.69%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  102 QSNINCLLSFKIQQNLD-------IDIKDYCKG-NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            Q  +NC    +    +D       I++ +   G  + N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R      C   CC          GV       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S+ E+                 V G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE++
Sbjct:   90 QPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGV------PIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC----------------VVGKISKHW-TGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFEST 308          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 56.6102 bits (135), Expect = 2.897e-9
Identity = 43/130 (33.08%), Postives = 58/130 (44.62%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYE 578
            N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R              CC   + +       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S+ E
Sbjct:   46 NKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPL----RCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDE 171          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 53.1434 bits (126), Expect = 1.183e-7
Identity = 51/166 (30.72%), Postives = 70/166 (42.17%), Query Frame = 3
Query:  102 QSNINCLLSFKIQQNLD-------IDIKDYCKG-NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFS 569
            Q  +NC    +    +D       I++ +   G  + N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R      C   CC          GV       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S
Sbjct:   90 QPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGV------PIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKS 249          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-2 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:G5EEQ3])

HSP 1 Score: 46.595 bits (109), Expect = 9.182e-6
Identity = 50/241 (20.75%), Postives = 102/241 (42.32%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR-------ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCR-CCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            ++ + ++ ++  ++++ L+I +  +   N Y I ++  +  +  +E+S+      R  CG  RGFTM + D  N ++  + R       + C C +         +   G       L+G V+Q Y  ++  ++I+++   ++  V G  C    CC D  F I    + +V                 G+I K W     ++   D +   +TF   ++   K + L +  LI+ + FEN
Sbjct:   51 EYLAYLDTVMVHQVKEVLEI-LTGWESKNKYAIRNKNGQQCYYAFEESN---AWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSFCGCLLGLQNICTIESLSTG-------LLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSCCCEDKDFTI-KTPDSSVPI---------------GSITKKWG-GLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFEN 263          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 67.781 bits (164), Expect = 4.669e-13
Identity = 56/235 (23.83%), Postives = 105/235 (44.68%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA-SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            ++ + I+ LL   ++Q +++ ++ +    + N +  K  +  +VY  +  + CC R  CGP R F M V D     + H++R  +C   ++ C         + V     N+IG + Q++S  SP F I+N   + + ++ GP C    C D+ F + S+  E +                 G I+K W     ++   D +   I F   ++   K + L +  LI+ M+FE +
Sbjct:   15 EYLTTIDQLL---VKQKVEL-LEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQS-----IEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTGEKI-----------------GKISKQWS-GLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKA 222          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 67.0106 bits (162), Expect = 1.299e-12
Identity = 62/224 (27.68%), Postives = 104/224 (46.43%), Query Frame = 3
Query:  120 LLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFE 791
            L+S KI++ L++ +  +   N + + +   + ++  YE+S    CC R   G +R F M + D   N + HL R   +CD+ CCF SC     +        +IG V Q  +F  P F+I N   + + ++ GP CPC+C  D +FK+ S   E +                 G I+K W     ++   D +   +TF   ++   K L  A+  LI+ +Y+E
Sbjct:   65 LVSQKIEK-LEL-LTGFETKNRFKVKNSLGQNVYFAYEESD---CCTRNMLGRSRPFEMKILDNFQNEVLHLYRPF-KCDILCCFPSCMNAVEVSAPPG--QVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSDTNFKVLSANNEEI-----------------GKISKQWS-GLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 66.6254 bits (161), Expect = 2.633e-12
Identity = 56/235 (23.83%), Postives = 105/235 (44.68%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA-SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            ++ + I+ LL   ++Q +++ ++ +    + N +  K  +  +VY  +  + CC R  CGP R F M V D     + H++R  +C   ++ C         + V     N+IG + Q++S  SP F I+N   + + ++ GP C    C D+ F + S+  E +                 G I+K W     ++   D +   I F   ++   K + L +  LI+ M+FE +
Sbjct:  114 EYLTTIDQLL---VKQKVEL-LEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQS-----IEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTGEKI-----------------GKISKQWS-GLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKA 321          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 62.003 bits (149), Expect = 1.436e-10
