tRNA wybutosine-synthesizing protein 3 homolog

Overview
NametRNA wybutosine-synthesizing protein 3 homolog
Smed IDSMED30011644
Length (bp)663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA wybutosine-synthesizing protein 3 homolog (SMED30011644) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA wybutosine-synthesizing protein 3 homolog (SMED30011644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA wybutosine-synthesizing protein 3 homolog (SMED30011644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA wybutosine-synthesizing protein 3 homolog (SMED30011644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011644SMESG000069969.1 SMESG000069968.1 Contig3873uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011644SMESG000069969.1 SMESG000069968.1 Contig3873newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011644SMESG000049478.1 Contig3873uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011644SMESG000049478.1 Contig3873newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig564uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig564newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000054821.1 Contig563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000054821.1 Contig563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000001228.1 Contig564uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000001228.1 Contig564newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000037024.1 Contig562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000037024.1 Contig562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000069968.1 SMESG000069969.1 Contig565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000076325.1 Contig565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011644SMESG000076325.1 Contig565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30011644SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Human
Match: TYW3 (tRNA-yW synthesizing protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:24757])

HSP 1 Score: 117.472 bits (293), Expect = 1.180e-31
Identity = 74/174 (42.53%), Postives = 112/174 (64.37%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHC-CAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD D++ L+  LN      + TTSSC+GRI++  +  +    QKQNC W+ V+H+    ++++  LK   G+  +K+EPF+LH  C +  D AQ L    I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++    N+KM  N +R  +F
Sbjct:   19 DLSRKGSVDEDVVELVQFLNMRDQ--FFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQD-AQILHSMAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-KGKLMVTEEYIDFLLNVANQKMEENKKRIERF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Human
Match: TYW3 (tRNA-yW synthesizing protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:24757])

HSP 1 Score: 81.2629 bits (199), Expect = 3.646e-18
Identity = 62/173 (35.84%), Postives = 96/173 (55.49%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD D++ L+  LN      + TTSSC+GRI++  +  +    QKQNC W+ V+H+ +C ++ V ++                                 I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++    N+KM  N +R  +F
Sbjct:   19 DLSRKGSVDEDVVELVQFLNMRDQ--FFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHK-LCVKDDVHSM--------------------------------AIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-KGKLMVTEEYIDFLLNVANQKMEENKKRIERF 155          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Human
Match: TYW3 (tRNA-yW synthesizing protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:24757])

HSP 1 Score: 65.855 bits (159), Expect = 3.268e-13
Identity = 33/68 (48.53%), Postives = 50/68 (73.53%), Query Frame = 2
Query:  389 GIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
             I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++    N+KM  N +R  +F
Sbjct:    2 AIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-KGKLMVTEEYIDFLLNVANQKMEENKKRIERF 68          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Human
Match: TYW3 (tRNA-yW synthesizing protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:24757])

HSP 1 Score: 57.3806 bits (137), Expect = 5.886e-11
Identity = 28/56 (50.00%), Postives = 43/56 (76.79%), Query Frame = 2
Query:  389 GIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNE 553
             I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++    N+
Sbjct:    2 AIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-KGKLMVTEEYIDFLLNVANQ 56          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Zebrafish
Match: tyw3 (tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) [Source:NCBI gene;Acc:436884])

HSP 1 Score: 108.612 bits (270), Expect = 1.525e-28
Identity = 62/161 (38.51%), Postives = 97/161 (60.25%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNVMELLSNLLKP 631
            Y TTSSCSGRI+++         QKQNC W+ V+H+    E++V  L+   G+   K+EPF+LH   K  + AQ L    I SGFR SGI++GK+ K ++A+RS++ ++VPL+  +  +LV+ +Y+ ++    N+KM  N +R  +F     E L   L+P
Sbjct:   42 YFTTSSCSGRIILFDAVSDCPDVQKQNCSWLFVTHQKCQMEDVVRGLEKSVGDATFKFEPFVLHVQCKQLEDAQLLHTVAINSGFRNSGITVGKKGKIIMAVRSTHCLEVPLSHRS-HVLVTHQYLDFLVGVANQKMEENLKRIQRFS----ECLQAALQP 197          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Xenopus
Match: tdp1 (tyrosyl-DNA phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-950568])

