dual serine/threonine and tyrosine protein kinase

Overview
Namedual serine/threonine and tyrosine protein kinase
Smed IDSMED30011629
Length (bp)3002
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dual serine/threonine and tyrosine protein kinase (SMED30011629) t-SNE clustered cells

Violin plots show distribution of expression levels for dual serine/threonine and tyrosine protein kinase (SMED30011629) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dual serine/threonine and tyrosine protein kinase (SMED30011629) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dual serine/threonine and tyrosine protein kinase (SMED30011629) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011629

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011629SMESG000021782.1 Contig4177GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011629SMESG000012972.1 Contig4177GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011629SMESG000012973.1 SMESG000012972.1 dd_Smed_v4_4436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011629SMESG000012973.1 SMESG000012972.1 dd_Smed_v4_4436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 539.265 bits (1388), Expect = 3.094e-176
Identity = 300/747 (40.16%), Postives = 435/747 (58.23%), Query Frame = 1
Query:  592 VMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAV--NNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             MH +  L + + VVV P    + +     +    ++D LP++ YA   ++LS  D+ EL+EI+      P+FF KVP            K   E    +++            S+T   +S    L+  L  +  +S+   N G      +P        D K  S L+ Q +     L+ + H  +Q  LV     +       L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D A    ++E F+D +V         +  K     ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   P +   W  + + + + S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  R+++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:  211 TMHHA--LLQEVDVVVAPC---QGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYF-SFPVFFFKVP------------KLGSE----IID------------SSTRRMESERSPLYRQLIDLGYLSSSHWNCG------APG------QDTKAQSMLVEQSEKL-RHLSTFSHQVLQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAT---NME-FKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 906          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 462.996 bits (1190), Expect = 1.144e-147
Identity = 277/747 (37.08%), Postives = 401/747 (53.68%), Query Frame = 1
Query:  592 VMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAV--NNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             MH +  L + + VVV P    + +     +    ++D LP++ YA   ++LS  D+ EL+EI+      P+FF KVP            K   E    +++            S+T   +S    L+  L  +  +S+   N G      +P        D K  S L+ Q +     L+ + H  +Q  LV     +       L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D A    ++E F+D +V         +  K     ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   P +   W  + + + + S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  R+++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF                                              G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:  211 TMHHA--LLQEVDVVVAPC---QGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYF-SFPVFFFKVP------------KLGSE----IID------------SSTRRMESERSPLYRQLIDLGYLSSSHWNCG------APG------QDTKAQSMLVEQSEKL-RHLSTFSHQVLQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAT---NME-FKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFT---------------------------------------------GARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 861          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 147.517 bits (371), Expect = 5.593e-40
Identity = 70/162 (43.21%), Postives = 101/162 (62.35%), Query Frame = 1
Query: 1705 LIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCK 2190
            L E++KQ+I R+ W   P +   W  + + + + S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  R+++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y +
Sbjct:    2 LWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMR 163          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Match: MAP3K5 (mitogen-activated protein kinase kinase kinase 5 [Source:HGNC Symbol;Acc:HGNC:6857])

HSP 1 Score: 88.1965 bits (217), Expect = 5.669e-17
Identity = 69/279 (24.73%), Postives = 130/279 (46.59%), Query Frame = 1
Query: 2056 IGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAAL-----------KQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLD-YNNRGKLTDLGFCK------PCAMLSGSLVGTPIHMAPELFNQ---EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGE-IEDQLLLMKTKAQ 2826
            +G+G YG+VYA        ++A+K +   D ++   L  E    K +         H ++V Y  S+  N  I   M+++     +AL           +Q + + T+      ++EG+++LH   ++HRDIK  NVL++ Y+   K++D G  K      PC   + +  GT  +MAPE+ ++    Y  + DI++ G     + + K   P  ++    + ++F+     + PE P  +  E    I +C+  DP+KR    + + D+ L + +K +
Sbjct:  686 LGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLK--------HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTK-----QILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPC---TETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGK---PPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKK 945          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Match: TXK (TXK tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:12434])