Identity = 52/204 (25.49%), Postives = 88/204 (43.14%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA-SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N +  K  +  +VY  +  + CC R  CGP R F M V D     + H++R  +C   ++ C         + V     N+IG + Q++S  SP F I+N   + + ++ GP C    C D+ F + S+  E +                 G I+K W     ++   D +   I F   ++   K + L +  LI+ M+FE +
Sbjct:  225 NKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQS-----IEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTGEKI-----------------GKISKQWS-GLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKA 405          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 77.0258 bits (188), Expect = 2.500e-16
Identity = 66/239 (27.62%), Postives = 106/239 (44.35%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDID--IKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR----ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            ++ + I+ LL   +QQ +++   I  +   N Y + +   + +F V E++    CC R +CGP R F + V D +   +  L R     SC C          C   L +       IG VIQ +    P F I NEK+E + K+ GP C CRCC D++F + S+ E                    G I+K W     ++   D +N  I+F   ++   K +   +  LI+ M+FE+
Sbjct:   16 EYLTQIDQLL---VQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEEND---CCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGSCFCPC--------CLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCRCCSDVNFDVLSLDEST----------------KVGKISKQW-TGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 77.0258 bits (188), Expect = 2.500e-16
Identity = 66/239 (27.62%), Postives = 106/239 (44.35%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDID--IKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR----ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            ++ + I+ LL   +QQ +++   I  +   N Y + +   + +F V E++    CC R +CGP R F + V D +   +  L R     SC C          C   L +       IG VIQ +    P F I NEK+E + K+ GP C CRCC D++F + S+ E                    G I+K W     ++   D +N  I+F   ++   K +   +  LI+ M+FE+
Sbjct:   16 EYLTQIDQLL---VQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEEND---CCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGSCFCPC--------CLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCRCCSDVNFDVLSLDEST----------------KVGKISKQW-TGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 77.0258 bits (188), Expect = 2.500e-16
Identity = 66/239 (27.62%), Postives = 106/239 (44.35%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDID--IKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR----ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            ++ + I+ LL   +QQ +++   I  +   N Y + +   + +F V E++    CC R +CGP R F + V D +   +  L R     SC C          C   L +       IG VIQ +    P F I NEK+E + K+ GP C CRCC D++F + S+ E                    G I+K W     ++   D +N  I+F   ++   K +   +  LI+ M+FE+
Sbjct:   16 EYLTQIDQLL---VQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEEND---CCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGSCFCPC--------CLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCRCCSDVNFDVLSLDEST----------------KVGKISKQW-TGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 77.0258 bits (188), Expect = 5.923e-16
Identity = 66/239 (27.62%), Postives = 106/239 (44.35%), Query Frame = 3
Query:   96 QFQSNINCLLSFKIQQNLDID--IKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR----ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            ++ + I+ LL   +QQ +++   I  +   N Y + +   + +F V E++    CC R +CGP R F + V D +   +  L R     SC C          C   L +       IG VIQ +    P F I NEK+E + K+ GP C CRCC D++F + S+ E                    G I+K W     ++   D +N  I+F   ++   K +   +  LI+ M+FE+
Sbjct:   54 EYLTQIDQLL---VQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEEND---CCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGSCFCPC--------CLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCRCCSDVNFDVLSLDEST----------------KVGKISKQW-TGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 261          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 73.1738 bits (178), Expect = 1.080e-14
Identity = 55/206 (26.70%), Postives = 96/206 (46.60%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y + +   + +F   E+SH    C+R +CG  R F + + D +   +  L+R   +C         CC   L V     + +G V Q +    P F I NE++E + K++GP C C+CC D++F++ S+ E +                V G I+K W    + +   D +N  + F   ++   K + L +  LI+ M+FE++
Sbjct:   61 NQYVVKNSLGQQVFFAAEESHF---CSRMFCGSVRSFLLHIQDNMGQEVMTLSRP-LKCS---SCFFPCCLQELEVHSPSGSPLGYVTQSWHPYLPKFIIHNERKEPVLKILGPFCDCKCCSDVNFEVMSLDESS----------------VIGRISKQWS-GFEAEAFTDADNFGLQFPMDLDVKIKAVILGACFLIDFMFFEHT 242          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 85.5001 bits (210), Expect = 1.582e-18
Identity = 64/203 (31.53%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY  +  + CC R  CGP+R F+M + D     +  L+R  CRC   C          L V       +G VIQ +    P F I +E+E+ + K+ GP  PCRCC D+ F+I S+ E                  V G I K W    K +   D +N  I F   ++   K + L +  LI+ M+FE S