HSP 1 Score: 122.865 bits (307), Expect = 8.817e-34
Identity = 67/156 (42.95%), Postives = 102/156 (65.38%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHC-CAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNVMELL 613
            Y TTSSCSGR+++  +T      QKQNC W+ V+H+   P+++   LK+  G+  +K+EPF+LH  C K  D AQ L    I SGFR SGI++GK+ K ++A+RS++ ++VPLT   GK LVS EYI+++ +  N KM  N +R ++F   +++ L
Sbjct:   43 YFTTSSCSGRVIMINETLDSSIIQKQNCSWLFVTHQLCKPDDVFAALKNATGDVVLKFEPFVLHVQCHKLED-AQILHGVAINSGFRNSGITVGKKGKIIMAVRSTHGLEVPLTQN-GKCLVSQEYIEFLVQTANRKMEENKRRITRFHSCLLKAL 196          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Mouse
Match: Tyw3 (tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2445040])

HSP 1 Score: 119.398 bits (298), Expect = 1.638e-32
Identity = 71/173 (41.04%), Postives = 106/173 (61.27%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVY----QKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD     +      NS   + TTSSC+GRI++     + +  QKQ+C W+ V+H+    ++++  LK    E  +K+EPFILH   +T   AQ L    I SGFR SGI++GKR KTM+A+R ++ ++VPLT   GKL+V++EYI+++    N+KM  N +R  +F
Sbjct:   19 DLSRKGSVD--EDAVEVVELLNSREEFFTTSSCAGRILLLDGSTEGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTLHSVAIDSGFRNSGITVGKRGKTMLAVRGTHGLEVPLTH-KGKLMVTEEYIEFLLTIANQKMEENKRRIGRF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Mouse
Match: Tyw3 (tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2445040])

HSP 1 Score: 82.8037 bits (203), Expect = 8.871e-20
Identity = 52/128 (40.62%), Postives = 74/128 (57.81%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVY----QKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAI 454
            D SRK SVD     +      NS   + TTSSC+GRI++     + +  QKQ+C W+ V+H+    ++++  LK    E  +K+EPFILH   +T   AQ L    I SGFR SGI++GKR KTM+ +
Sbjct:   19 DLSRKGSVD--EDAVEVVELLNSREEFFTTSSCAGRILLLDGSTEGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTLHSVAIDSGFRNSGITVGKRGKTMLVL 144          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Mouse
Match: Tyw3 (tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2445040])