HSP 1 Score: 85.8853 bits (211), Expect = 1.456e-16
Identity = 71/257 (27.63%), Postives = 120/257 (46.69%), Query Frame = 1
Query: 2050 REIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGT-----PIHMAPE---LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESL--FEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEI 2790
            +EIG GQ+GVV+    W ++ Q+A+K++         D   E     ++S H ++  ++G  +     Y       F+ +    ++    K  L     L V  D+ EG+ +L   G IHRD+  +N L+      K++D G  +   +L    V +     PI  +P    LFN+ Y+   D+++FG+L W V +   K+P     F NK +L   EA+ +G R  RP       ++++  CWH+ P  RP   E+
Sbjct:  275 KEIGSGQFGVVH-LGEWRSHIQVAIKAINEGSMSE-EDFIEEAKVMMKLS-HSKLVQLYGVCIQRKPLY---IVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTR--YVLDDEYVSSFGAKFPIKWSPPEVFLFNK-YSSKSDVWSFGVLMWEVFTEG-KMP-----FENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAEL 516          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 92.0485 bits (227), Expect = 3.023e-20
Identity = 73/271 (26.94%), Postives = 125/271 (46.13%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVD-------YNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLS--GSLVGTPIHMAPELFN-QEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPE--RPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTK 2820
            + ++IG G  G V+  N  G+ + +AVK +    +     L  E    KQ    + +  I   +VD        +Y  G N   + +   +     AA+ Q            + ++ + FLH   ++HRDIK  NVLL  N   KLTD+GFC      S   ++VGTP  M+PE+ N ++YN+ VDI++ GI+   +   +      + R T  ++++   + G +PE  +  ++  E  + + +C   DP++R    E+     L K K
Sbjct:    1 MKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQ------------ECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGE----PPYLRETPLKAIYLIAQNG-KPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAK 254          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 92.8189 bits (229), Expect = 1.714e-19
Identity = 74/276 (26.81%), Postives = 127/276 (46.01%), Query Frame = 1
Query: 2029 FGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVD-------YNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLS--GSLVGTPIHMAPELFN-QEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPE--RPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTK 2820
             G  ++ ++IG G  G V+  N  G+ + +AVK +    +     L  E    KQ    + +  I   +VD        +Y  G N   + +   +     AA+ Q            + ++ + FLH   ++HRDIK  NVLL  N   KLTD+GFC      S   ++VGTP  M+PE+ N ++YN+ VDI++ GI+   +   +      + R T  ++++   + G +PE  +  ++  E  + + +C   DP++R    E+     L K K
Sbjct:  153 LGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQ------------ECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGE----PPYLRETPLKAIYLIAQNG-KPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAK 411          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Match: C18H7.4 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q9GZG1])