Sbjct:  139 NKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHR-PCRCSACCFPCCLQK---LEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCADVKFEIKSMDES----------------AVVGRITKQWTGFVK-EAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQS 320          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 85.1149 bits (209), Expect = 1.952e-18
Identity = 64/203 (31.53%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY  +  + CC R  CGP+R F+M + D     +  L+R  CRC   C          L V       +G VIQ +    P F I +E+E+ + K+ GP  PCRCC D+ F+I S+ E                  V G I K W    K +   D +N  I F   ++   K + L +  LI+ M+FE S
Sbjct:  134 NKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHR-PCRCSACCFPCCLQK---LEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCADVKFEIKSMDES----------------AVVGRITKQWTGFVK-EAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQS 315          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 78.5666 bits (192), Expect = 2.224e-16
Identity = 61/200 (30.50%), Postives = 92/200 (46.00%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYF 788
            N Y+ K  +  RVY  +  + CC R +CGP+R F M + D     +  L+R   RC         CC   L V      ++G V+Q +    P F I +E+E+ + K+ GP  PCRCC D++F++ SV E +                V G I+K W  S K +   D +N  I F   ++   K + L +  LI   +F
Sbjct:   99 NKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHR-PLRCSA---CCFPCCLQKLEVQAPPGTVVGYVVQNWHPCLPKFTIQDEREQGVLKISGPCIPCRCCTDVNFEVMSVDESS----------------VVGRISKQWAGSVK-EIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIVSSFF 277          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 67.781 bits (164), Expect = 1.803e-12
Identity = 59/205 (28.78%), Postives = 88/205 (42.93%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY       CC R  CG +R FT+ + D +   +  L R      C   CC          GV       +G V Q +    P F + NEK++ + KVVGP   C CC D+ F++ S+ EE+                V G I+K W    + +   D +N  I F   ++   K + L +  LI+ M+FE +
Sbjct:  136 NKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGV------PVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEES----------------VVGKISKQWSGFVR-EAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERT 317          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 67.781 bits (164), Expect = 1.803e-12
Identity = 59/205 (28.78%), Postives = 88/205 (42.93%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY       CC R  CG +R FT+ + D +   +  L R      C   CC          GV       +G V Q +    P F + NEK++ + KVVGP   C CC D+ F++ S+ EE+                V G I+K W    + +   D +N  I F   ++   K + L +  LI+ M+FE +
Sbjct:  136 NKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGV------PVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEES----------------VVGKISKQWSGFVR-EAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERT 317          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 56.6102 bits (135), Expect = 2.629e-9
Identity = 54/192 (28.12%), Postives = 73/192 (38.02%), Query Frame = 3
Query:  225 VYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            VY       CC R  C  +R FT+ + D +   +  L R      C   CC          GV       IG V Q +    P   + N+K E + KVVGP   C CC D+ F+I S+ E                    G I K W    K+    D +N  I F   +    K + L +  LI+ M+FE 
Sbjct:    2 VYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGV------PIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDE----------------VTRIGKITKQWSGCVKE-AFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 170          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 56.225 bits (134), Expect = 1.048e-8
Identity = 55/207 (26.57%), Postives = 81/207 (39.13%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N + I +   ++++   E +    CC R  C  +R FT+ + D +   +  L R      C   CC          GV       IG V Q +    P   + N+K E + KVVGP   C CC D+ F+I S+ E                    G I K W    K +   D +N  I F   +    K + L +  LI+ M+FE 
Sbjct:  125 NKFEIKNSLGQMVYVAVEDTD---CCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGV------PIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDE----------------VTRIGKITKQWSGCVK-EAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 56.225 bits (134), Expect = 1.048e-8
Identity = 55/207 (26.57%), Postives = 81/207 (39.13%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N + I +   ++++   E +    CC R  C  +R FT+ + D +   +  L R      C   CC          GV       IG V Q +    P   + N+K E + KVVGP   C CC D+ F+I S+ E                    G I K W    K +   D +N  I F   +    K + L +  LI+ M+FE 
Sbjct:  125 NKFEIKNSLGQMVYVAVEDTD---CCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGV------PIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDE----------------VTRIGKITKQWSGCVK-EAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|P58195|PLS1_RAT (Phospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.009e-11