HSP 1 Score: 62.7734 bits (151), Expect = 5.359e-12
Identity = 47/144 (32.64%), Postives = 70/144 (48.61%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVY----QKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPLTDGTGKL 505
            D SRK SVD     +      NS   + TTSSC+GRI++     + +  QKQ+C W+ V+H+    ++++  LK    E  +K+EPFILH   +T   AQ L                       A+R ++ ++VPLT   GKL
Sbjct:   42 DLSRKGSVD--EDAVEVVELLNSREEFFTTSSCAGRILLLDGSTEGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTL-----------------------AVRGTHGLEVPLTH-KGKL 159          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Match: sp|Q641F8|TYW3_XENLA (tRNA wybutosine-synthesizing protein 3 homolog OS=Xenopus laevis OX=8355 GN=tyw3 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.942e-32
Identity = 61/147 (41.50%), Postives = 97/147 (65.99%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            Y TTSSCSGR+++  +T      QKQNC W+ V+H+   P+++   L++  G+  +K+EPF+LH   +  + AQ L    I +GFR SGI++GK+ K ++A+RS++ ++VPLT   GK LVS EYI+++    N+KM  N +R ++F
Sbjct:   43 YFTTSSCSGRVIIINETLDNSTIQKQNCSWLFVTHKLCKPDDVFAALQNATGDVVLKFEPFVLHVQCRALEDAQLLHSVAINAGFRNSGITVGKKGKIIMAVRSTHGLEVPLTQN-GKCLVSHEYIEFLVHTANKKMEENKRRITRF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Match: sp|Q8BSA9|TYW3_MOUSE (tRNA wybutosine-synthesizing protein 3 homolog OS=Mus musculus OX=10090 GN=Tyw3 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.146e-31
Identity = 71/173 (41.04%), Postives = 106/173 (61.27%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVY----QKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD     +      NS   + TTSSC+GRI++     + +  QKQ+C W+ V+H+    ++++  LK    E  +K+EPFILH   +T   AQ L    I SGFR SGI++GKR KTM+A+R ++ ++VPLT   GKL+V++EYI+++    N+KM  N +R  +F
Sbjct:   19 DLSRKGSVD--EDAVEVVELLNSREEFFTTSSCAGRILLLDGSTEGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTLHSVAIDSGFRNSGITVGKRGKTMLAVRGTHGLEVPLTH-KGKLMVTEEYIEFLLTIANQKMEENKRRIGRF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Match: sp|Q5E9U4|TYW3_BOVIN (tRNA wybutosine-synthesizing protein 3 homolog OS=Bos taurus OX=9913 GN=TYW3 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.361e-31
Identity = 68/173 (39.31%), Postives = 108/173 (62.43%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD     L      N    + TTSSC+GRI++  ++ +    QKQNC W+ V+H++   ++++  L+  +G+  +K+EP +LH   +    AQ L    I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++ +  N+KM  N +R  +F
Sbjct:   19 DLSRKGSVD--EDVLEIVQLLNGQEQFFTTSSCAGRIILLDRSVNGSEVQKQNCCWLLVTHKACVKDDVIVALQKAKGDAILKFEPLVLHVQCRQLQDAQILHSVAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-QGKLMVTEEYINFLLKIANQKMEENKKRIERF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Match: sp|Q6IPR3|TYW3_HUMAN (tRNA wybutosine-synthesizing protein 3 homolog OS=Homo sapiens OX=9606 GN=TYW3 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 5.668e-31
Identity = 74/174 (42.53%), Postives = 112/174 (64.37%), Query Frame = 2
Query:   86 DKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHC-CAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            D SRK SVD D++ L+  LN      + TTSSC+GRI++  +  +    QKQNC W+ V+H+    ++++  LK   G+  +K+EPF+LH  C +  D AQ L    I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++    N+KM  N +R  +F
Sbjct:   19 DLSRKGSVDEDVVELVQFLNMRDQ--FFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQD-AQILHSMAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSH-KGKLMVTEEYIDFLLNVANQKMEENKKRIERF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Match: sp|Q19QT9|TYW3_PIG (tRNA wybutosine-synthesizing protein 3 homolog OS=Sus scrofa OX=9823 GN=TYW3 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.641e-31
Identity = 61/147 (41.50%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            + TTSSC+GRI++ ++       QKQNC W+ VSH+    ++++  LK   G+  +K+EP +LH   +    AQ L    I SGFR SGI++GKR KTM+A+RS++ ++VPL+   GKL+V++EYI ++ +  N KM  N +R  +F
Sbjct:   43 FFTTSSCAGRIILLEQGMDSLEVQKQNCCWLLVSHKPCVKDDVIVALKKANGDAILKFEPLVLHVQCRQLQDAQILHSVAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLS-HKGKLMVTEEYIDFLLKIANHKMEENKKRIERF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Match: A0A267GY03 (TYW3 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005776g2 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.389e-36