HSP 1 Score: 90.8929 bits (224), Expect = 4.396e-19
Identity = 72/267 (26.97%), Postives = 128/267 (47.94%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSV--VPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFI-------MDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIH---MAPELF-NQEYNFSVDIYAFGILFWYVCSNKVKVP-TNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
              ++IG G YG VY          +AVK +     DE+   D+ M+     Q+ +H  I   +G ++D        P +L +       ++ + RD     K  +    R+Q +     G+ +LH +  IHRDI  +N L+ +N   K+ D G C+  A+    L   P++   +APE++ N E  ++ D+YAFG++ W       + P T +  +T K+     V+ G R + P  + ++   L++ CW+ DP KRP   +++++L
Sbjct:  124 FKKQIGSGAYGTVYRGRLVKTNAIVAVKKLDTEGTDEEGLTDM-MKEARVMQLYDHPNIVKFYGYILD------DVPYLLVLEFCNGGSVEDLLRD-----KPEIKINRRVQYTYMAACGMDYLHKKNCIHRDIASRNCLI-HNGVVKMADFGMCRATAVYKVDL-SKPLNVRWLAPEVWTNGETRYNTDVYAFGVMIWEFFITPYQSPYTEWKGYTVKQK----VRGGYRMQPPEGMPKDVASLLAECWNHDPEKRPNAEKLKEKL 372          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 90.8929 bits (224), Expect = 1.451e-18
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 1
Query: 2029 FGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVD-------YNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGS----LVGTPIHMAPELFN-QEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPE--RPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTK 2820
             G  ++ ++IG G  G V+  N  G+ + +AVK +    +     L  E    KQ    + +  I   +VD        +Y  G N   + +   +     AA+ Q            + ++ + FLH   ++HRDIK  NVLL  N   KLTD+GFC    +  GS    +VGTP  M+PE+ N ++YN+ VDI++ GI+   +   +      + R T  ++++   + G +PE  +  ++  E  + + +C   DP++R    E+     L K K
Sbjct:  325 LGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQ------------ECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFC--AQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGE----PPYLRETPLKAIYLIAQNG-KPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAK 583          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 90.8929 bits (224), Expect = 1.464e-18
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 1
Query: 2029 FGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVD-------YNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGS----LVGTPIHMAPELFN-QEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPE--RPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTK 2820
             G  ++ ++IG G  G V+  N  G+ + +AVK +    +     L  E    KQ    + +  I   +VD        +Y  G N   + +   +     AA+ Q            + ++ + FLH   ++HRDIK  NVLL  N   KLTD+GFC    +  GS    +VGTP  M+PE+ N ++YN+ VDI++ GI+   +   +      + R T  ++++   + G +PE  +  ++  E  + + +C   DP++R    E+     L K K
Sbjct:  328 LGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQ------------ECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFC--AQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPP----YLRETPLKAIYLIAQNG-KPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAK 586          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Match: png (gene:FBgn0000826 transcript:FBtr0070234)

HSP 1 Score: 82.8037 bits (203), Expect = 8.378e-17
Identity = 67/263 (25.48%), Postives = 119/263 (45.25%), Query Frame = 1
Query: 2005 MSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQ----MAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTR---LQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFC---KPCAMLSGSLVGTPIHMAPELFNQE--YNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQ 2757
            M L D+ L  V    R +G+G +G V+ C+      Q    + VK ++  + K    L  E  Y      H  I     S   ++++   N  + ++ +   RD    L  G   V +   +    D++ G+ +LH + +IHRDIK +N+LLD N+R K+ D G      P   L   + GTP++MAPE  + +   +F  D+++ G++ + +C  +       D+      L   V+  +RP    ++ +  +D +   W Q
Sbjct:    1 MELGDSKLRAV----RVLGQGTFGRVFLCHQNEVRGQPERKVCVKRIIVRNPKTELGLIKEEVYIISQLRHPHIVEFLRS---FSHAGTVNIVMEYVPNGTLRDVIQQLPSGTGGVNQERLMGYFRDMVVGLEYLHIRCVIHRDIKPENMLLDANDRVKIADFGIANVHAPSTQLQAGM-GTPMYMAPEAMSSQGKVDFKSDVWSLGLVLYELCLGRSPFAAFLDKNATPALLHTVVQALVRPRLDCQLIRRLYDPV---WAQ 252          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330131)

HSP 1 Score: 85.1149 bits (209), Expect = 2.643e-16
Identity = 72/255 (28.24%), Postives = 116/255 (45.49%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAY-NQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMAR----DFY-AALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFC---KPCAMLSGSLVGTPIH-MAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            +  ++G GQYG VY    W  Y N +AVK++   D     D   E    K+M +H  +  + G            P    I + M+     DF  +A ++ LD V  L ++  +  G+ +L S+  IHRD+  +N L+  N   K+ D G     +     + +    PI   APE L   +++   D++AFG+L W + +  +      D  T+   ++  + KG R ERPP    E +DL+ +CW  D   RP
Sbjct:  391 MKHKLGGGQYGEVYEA-VWKRYGNTVAVKTLKE-DTMALKDFLEEAAIMKEM-KHPNLVQLIGVCT-------REPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAID-LTD---VYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRP 631          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330132)