Identity = 61/206 (29.61%), Postives = 89/206 (43.20%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCD---MWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY       CC R  CG +R FT+ + D +   +  L R   RC      CC          GV       +G VIQ +    P F + NEK + + KVVGP   C CC D+ F++ S+ EE+                V G I+K W    + +   D +N  I F   ++   K + L +  LI+ M+FE +
Sbjct:  144 NKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLER-PLRCSSCCFPCCLQEIEIQAPPGV------PVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEES----------------VVGKISKQWSGFVR-EAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERT 325          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|O15162|PLS1_HUMAN (Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.196e-11
Identity = 67/242 (27.69%), Postives = 101/242 (41.74%), Query Frame = 3
Query:  102 QSNINCLLSFKIQQNLD-------IDIKDYCKG-NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            Q  +NC    +    +D       I++ +   G  + N Y+ K     RVY  +    CC R  CGP+R FT+ + D +   +  L R      C   CC          GV       IG VIQ +    P F I NEK E + K+ GP   C CC D+ F+I S+ E+                 V G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE++
Sbjct:   90 QPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGV------PIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC----------------VVGKISKHW-TGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFEST 308          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q9JJ00|PLS1_MOUSE (Phospholipid scramblase 1 OS=Mus musculus OX=10090 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.261e-11
Identity = 59/205 (28.78%), Postives = 88/205 (42.93%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY       CC R  CG +R FT+ + D +   +  L R      C   CC          GV       +G V Q +    P F + NEK++ + KVVGP   C CC D+ F++ S+ EE+                V G I+K W    + +   D +N  I F   ++   K + L +  LI+ M+FE +
Sbjct:  136 NKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGV------PVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEES----------------VVGKISKQWSGFVR-EAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERT 317          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q3ZBG9|PLS2_BOVIN (Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.925e-11
Identity = 57/203 (28.08%), Postives = 87/203 (42.86%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFE 791
            N Y+ K  +  R+Y  +    CC R  CGP+R FTM + D +   +  L R      C   CC          GV       +G V Q +    P F I NE+ E + ++ GP   C CC D+ F++ S+ ++                +V G I+K W    K +   D +N  I F   ++   K + L +  LI+ M+FE
Sbjct:  109 NKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLRCTSCCFPCCLQEIEIQAPPGV------PVGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICSCCADIDFEVKSLDDK----------------YVVGKISKHWTGLIK-ELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 288          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q9DCW2|PLS2_MOUSE (Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3)

HSP 1 Score: 56.225 bits (134), Expect = 7.333e-8
Identity = 55/207 (26.57%), Postives = 81/207 (39.13%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRA--SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N + I +   ++++   E +    CC R  C  +R FT+ + D +   +  L R      C   CC          GV       IG V Q +    P   + N+K E + KVVGP   C CC D+ F+I S+ E                    G I K W    K +   D +N  I F   +    K + L +  LI+ M+FE 
Sbjct:  125 NKFEIKNSLGQMVYVAVEDTD---CCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGV------PIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDE----------------VTRIGKITKQWSGCVK-EAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|23910578 (tr|K1R4F4|K1R4F4_CRAGI Phospholipid scramblase OS=Crassostrea gigas OX=29159 GN=CGI_10011097 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.313e-17
Identity = 60/190 (31.58%), Postives = 100/190 (52.63%), Query Frame = 3
Query:  135 IQQNLDIDIKDYC-KGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIF-SVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHE 698
            ++Q ++ DI+  C   N+Y I++EKE+ +F V E +    C  RW+CGP+R F +      ++ +F L R SCRCD  CC +   CN+ + V D     +G + Q++      F +++   E++AK+ GP C  RCC +++F+I+  + EE +                 G+INK W+       N+DHE
Sbjct:   87 VRQQMETDIRGGCGSANTYKIWNEKEEELFYVLEDTS---CICRWFCGPHRQFQLEFFTPQDDLVFTLFRKSCRCDWCCCLDCVLCNHKVYVVDCLNRTLGSIKQKFGVCQGNFEVLDNDGEIVAKIFGPCCVFRCCTELTFEIWDKIGEEKL-----------------GSINKKWEGEQDTGINVDHE 256          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|21871464 (tr|A0A1X7VVQ2|A0A1X7VVQ2_AMPQE Phospholipid scramblase OS=Amphimedon queenslandica OX=400682 GN=100640566 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.482e-16
Identity = 66/218 (30.28%), Postives = 99/218 (45.41%), Query Frame = 3
Query:  144 NLDIDIKDYCKG-NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N  I++ +   G  + N Y  +  +  +VY  +    CC R +CGP+R F M + D     + HL R   RC  WCCF        + V      +IG V Q  S   P F + N   E + K+ GP CPC+CCYD+ F++ S   +  Q                G I+K W    K +   D +N  +TF   ++   K + LA+  LI+ M+FE+