Identity = 85/185 (45.95%), Postives = 120/185 (64.86%), Query Frame = 2
Query:   47 FLLH*SN*N*MEIDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS-QKQNCKWIKVSHESVCPEEIVENLKDLE--GETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            FLL+ S    M  DKSRK  +D+ I ++ID +N +     STTSSCSGRIVVYQK  + +K NC W+ V HE +  E++ ++L+++   G  F K+EPFILHC     + A+ LL  G+ SGFRESGI +GK  +  VAIRSS  M+VPLT+ +GK++V DEY+  +    N++M    +RR +F
Sbjct:    1 FLLYLS----MAEDKSRKGEIDSPIRDMIDEINIDPK--LSTTSSCSGRIVVYQKLENIRKTNCNWLLVLHEPINLEQLQDSLRNVTTGGIVFAKFEPFILHCQCADMETARCLLICGLNSGFRESGIVVGKNDRFTVAIRSSQIMEVPLTNNSGKVIVPDEYLDQLVSLLNQRMQVTAERRDKF 179          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Match: A0A267GLS1 (TYW3 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005776g5 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.468e-36
Identity = 81/175 (46.29%), Postives = 115/175 (65.71%), Query Frame = 2
Query:   77 MEIDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS-QKQNCKWIKVSHESVCPEEIVENLKDLE--GETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            M  DKSRK  +D+ I ++ID +N +     STTSSCSGRIVVYQK  + +K NC W+ V HE +  E++ ++L+++   G  F K+EPFILHC     + A+ LL  G+ SGFRESGI +GK  +  VAIRSS  M+VPLT+ +GK++V DEY+  +    N++M    +RR +F
Sbjct:    5 MAEDKSRKGEIDSPIRDMIDEINIDPK--MSTTSSCSGRIVVYQKLENIRKTNCNWLLVLHEPINLEQLQDSLRNVTTGGIVFAKFEPFILHCQCADMETARCLLICGLNSGFRESGIVVGKNDRFTVAIRSSQIMEVPLTNNSGKVIVPDEYLDQLVSLLNQRMQVTAERRDKF 177          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Match: A0A0B7AZI4 (TYW3 domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF152557 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.616e-33
Identity = 75/176 (42.61%), Postives = 108/176 (61.36%), Query Frame = 2
Query:   83 IDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQ--KTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLG-KRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNV 601
            +D SRK SVD            NS   Y TTSSCSGR ++ +  +   QK+ CKW+ VSH+ V   +I   LK+L GE  +K+EP ++H   +  D AQ++  A +A+GFR SGI++G K K M+A+RS+++++ PL+D  GK+LVS EY+KY+    N KM  N  R  +F  NV
Sbjct:   14 VDLSRKGSVD--EALHEVVNLINSLPMYFTTSSCSGRTILVENLEKKVQKKGCKWLYVSHDPVVETDIENALKELIGEAVLKFEPMVMHIQCQALDDAQRMHQAAVAAGFRNSGITVGLKGKIMIAVRSTHSLEAPLSD-EGKILVSQEYLKYLTVSANGKMQENFARIHRFHENV 186          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Match: A0A2C9LAJ5 (TYW3 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106063801 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 3.371e-33
Identity = 67/144 (46.53%), Postives = 98/144 (68.06%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKT-PSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISL-GKRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            Y TTSSCSGRI++++    + K+ CKW+ VSH  V  EEI+ +L  +  E   K+EPFI+H   +T + AQKL  A +A+GFR SGI++ GK K M+A+RS+++++ PL+   GKL+VS EYIK++ E  N+KM  N  R  +F
Sbjct:   39 YFTTSSCSGRILIFENDLQADKKGCKWLYVSHTYVTLEEILTHLTAVPDEAVFKFEPFIMHVQCQTLEDAQKLHQAAVAAGFRNSGITIGGKGKIMMAVRSTHSLEAPLS-SEGKLIVSQEYIKFLTECANKKMEENKNRIHRF 181          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Match: A0A0P5TPJ4 (tRNA wybutosine-synthesizing protein OS=Daphnia magna OX=35525 GN=APZ42_015170 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 7.065e-32
Identity = 73/161 (45.34%), Postives = 99/161 (61.49%), Query Frame = 2
Query:  164 YSTTSSCSGRIVVYQKT----PS-QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKT--------MVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNVME 607
            Y TTSSCSGRIVV  +T    PS QKQ C+W+ VSH     EEI   L    G+   K+E F+LH   +T D AQ +L  G+ +GFR SGISL  RK         MVAIRS++ ++VPL+  +GKLLV+ EY+ ++  K N  M  N +R S+F+ N+++
Sbjct:   42 YFTTSSCSGRIVVLAETAEEEPSVQKQGCQWVFVSHSKCSWEEIYSKLDTSIGDLSFKFEAFVLHVQCRTLDDAQLMLSCGVQAGFRNSGISLKSRKNSHQEWPKIMVAIRSTHGIEVPLS-ASGKLLVTSEYVDHVVTKANILMEENFKRISRFQQNLIQ 201          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Cavefish
Match: tyw3 (tRNA-yW synthesizing protein 3 homolog [Source:NCBI gene;Acc:103027647])