HSP 1 Score: 85.1149 bits (209), Expect = 2.843e-16
Identity = 72/255 (28.24%), Postives = 116/255 (45.49%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAY-NQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMAR----DFY-AALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFC---KPCAMLSGSLVGTPIH-MAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            +  ++G GQYG VY    W  Y N +AVK++   D     D   E    K+M +H  +  + G            P    I + M+     DF  +A ++ LD V  L ++  +  G+ +L S+  IHRD+  +N L+  N   K+ D G     +     + +    PI   APE L   +++   D++AFG+L W + +  +      D  T+   ++  + KG R ERPP    E +DL+ +CW  D   RP
Sbjct:  373 MKHKLGGGQYGEVYEA-VWKRYGNTVAVKTLKE-DTMALKDFLEEAAIMKEM-KHPNLVQLIGVCT-------REPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAID-LTD---VYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRP 613          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330130)

HSP 1 Score: 84.7297 bits (208), Expect = 3.210e-16
Identity = 72/255 (28.24%), Postives = 116/255 (45.49%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAY-NQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMAR----DFY-AALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFC---KPCAMLSGSLVGTPIH-MAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            +  ++G GQYG VY    W  Y N +AVK++   D     D   E    K+M +H  +  + G            P    I + M+     DF  +A ++ LD V  L ++  +  G+ +L S+  IHRD+  +N L+  N   K+ D G     +     + +    PI   APE L   +++   D++AFG+L W + +  +      D  T+   ++  + KG R ERPP    E +DL+ +CW  D   RP
Sbjct:  373 MKHKLGGGQYGEVYEA-VWKRYGNTVAVKTLKE-DTMALKDFLEEAAIMKEM-KHPNLVQLIGVCT-------REPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAID-LTD---VYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRP 613          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330133)