Sbjct:   37 NQQIELLEIMTGFETQNKYKVRNSLGQQVYFAAEDSNCCLRQYCGPSRPFGMQILDNNQREVIHLERP-LRCSSWCCFCCLQT---MEVQSPPGTVIGFVEQDCSLVYPWFSLKNADGETVLKIKGPLCPCKCCYDVEFQVLSA--DGTQEV--------------GKISKKWSGLAK-EYFTDADNFGVTFPMDLDVKMKAVMLAATFLIDFMFFED 233          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|176468664 (tr|A0A5G3IYB4|A0A5G3IYB4_XENTR Phospholipid scramblase OS=Xenopus tropicalis OX=8364 GN=insyn1 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.483e-15
Identity = 64/203 (31.53%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY  +  + CC R  CGP+R F+M + D     +  L+R  CRC   C          L V       +G VIQ +    P F I +E+E+ + K+ GP  PCRCC D+ F+I S+ E                  V G I K W    K +   D +N  I F   ++   K + L +  LI+ M+FE S
Sbjct:  139 NKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHR-PCRCSACCFPCCLQK---LEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCADVKFEIKSMDES----------------AVVGRITKQWTGFVK-EAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQS 320          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|176475803 (tr|A0A5G3HBI2|A0A5G3HBI2_XENTR Phospholipid scramblase OS=Xenopus tropicalis OX=8364 GN=insyn1 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.064e-15
Identity = 64/203 (31.53%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY  +  + CC R  CGP+R F+M + D     +  L+R  CRC   C          L V       +G VIQ +    P F I +E+E+ + K+ GP  PCRCC D+ F+I S+ E                  V G I K W    K +   D +N  I F   ++   K + L +  LI+ M+FE S
Sbjct:  134 NKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHR-PCRCSACCFPCCLQK---LEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCADVKFEIKSMDES----------------AVVGRITKQWTGFVK-EAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQS 315          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|176473872 (tr|B5DDV8|B5DDV8_XENTR Phospholipid scramblase OS=Xenopus tropicalis OX=8364 GN=plscr1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.621e-15
Identity = 64/203 (31.53%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y+ K  +  RVY  +  + CC R  CGP+R F+M + D     +  L+R  CRC   C          L V       +G VIQ +    P F I +E+E+ + K+ GP  PCRCC D+ F+I S+ E                  V G I K W    K +   D +N  I F   ++   K + L +  LI+ M+FE S
Sbjct:  139 NKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHR-PCRCSACCFPCCLQK---LEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCADVKFEIKSMDES----------------AVVGRITKQWTGFVK-EAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQS 320          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 74.7146 bits (182), Expect = 3.129e-15
Identity = 61/206 (29.61%), Postives = 91/206 (44.17%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y + +   + +F V E++    CC R  CGP R F + V D +   +  L R              CC   L V     N IG VIQ++    P F + NEK E + ++ GP C C CC D++F++ S+ +E+ Q                G I K W     Q+   D +N  I F   ++   K +   +  LI+ M+FENS
Sbjct:   80 NKYLVKNTLGQQVFYVAEEND---CCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPL----RCASCCCPCCLQELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGPFCACNCCSDVNFEVMSM-DESTQ---------------VGRICKQW-TGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLIDFMFFENS 261          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 70.4774 bits (171), Expect = 7.019e-14
Identity = 56/212 (26.42%), Postives = 93/212 (43.87%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR----ASC--RCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y + +   + +F   E++     C R  CGP R F + + D     +  L R    +SC   C +            L V       IG VIQ++    P F I +E+++ + ++VGP C C CC D++F++ S+   +                V G I+K W    + +   D +N  + F   ++   K + L++  LI+ MYFENS
Sbjct:   61 NQYVVKNSLGQQVFLAAEENDF---CTRTMCGPMRSFVLHLQDNTGREVLTLTRPLNCSSCCFPCCL----------QELEVQSPPGQPIGYVIQKWHPYLPKFTIKDERKQSVMQIVGPFCDCNCCSDVNFEVMSLDGAS----------------VIGRISKQWT-GMEAEMLTDADNFGVQFPMDLDVKIKAVILSACFLIDFMYFENS 242          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3a (phospholipid scramblase 3a [Source:ZFIN;Acc:ZDB-GENE-060531-17])

HSP 1 Score: 64.3142 bits (155), Expect = 9.019e-12
Identity = 53/202 (26.24%), Postives = 79/202 (39.11%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N Y+ K  +  ++Y     + CC R  CGP R F + + D  +  + HL +              CC   + V     N IG V+Q +    P F ++    E L  V GP C   CC D+ F +                    +  V G I+K W    K+    D +N  I F   ++   K   L +  LI+ M+FEN
Sbjct:   31 NRYEIKNSMGQQIYYAKEQNDCCTRNCCGPQRSFDLKITDNTDQEVIHLVKPF----RCTSCCCPCCLQEMEVQAPPGNTIGYVVQNWHPFLPKFSLLGPSHETLLTVEGPMCTISCCGDVDFNVLG-----------------KDGSVIGRISKQWAGLIKEGLT-DADNFGINFPLDLDVRLKATLLGACFLIDFMFFEN 210          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 63.1586 bits (152), Expect = 3.530e-11
Identity = 56/198 (28.28%), Postives = 84/198 (42.42%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLI 773
            N Y + +   + +F V E++    CC R  CGP R F + V D +   +  L R              CC   L V     N IG VIQ++    P F + NEK E + ++ GP C C CC D++F++ S+ +E+ Q                G I K W     Q+   D +N  I F   ++   K +   +  LI