HSP 1 Score: 116.316 bits (290), Expect = 1.611e-31
Identity = 64/147 (43.54%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  164 YSTTSSCSGRIV----VYQKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            Y TTSSCSGRI+    V   T  QKQNC W+ V+HE    E+++  L+   G+   K+EP +LH   +  + AQ L    I SGFR SG+++GK+ KT++A+RS++ ++VPL+   G++LVS+EYI++I E  N KM  N +R  +F
Sbjct:   43 YFTTSSCSGRIILIDGVSDCTDVQKQNCSWLFVTHEKCQKEDVITALEKSSGDAVFKFEPCVLHVQCRQLENAQLLHSVAINSGFRNSGVTVGKKGKTIMAVRSTHCLEVPLS-RRGRVLVSEEYIEFIVETANNKMEENLKRIERF 188          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008597.1 (pep scaffold:Pmarinus_7.0:GL486775:3603:7409:-1 gene:ENSPMAG00000007789.1 transcript:ENSPMAT00000008597.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.302e-18
Identity = 39/103 (37.86%), Postives = 64/103 (62.14%), Query Frame = 2
Query:  281 VENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQ 586
            VE L+   G++  K+EPF+LH      + AQ L    + SGFR SGI++GK+ K +VA+RS++ ++VPL    G+L+V  +Y+ ++    N KM  N +R ++
Sbjct:    1 VEGLRGATGDSVFKFEPFVLHVHCLRLEEAQLLHMVAVESGFRNSGITVGKKGKIIVAVRSTHALEVPLCQ-AGRLMVPHDYLAFLVAIANGKMAENRERVAR 102          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Yeast
Match: TYW3 (tRNA methyltransferase required for synthesis of wybutosine; a modified guanosine found at the 3'-position adjacent to the anticodon of phenylalanine tRNA which supports reading frame maintenance by stabilizing codon-anticodon interactions [Source:SGD;Acc:S000003018])