HSP 1 Score: 84.7297 bits (208), Expect = 3.274e-16
Identity = 72/255 (28.24%), Postives = 116/255 (45.49%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAY-NQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMAR----DFY-AALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFC---KPCAMLSGSLVGTPIH-MAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            +  ++G GQYG VY    W  Y N +AVK++   D     D   E    K+M +H  +  + G            P    I + M+     DF  +A ++ LD V  L ++  +  G+ +L S+  IHRD+  +N L+  N   K+ D G     +     + +    PI   APE L   +++   D++AFG+L W + +  +      D  T+   ++  + KG R ERPP    E +DL+ +CW  D   RP
Sbjct:  391 MKHKLGGGQYGEVYEA-VWKRYGNTVAVKTLKE-DTMALKDFLEEAAIMKEM-KHPNLVQLIGVCT-------REPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAID-LTD---VYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRP 631          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 521.931 bits (1343), Expect = 2.125e-170
Identity = 283/738 (38.35%), Postives = 424/738 (57.45%), Query Frame = 1
Query:  613 LFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSP--IFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID--LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN---ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            L + +K++V+P    + +EE  A+ D     +LPI++YA     LS+    +LE+++ L +  P  + F++V                                         ++  G   LF  L  + LISA          +P  ++      ++   L    +     L  +    +Q   V   T++       L   I+Q +D+     ITP+++E+ +++E  L+ SL++ +  K EE+  +I E L+ MK Q L DA  ++    + S   + VS K  K   + +++ + +++N A+A KL  S+D LR ++VGTLER + SL K   E+      +  LK IL+  Y + +   + S+      E++KQ+I R+ W   P + A W  + + D + S+S  KL   + +Q    L  SHE F  S+++LE     R  +  ++  R+++ + P+LARL LE  SLRD +L G PKL RE+GRGQYGVVY C++W   +  A+KSVVPPD+KHW DLA+EF Y + + +H+R+  +HGSV+D++YS GS+ A+L IM+R+ RD Y  LK GL    RL ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  VKKG RPER P  D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  184 LLQEVKIMVLPCRNVQPLEE--ALEDCK-RGILPIVLYAVSRESLSA---QQLEDLQTLRESLPFPVCFIRV-----------------------------------------SDGGGGGALFTQLASLQLISASAGN--CACGAPAAQSAG----RMQGVLCDSLERLQRVLVPFTRQVLQNQQVEAATLLNTIHCRCLDLFIIQAFDMQRDLQITPRRLEYTREKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQNLDFTDIIMSSNGEPVSSKDIKVCISQIQDLIVNRLNQAVANKLTNSVDYLRESFVGTLERCLGSLEKSTPESCAHNVTSNHLKQILNAAYHVEVTFHSGSSVTRLFWEQIKQIIHRITWVNPPAITAEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDILLHGKPKLGRELGRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHGSVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAGLSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASKDQLWTNVKKGCRPERLPVFDEECWQLMEACWNGDPSQRPLLGIVQPGL 868          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 502.286 bits (1292), Expect = 3.325e-163
Identity = 278/735 (37.82%), Postives = 412/735 (56.05%), Query Frame = 1
Query:  613 LFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSP--IFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID--LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            L + +K++V+P    + +EE  A+ D     +LPI++YA     LS+    +LE+++ L +  P  + F++V                                         ++  G   LF  L  + LISA          +P  ++      ++   L    +     L  +    +Q   V   T++       L   I+Q +D+     ITP+++E+ +++E  L+ SL++ +  K EE+  +I E L+ MK Q L DA  ++    + S   + VS K  K   + +++ + +++N A+A KL  S+D LR ++VGTLER + SL K   E+           H     H                +KQ+I R+ W   P + A W  + + D + S+S  KL   + +Q    L  SHE F  S+++LE     R  +  ++  R+++ + P+LARL LE  SLRD +L G PKL RE+GRGQYGVVY C++W   +  A+KSVVPPD+KHW DLA+EF Y + + +H+R+  +HGSV+D++YS GS+ A+L IM+R+ RD Y  LK GL    RL ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  VKKG RPER P  D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  184 LLQEVKIMVLPCRNVQPLEE--ALEDCK-RGILPIVLYAVSRESLSA---QQLEDLQTLRESLPFPVCFIRV-----------------------------------------SDGGGGGALFTQLASLQLISASAGN--CACGAPAAQSAG----RMQGVLCDSLERLQRVLVPFTRQVLQNQQVEAATLLNTIHCRCLDLFIIQAFDMQRDLQITPRRLEYTREKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQNLDFTDIIMSSNGEPVSSKDIKVCISQIQDLIVNRLNQAVANKLTNSVDYLRESFVGTLERCLGSLEKSTPESCA---------HNVTSNH----------------LKQIIHRITWVNPPAITAEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDILLHGKPKLGRELGRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHGSVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAGLSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASKDQLWTNVKKGCRPERLPVFDEECWQLMEACWNGDPSQRPLLGIVQPGL 840          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Match: btk (Bruton agammaglobulinemia tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070531-1])

HSP 1 Score: 91.2781 bits (225), Expect = 2.421e-18
Identity = 79/277 (28.52%), Postives = 132/277 (47.65%), Query Frame = 1
Query: 2050 REIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIAT-------IHGSVVDYNYSYGSNPAILFIMDRMARD-FYAALKQGL---DWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSG---SLVGT--PIHMAPE--LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP----LPGEIEDQLLLMK 2814
            RE+G GQ+GVV     W   + +A+K V                    MSE D I          HG++V           I  + + +A       L++GL     +  L++  DV EG+++L +   IHRD+  +N L+D N   K+TD G  +   +L     S VG+  P+  +P   L   +++   DI+AFG+L W + + + ++P  +DR+ N E + E +  G R  RP   ++  + +++ CWH+ P++RP    L G I+D L  M+
Sbjct:  385 RELGNGQFGVV-KYGKWQGRHDVAIKMVKE----------------GSMSEDDFIEEAKVMMKLCHGNLVQLYGVCTKQRPIYIVTEYLANGCLLNYLQEGLLNPTSIALLEMCKDVSEGMKYLEANQFIHRDLAARNCLVDSNGTIKVTDFGLSR--YVLDDEYTSSVGSKFPVRWSPPEVLLYCKFSSKSDIWAFGVLMWEIYT-QGRMP--YDRWNNTE-IVEKISAGHRLYRPQMANENVFAIMNSCWHERPDERPTFQELVGVIKDLLFSMQ 638          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Match: prkcdb (protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GENE-111129-1])