Sbjct:   80 NKYLVKNTLGQQVFYVAEEND---CCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPL----RCASCCCPCCLQELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGPFCACNCCSDVNFEVMSM-DESTQ---------------VGRICKQWT-GMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLI 253          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: ENSAMXT00000033378.1 (phospholipid scramblase family member 5-like [Source:NCBI gene;Acc:111190311])

HSP 1 Score: 63.1586 bits (152), Expect = 3.731e-11
Identity = 57/211 (27.01%), Postives = 88/211 (41.71%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCA-RWWCGPNRGFTMFVNDEINNSLFHLNRA----SCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
             +YNI  E  + +F   E++    CC     CGP R  ++   D+    +F   R     SC           CC   +  +   + LIG V Q++S  +P F + +        + G  CP RC  D  F++ S   E V                 GT+ K W     ++ NMDHE+  +   + +  N K+L LA+  L+N M+FE S
Sbjct:  120 RTYNITTETREQLFVAVEET----CCVCVQCCGPARSCSLQGFDQDRQHIFQFERPLRAESC--------CLGCCLMEMRAYTAQRELIGTVHQRWSMFTPYFEVCDASGSSSIWIQGSCCPVRCFADQEFQVVSTIGERV-----------------GTVWKKWP-GYNEECNMDHEHFGLDIPQNLCVNTKVLLLAATFLLNHMFFEMS 300          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO31512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP9])

HSP 1 Score: 75.0998 bits (183), Expect = 4.738e-16
Identity = 58/206 (28.16%), Postives = 86/206 (41.75%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            N Y I +   + ++  + K   D CC R  CGP R F M + D     + HL+R         CF   CC   + V     N++G V Q++    P F I +   + +  + GP C CRCC D+ F + S  +  V                 G + K W    K +   D EN  ITF   ++   K + L +  LI+ M+FE  
Sbjct:   42 NKYQITNSLGQQVY--FAKEDTD-CCTRQCCGPARPFEMEITDNTGREVIHLSRPL----RCACFCCWCCLQTIEVQAPRGNVVGYVEQEFYICKPKFTIKDANRQTILTMTGPICACRCCADVEFPVLSA-DGTVPV---------------GKVTKQWTGLIK-EAFTDAENFGITFPMDLDVKMKAVMLGAVFLIDFMFFETQ 223          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 49.6766 bits (117), Expect = 1.029e-6
Identity = 47/200 (23.50%), Postives = 80/200 (40.00%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDM-WXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLIN 776
            N Y I +   + +F   E +    CC R  CGP+R F + + D     + HL R   RC   W      CC   + V      ++G   Q +S   P + + +   + + ++ GP C    C D+ F++ S   +N                  G ++K W    K+    D +N  +TF   ++   K + + +A LI 
Sbjct:  115 NKYKITNNLGQQVFFAAEDTD---CCTRQCCGPSRPFDIKIMDNTQREVIHLTRP-LRCSSCW----FPCCLQEVEVQSPPGTVVGYCCQSWSICIPKYTLQDANRQTILQIEGPLCTFNICGDVEFQVLSADGQN----------------QVGKVSKQWSGLVKE-AFTDADNFGVTFPMDLDVKMKAVIIGTAFLIT 289          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 61.6178 bits (148), Expect = 8.689e-11
Identity = 61/250 (24.40%), Postives = 106/250 (42.40%), Query Frame = 3
Query:   60 TILMNNYRLNSSQFQSNINCLLSFKIQQNLDIDIKDYCKG----NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            T+L   +  +  +++S++ C    ++     +++ +   G    N Y I +   + +F   E++    C +R  CGP R FT+ V D     +  + R   +C         CC   L V     N +G VIQQ+    P F + NE  E + K+ GP C   C  D+ F+I ++ E N                  G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE +
Sbjct:   20 TVLFAEFE-SEPKYKSSVYCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEEND---CLSRQCCGPLRSFTIHVLDNFGQEIITVTRP-LKC---MSCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFCGWSCLPDVDFEILTMDEVN----------------KIGKISKQWT-GLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETT 244          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 61.6178 bits (148), Expect = 8.689e-11
Identity = 61/250 (24.40%), Postives = 106/250 (42.40%), Query Frame = 3
Query:   60 TILMNNYRLNSSQFQSNINCLLSFKIQQNLDIDIKDYCKG----NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            T+L   +  +  +++S++ C    ++     +++ +   G    N Y I +   + +F   E++    C +R  CGP R FT+ V D     +  + R   +C         CC   L V     N +G VIQQ+    P F + NE  E + K+ GP C   C  D+ F+I ++ E N                  G I+K W     ++   D +N  I F   ++   K + + +  LI+ M+FE +
Sbjct:   20 TVLFAEFE-SEPKYKSSVYCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEEND---CLSRQCCGPLRSFTIHVLDNFGQEIITVTRP-LKC---MSCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFCGWSCLPDVDFEILTMDEVN----------------KIGKISKQWT-GLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETT 244          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 51.2174 bits (121), Expect = 4.379e-7
Identity = 50/201 (24.88%), Postives = 77/201 (38.31%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFE 791
            N Y+ K  +  ++Y     + CC R  CG  R F M + D  +  +  L R              CC   + V       +G V Q +    P F I    +E L ++ GP   C CC D+SF++    E  +                 G I K W    K +   D +N  I F   ++   K + + +  LI+ M+FE
Sbjct:   99 NQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPF----RCVSCCCPCCLQEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACNCCGDVSFELKGKDETPI-----------------GRITKQWSGLLK-EVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 51.2174 bits (121), Expect = 4.379e-7
Identity = 50/201 (24.88%), Postives = 77/201 (38.31%), Query Frame = 3