HSP 1 Score: 63.5438 bits (153), Expect = 1.109e-12
Identity = 54/170 (31.76%), Postives = 78/170 (45.88%), Query Frame = 2
Query:  170 TTSSCSGRIVVY-QKTPSQKQNCK---------WIKVSHESVCPEEIVENLKDLEGET-----------------------FIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPL-----TDGTGKLLVSDEYIKYI----CEKFNE 553
            TTSSCSGR+ V+ + T S     K         W+ V+H+    E+++  L +L+ ++                         KYEPFILH   +    A KL +  ++ GFRESGI       +VAIR +  +DVPL     T GT K  V+ EY+  +      KF+E
Sbjct:   50 TTSSCSGRVSVFLEGTKSYNGEVKIGGKGQGGKWLYVTHDR---EKVIGWLDELKSKSEFSFELSGKEIPTEKVTGSIRYILYKYEPFILHVKCRDFQAASKLYNTAMSCGFRESGIG---SNNLVAIRINIKLDVPLGYLDETSGTLKFFVTPEYVSVLDSLSLSKFDE 213          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Nematostella
Match: EDO43291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ42])

HSP 1 Score: 58.9214 bits (141), Expect = 5.881e-11
Identity = 31/79 (39.24%), Postives = 52/79 (65.82%), Query Frame = 2
Query:  380 LHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNVMELL 613
            L A + SG++ SGI +G++ + M+A+RS+++++VPL    G LLVS EYI+Y+ +  N+KM  N  R  +F   + E +
Sbjct:   56 LKASLESGYKNSGIVIGRKSRYMMAVRSTHSLEVPLI-CNGNLLVSKEYIQYVVDMANKKMEDNKDRIQRFYTKLKEAI 133          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Medaka
Match: tyw3 (tRNA-yW synthesizing protein 3 homolog [Source:NCBI gene;Acc:101155543])

HSP 1 Score: 116.701 bits (291), Expect = 1.189e-31
Identity = 69/175 (39.43%), Postives = 106/175 (60.57%), Query Frame = 2
Query:   83 IDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHC-CAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQF 589
            +D+SRK SVD            NS   + TTSSCSGRIV+    P     QK++C+W+ +SH+    E++V  L    GE  +K+E F+LH  C +  D AQ L    + SGFR SG+++ +  K ++A+RS++ ++VPL+ G GKLLV +EY+ ++ +K N+KM  N +R  +F
Sbjct:   19 LDQSRKGSVD--ERARHVVCLLNSQERFFTTSSCSGRIVLMDGPPEGGVVQKKDCRWLFISHDPCRSEDLVSALSRSSGEAVLKFEAFVLHVQCHRLED-AQLLHSVAVNSGFRNSGLTVSRSGKIIMAVRSTHGLEVPLSHG-GKLLVGEEYVHFLTQKANQKMEENFRRIHRF 189          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Medaka
Match: tyw3 (tRNA-yW synthesizing protein 3 homolog [Source:NCBI gene;Acc:101155543])