HSP 1 Score: 89.3521 bits (220), Expect = 9.297e-18
Identity = 54/181 (29.83%), Postives = 102/181 (56.35%), Query Frame = 1
Query: 2251 SYGSNPAILFIMDRMARD---FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAM---LSGSLVGTPIHMAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            ++ S   + F+M+ +      F+   K   D       + ++I G+++LHS+G+++RD+KL NV+LD +   K+ D G CK   +    + +  GTP ++APE L  Q+Y+FSVD ++FG+L + +     + P   D   +++ LF++++  + P  P  I +E  DL+ + + +DP +R
Sbjct:  425 TFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIG--QSPFQGD---DEDELFDSIRMDV-PHYPRWITKEAKDLLEKLFERDPTRR 599          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Match: BX005175.1 (protein kinase C, delta b [Source:NCBI gene;Acc:100150844])

HSP 1 Score: 89.3521 bits (220), Expect = 9.942e-18
Identity = 54/181 (29.83%), Postives = 102/181 (56.35%), Query Frame = 1
Query: 2251 SYGSNPAILFIMDRMARD---FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAM---LSGSLVGTPIHMAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            ++ S   + F+M+ +      F+   K   D       + ++I G+++LHS+G+++RD+KL NV+LD +   K+ D G CK   +    + +  GTP ++APE L  Q+Y+FSVD ++FG+L + +     + P   D   +++ LF++++  + P  P  I +E  DL+ + + +DP +R
Sbjct:  410 TFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIG--QSPFQGD---DEDELFDSIRMDV-PHYPRWITKEAKDLLEKLFERDPTRR 584          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 534.643 bits (1376), Expect = 1.296e-175
Identity = 303/771 (39.30%), Postives = 446/771 (57.85%), Query Frame = 1
Query:  505 NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEI-DLESFQD-KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN--ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             K D I EE L D     +D A   + ++V     +L + + +VV P    +A+      Y  H+     I++YA     LS  D+ EL EIK      P+FF++        RL    +  +  L   L   + F   G  + N  A  SG                        + +P +             L+ QF+    +L+ +    +Q +LV    ++    S  L   I + +D+     ITPK++E+ +Q+E  LY SL+  S  K EE+  +I E LN M+ Q L DAA ++  D+   Q+ + VS++  K     ++E + S++N A+  KL+ S+D LR ++VGTLER + SL K ++E+ +   +  LK IL+  Y + +   + ST    + E++ Q+I R+ W   PT+   W  R + D + S+S  KL   + +Q  + LK SHE F  S+K+LE     R  K  ++  R+++ + P+LARL LE  SL+D +L G P++ RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DY+Y  GS+ A+L I +R+ RD Y  LK GL   TRLQ++LDV+EGIRFLH+QGL+HRDIKLKNVLLD  +R K+TDLGFCKP AM+SGS+VGTPIHMAPELF+ +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  V+KG RPER    D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  101 GKWDTIPEEDL-DVPEDEEDPAHRLAELEVTLPHQLL-QDVDIVVSPCRSSQAVSMTLEDYVDHVQS---IVVYAVCEERLSQQDEEELTEIKE-KYKLPVFFIRTSSTR--DRLIGGSEGVRSALYEQLME-LGFLKRG--LCNCGAAGSG------------------------STAPSM-------------LVEQFEKL-RQLSTFSRQVLQMHLVDAAIVLNMVHSRCLDLFINKAFDMHRDLQITPKRLEYTRQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRSLEKSQQESSSHVTSNHLKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRITWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASKDHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRPLMGIVQPML 822          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 534.258 bits (1375), Expect = 1.691e-175