Query:  189 NIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFE 791
            N Y+ K  +  ++Y     + CC R  CG  R F M + D  +  +  L R              CC   + V       +G V Q +    P F I    +E L ++ GP   C CC D+SF++    E  +                 G I K W    K +   D +N  I F   ++   K + + +  LI+ M+FE
Sbjct:   99 NQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPF----RCVSCCCPCCLQEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACNCCGDVSFELKGKDETPI-----------------GRITKQWSGLLK-EVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000016647.1 (SMESG000016647.1)

HSP 1 Score: 152.14 bits (383), Expect = 2.460e-44
Identity = 83/243 (34.16%), Postives = 126/243 (51.85%), Query Frame = 3
Query:  111 INCLLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKIFS--------------VYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS 797
            ++ L + ++QQ +  D+K+ C GNSY ++DE    I R+ EK   + CC+RWWCGP RGF M   D     + H+ R  CRCD WCC +   C++ + + D  KN +G   Q+ S  +P   IV+  +E +  + GP CPCRC  D++F +F+                +     +    ++   NF+  G I K W  ST    NMDHEN ++     M++  + L L S  L++ MYFE S
Sbjct:   29 LDGLQNVRVQQQMPRDLKECCHGNSYKVFDENGNTILRILEKPDCNNCCSRWWCGPARGFRMVAYDNNRRPIMHMRRHPCRCDAWCCLDCVFCSHRITISDGDKNYLGFGKQKCSCCAPNISIVDSTDEPVGTIRGPCCPCRCLCDLTFNVFTPDGKGPSVVKDFAITDQPGSMTSLKSAESYVENFYYSGKIEKRWTKSTYPRINMDHENIMMRIPDDMDTVERALLLGSMFLVDFMYFEVS 271          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000062579.1 (SMESG000062579.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.400e-35
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 3
Query:  351 RCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCRCCYDMSFKI 563
            RCDMWCCFNSCCCNNFLGVFDNYKNLIGKVIQQYSFSSPLFHIVNE EEVLAKVVGPPCPCRCCYDMSFK+
Sbjct:    6 RCDMWCCFNSCCCNNFLGVFDNYKNLIGKVIQQYSFSSPLFHIVNENEEVLAKVVGPPCPCRCCYDMSFKV 76          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.287e-13
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR---ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCR---CCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N Y I +   + ++   E+S +   CAR  CGP RGF M + D +   +    R           CC     C   L V       IG+VIQQ S   P + I N  EE + ++ GP C C+   C +D  FK+FS                ++     G I+K W      +   D +N  ++F   ++   K   LA+  LI+ M+FEN
Sbjct:  212 NKYQIKNSLGQQVYYAAEESDV---CARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFS----------------SDMSTELGRISKQWS-GFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFEN 402          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.653e-13
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR---ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCR---CCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N Y I +   + ++   E+S +   CAR  CGP RGF M + D +   +    R           CC     C   L V       IG+VIQQ S   P + I N  EE + ++ GP C C+   C +D  FK+FS                ++     G I+K W      +   D +N  ++F   ++   K   LA+  LI+ M+FEN
Sbjct:  226 NKYQIKNSLGQQVYYAAEESDV---CARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFS----------------SDMSTELGRISKQWS-GFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFEN 416          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.856e-13
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  180 NSYNIYDEKEKIIFRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNR---ASCRCDMWXXXXXXXXXXXLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVGPPCPCR---CCYDMSFKIFSVYEENVQXXXXXXXXXXXXFHVCGTINKIWDMSTKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFEN 794
            N Y I +   + ++   E+S +   CAR  CGP RGF M + D +   +    R           CC     C   L V       IG+VIQQ S   P + I N  EE + ++ GP C C+   C +D  FK+FS                ++     G I+K W      +   D +N  ++F   ++   K   LA+  LI+ M+FEN
Sbjct:  223 NKYQIKNSLGQQVYYAAEESDV---CARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTWDQEFKVFS----------------SDMSTELGRISKQWS-GFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFEN 413          
The following BLAST results are available for this feature:
BLAST of Phospholipid scramblase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLSCR12.590e-1328.57phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR12.242e-1227.69phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR12.490e-1227.69phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR12.897e-933.08phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR11.183e-730.72phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scrm-29.182e-620.75Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scramb14.669e-1323.83gene:FBgn0052056 transcript:FBtr0076302[more]
scramb21.299e-1227.68gene:FBgn0035390 transcript:FBtr0073005[more]
scramb12.633e-1223.83gene:FBgn0052056 transcript:FBtr0076303[more]
scramb11.436e-1025.49gene:FBgn0052056 transcript:FBtr0076301[more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.12.500e-1627.62si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.12.500e-1627.62si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.12.500e-1627.62si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.15.923e-1627.62si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.51.080e-1426.70si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