HSP 1 Score: 115.546 bits (288), Expect = 5.821e-31
Identity = 68/172 (39.53%), Postives = 105/172 (61.05%), Query Frame = 2
Query:   80 EIDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPS----QKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHC-CAKTNDLAQKLLHAGIASGFRESGISLGKR-KTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQR 577
            ++D+SRK SVD            NS   + TTSSCSGRIV+    P     QK++C+W+ +SH+    E++V  L    GE  +K+E F+LH  C +  D AQ L    + SGFR SG+++ +  K ++A+RS++ ++VPL+ G GKLLV +EY+ ++ +K N+KM  N +R
Sbjct:   18 KLDQSRKGSVD--ERARHVVCLLNSQERFFTTSSCSGRIVLMDGPPEGGVVQKKDCRWLFISHDPCRSEDLVSALSRSSGEAVLKFEAFVLHVQCHRLED-AQLLHSVAVNSGFRNSGLTVSRSGKIIMAVRSTHGLEVPLSHG-GKLLVGEEYVHFLTQKANQKMEENFRR 185          
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Planmine SMEST
Match: SMESG000069969.1 (SMESG000069969.1)

HSP 1 Score: 343.584 bits (880), Expect = 7.455e-122
Identity = 184/185 (99.46%), Postives = 184/185 (99.46%), Query Frame = 2
Query:   77 MEIDKSRKHSVDAXXXXXXXXXXXXXXXXYSTTSSCSGRIVVYQKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFELNVMELLSNLLKP 631
            MEIDKSRKHSVDADILNLIDNLNNNSFNNYSTTSSCSGRIVVYQKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFE NVMELLSNLLKP
Sbjct:    1 MEIDKSRKHSVDADILNLIDNLNNNSFNNYSTTSSCSGRIVVYQKTPSQKQNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQKLLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYIKYICEKFNEKMLTNTQRRSQFESNVMELLSNLLKP 185          
The following BLAST results are available for this feature:
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TYW31.180e-3142.53tRNA-yW synthesizing protein 3 homolog [Source:HGN... [more]
TYW33.646e-1835.84tRNA-yW synthesizing protein 3 homolog [Source:HGN... [more]
TYW33.268e-1348.53tRNA-yW synthesizing protein 3 homolog [Source:HGN... [more]
TYW35.886e-1150.00tRNA-yW synthesizing protein 3 homolog [Source:HGN... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tyw31.525e-2838.51tRNA-yW synthesizing protein 3 homolog (S. cerevis... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdp18.817e-3442.95tyrosyl-DNA phosphodiesterase 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tyw31.638e-3241.04tRNA-yW synthesizing protein 3 homolog (S. cerevis... [more]
Tyw38.871e-2040.63tRNA-yW synthesizing protein 3 homolog (S. cerevis... [more]
Tyw35.359e-1232.64tRNA-yW synthesizing protein 3 homolog (S. cerevis... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q641F8|TYW3_XENLA3.942e-3241.50tRNA wybutosine-synthesizing protein 3 homolog OS=... [more]
sp|Q8BSA9|TYW3_MOUSE1.146e-3141.04tRNA wybutosine-synthesizing protein 3 homolog OS=... [more]
sp|Q5E9U4|TYW3_BOVIN1.361e-3139.31tRNA wybutosine-synthesizing protein 3 homolog OS=... [more]
sp|Q6IPR3|TYW3_HUMAN5.668e-3142.53tRNA wybutosine-synthesizing protein 3 homolog OS=... [more]
sp|Q19QT9|TYW3_PIG9.641e-3141.50tRNA wybutosine-synthesizing protein 3 homolog OS=... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GY031.389e-3645.95TYW3 domain-containing protein (Fragment) OS=Macro... [more]
A0A267GLS13.468e-3646.29TYW3 domain-containing protein (Fragment) OS=Macro... [more]
A0A0B7AZI42.616e-3342.61TYW3 domain-containing protein OS=Arion vulgaris O... [more]
A0A2C9LAJ53.371e-3346.53TYW3 domain-containing protein OS=Biomphalaria gla... [more]
A0A0P5TPJ47.065e-3245.34tRNA wybutosine-synthesizing protein OS=Daphnia ma... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tyw31.611e-3143.54tRNA-yW synthesizing protein 3 homolog [Source:NCB... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008597.11.302e-1837.86pep scaffold:Pmarinus_7.0:GL486775:3603:7409:-1 ge... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TYW31.109e-1231.76tRNA methyltransferase required for synthesis of w... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432915.881e-1139.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tyw31.189e-3139.43tRNA-yW synthesizing protein 3 homolog [Source:NCB... [more]
tyw35.821e-3139.53tRNA-yW synthesizing protein 3 homolog [Source:NCB... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 3 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069969.17.455e-12299.46SMESG000069969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011644 ID=SMED30011644|Name=tRNA wybutosine-synthesizing protein 3 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=663bp
TTGTTTAAATAACCAGATTAATATTAGTTGACTTTATTTTTAAAAATTTT
TATTACATTGAAGTAATTAAAATTGAATGGAAATTGATAAAAGCAGAAAG
CATTCTGTTGATGCTGACATACTTAATCTCATAGATAATTTAAATAACAA
CAGTTTTAACAATTATTCTACAACTAGTTCATGCTCTGGGAGAATCGTAG
TTTATCAAAAAACACCATCACAGAAGCAGAATTGCAAATGGATTAAAGTA
TCTCATGAAAGCGTTTGTCCCGAAGAAATAGTTGAAAACTTAAAGGATCT
CGAAGGTGAAACTTTTATAAAATATGAGCCTTTCATCCTTCATTGTTGTG
CAAAAACAAACGATCTGGCACAGAAATTATTGCACGCGGGAATTGCCAGT
GGGTTCCGAGAATCTGGGATTAGTCTAGGCAAGCGGAAAACGATGGTAGC
AATCAGGAGTTCCAATAACATGGATGTGCCACTGACGGATGGAACTGGGA
AACTGCTCGTGTCGGACGAGTATATCAAATATATTTGCGAGAAATTCAAT
GAAAAAATGCTGACAAATACTCAACGACGATCACAATTTGAGTTGAACGT
AATGGAATTGTTATCAAATTTACTAAAACCATAATTGTATTCAAATAAAT
TTTATTGTTATCG
back to top

protein sequence of SMED30011644-orf-1

>SMED30011644-orf-1 ID=SMED30011644-orf-1|Name=SMED30011644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MEIDKSRKHSVDADILNLIDNLNNNSFNNYSTTSSCSGRIVVYQKTPSQK
QNCKWIKVSHESVCPEEIVENLKDLEGETFIKYEPFILHCCAKTNDLAQK
LLHAGIASGFRESGISLGKRKTMVAIRSSNNMDVPLTDGTGKLLVSDEYI
KYICEKFNEKMLTNTQRRSQFELNVMELLSNLLKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036602tRNA_yW-synthesising-like_sf
IPR003827tRNA_yW-synthesising
Vocabulary: biological process
TermDefinition
GO:0008033tRNA processing
GO:0032259methylation
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036602tRNA wybutosine-synthesizing-like superfamilyGENE3DG3DSA:3.30.1960.10coord: 1..182
e-value: 1.4E-54
score: 186.5
IPR036602tRNA wybutosine-synthesizing-like superfamilySUPERFAMILYSSF111278SSo0622-likecoord: 4..174
IPR003827tRNA wybutosine-synthesizing proteinPFAMPF02676TYW3coord: 3..175
e-value: 3.4E-45
score: 154.0
NoneNo IPR availablePANTHERPTHR23245UNCHARACTERIZEDcoord: 4..180
NoneNo IPR availablePANTHERPTHR23245:SF31TRNA WYBUTOSINE-SYNTHESIZING PROTEIN 3 HOMOLOGcoord: 4..180