insyn11.582e-1831.53inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn11.952e-1831.53inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.12.224e-1630.50phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plscr11.803e-1228.78phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr11.803e-1228.78phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr22.629e-928.13phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr21.048e-826.57phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr21.048e-826.57phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid scramblase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58195|PLS1_RAT1.009e-1129.61Phospholipid scramblase 1 OS=Rattus norvegicus OX=... [more]
sp|O15162|PLS1_HUMAN1.196e-1127.69Phospholipid scramblase 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q9JJ00|PLS1_MOUSE1.261e-1128.78Phospholipid scramblase 1 OS=Mus musculus OX=10090... [more]
sp|Q3ZBG9|PLS2_BOVIN8.925e-1128.08Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN... [more]
sp|Q9DCW2|PLS2_MOUSE7.333e-826.57Phospholipid scramblase 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Phospholipid scramblase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|239105782.313e-1731.58tr|K1R4F4|K1R4F4_CRAGI Phospholipid scramblase OS=... [more]
gnl|BL_ORD_ID|218714641.482e-1630.28tr|A0A1X7VVQ2|A0A1X7VVQ2_AMPQE Phospholipid scramb... [more]
gnl|BL_ORD_ID|1764686642.483e-1531.53tr|A0A5G3IYB4|A0A5G3IYB4_XENTR Phospholipid scramb... [more]
gnl|BL_ORD_ID|1764758033.064e-1531.53tr|A0A5G3HBI2|A0A5G3HBI2_XENTR Phospholipid scramb... [more]
gnl|BL_ORD_ID|1764738724.621e-1531.53tr|B5DDV8|B5DDV8_XENTR Phospholipid scramblase OS=... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.13.129e-1529.61phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch211-71m22.57.019e-1426.42si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
plscr3a9.019e-1226.24phospholipid scramblase 3a [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-71m22.13.530e-1128.28phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000033378.13.731e-1127.01phospholipid scramblase family member 5-like [Sour... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315124.738e-1628.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461091.029e-623.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-206p6.18.689e-1124.40phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.18.689e-1124.40phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
plscr3b4.379e-724.88phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b4.379e-724.88phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid scramblase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016647.12.460e-4434.16SMESG000016647.1[more]
SMESG000062579.11.400e-3597.18SMESG000062579.1[more]
SMESG000043802.15.287e-1328.44SMESG000043802.1[more]
SMESG000043802.16.653e-1328.44SMESG000043802.1[more]
SMESG000043802.16.856e-1328.44SMESG000043802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011648 ID=SMED30011648|Name=Phospholipid scramblase|organism=Schmidtea mediterranea sexual|type=transcript|length=882bp
ATTGTAACTATGCTAATAAATGTTAATTTAACTATAAACGCTGTCTTTAT
TGAGTAAGAACTATTTTAATGAATAATTACAGATTAAATTCATCTCAATT
TCAATCGAACATTAATTGTTTATTGAGTTTCAAAATTCAGCAAAATCTTG
ATATTGATATAAAAGATTATTGTAAAGGAAATTCGTATAATATATATGAT
GAAAAAGAAAAAATTATATTTAGAGTTTATGAAAAATCTCATATCGATTA
TTGTTGTGCGCGTTGGTGGTGTGGACCTAATCGAGGTTTCACCATGTTTG
TAAATGACGAGATAAATAATAGTTTATTTCATTTAAATAGAGCATCATGC
AGATGTGACATGTGGTGTTGCTTCAATTCCTGTTGTTGCAATAATTTTCT
TGGTGTATTTGATAATTACAAGAATTTAATTGGAAAAGTTATTCAACAAT
ATTCATTTTCGTCTCCATTATTTCATATTGTCAATGAAAAGGAAGAAGTC
CTTGCAAAAGTTGTTGGGCCTCCATGTCCCTGTCGATGCTGTTATGATAT
GAGTTTCAAAATTTTTTCAGTTTATGAGGAAAATGTACAGAATAATGAAA
GTTTATTGAAAAATGAAAATAATAATTTTCATGTTTGTGGAACTATCAAT
AAAATTTGGGACATGTCGACAAAACAAGATACTAACATGGATCACGAAAA
TTGTGTCATTACGTTTTCAAAACAAATGAATTCCAACTTTAAGATATTGA
ATTTAGCGAGTGCTCTCCTCATTAATGTTATGTACTTTGAGAATTCCTAA
GAATTGATTTAATAGATTTTGTGAAAAATATTTCAGTTAATTAAATAGAT
TTGTTTTCTGTATTAAAAATAAGCAAATAGAT
back to top

protein sequence of SMED30011648-orf-1

>SMED30011648-orf-1 ID=SMED30011648-orf-1|Name=SMED30011648-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MNNYRLNSSQFQSNINCLLSFKIQQNLDIDIKDYCKGNSYNIYDEKEKII
FRVYEKSHIDYCCARWWCGPNRGFTMFVNDEINNSLFHLNRASCRCDMWC
CFNSCCCNNFLGVFDNYKNLIGKVIQQYSFSSPLFHIVNEKEEVLAKVVG
PPCPCRCCYDMSFKIFSVYEENVQNNESLLKNENNNFHVCGTINKIWDMS
TKQDTNMDHENCVITFSKQMNSNFKILNLASALLINVMYFENS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007268chemical synaptic transmission
GO:0017121phospholipid scrambling
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005886plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR005552Scramblase
Vocabulary: molecular function
TermDefinition
GO:0017128phospholipid scramblase activity