Identity = 303/771 (39.30%), Postives = 446/771 (57.85%), Query Frame = 1
Query:  505 NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEI-DLESFQD-KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN--ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             K D I EE L D     +D A   + ++V     +L + + +VV P    +A+      Y  H+     I++YA     LS  D+ EL EIK      P+FF++        RL    +  +  L   L   + F   G  + N  A  SG                        + +P +             L+ QF+    +L+ +    +Q +LV    ++    S  L   I + +D+     ITPK++E+ +Q+E  LY SL+  S  K EE+  +I E LN M+ Q L DAA ++  D+   Q+ + VS++  K     ++E + S++N A+  KL+ S+D LR ++VGTLER + SL K ++E+ +   +  LK IL+  Y + +   + ST    + E++ Q+I R+ W   PT+   W  R + D + S+S  KL   + +Q  + LK SHE F  S+K+LE     R  K  ++  R+++ + P+LARL LE  SL+D +L G P++ RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DY+Y  GS+ A+L I +R+ RD Y  LK GL   TRLQ++LDV+EGIRFLH+QGL+HRDIKLKNVLLD  +R K+TDLGFCKP AM+SGS+VGTPIHMAPELF+ +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  V+KG RPER    D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:   97 GKWDTIPEEDL-DVPEDEEDPAHRLAELEVTLPHQLL-QDVDIVVSPCRSSQAVSMTLEDYVDHVQS---IVVYAVCEERLSQQDEEELTEIKE-KYKLPVFFIRTSSTR--DRLIGGSEGVRSALYEQLME-LGFLKRG--LCNCGAAGSG------------------------STAPSM-------------LVEQFEKL-RQLSTFSRQVLQMHLVDAAIVLNMVHSRCLDLFINKAFDMHRDLQITPKRLEYTRQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRSLEKSQQESSSHVTSNHLKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRITWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASKDHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRPLMGIVQPML 818          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 534.643 bits (1376), Expect = 2.483e-175
Identity = 303/771 (39.30%), Postives = 446/771 (57.85%), Query Frame = 1
Query:  505 NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEI-DLESFQD-KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN--ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             K D I EE L D     +D A   + ++V     +L + + +VV P    +A+      Y  H+     I++YA     LS  D+ EL EIK      P+FF++        RL    +  +  L   L   + F   G  + N  A  SG                        + +P +             L+ QF+    +L+ +    +Q +LV    ++    S  L   I + +D+     ITPK++E+ +Q+E  LY SL+  S  K EE+  +I E LN M+ Q L DAA ++  D+   Q+ + VS++  K     ++E + S++N A+  KL+ S+D LR ++VGTLER + SL K ++E+ +   +  LK IL+  Y + +   + ST    + E++ Q+I R+ W   PT+   W  R + D + S+S  KL   + +Q  + LK SHE F  S+K+LE     R  K  ++  R+++ + P+LARL LE  SL+D +L G P++ RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DY+Y  GS+ A+L I +R+ RD Y  LK GL   TRLQ++LDV+EGIRFLH+QGL+HRDIKLKNVLLD  +R K+TDLGFCKP AM+SGS+VGTPIHMAPELF+ +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  V+KG RPER    D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  118 GKWDTIPEEDL-DVPEDEEDPAHRLAELEVTLPHQLL-QDVDIVVSPCRSSQAVSMTLEDYVDHVQS---IVVYAVCEERLSQQDEEELTEIKE-KYKLPVFFIRTSSTR--DRLIGGSEGVRSALYEQLME-LGFLKRG--LCNCGAAGSG------------------------STAPSM-------------LVEQFEKL-RQLSTFSRQVLQMHLVDAAIVLNMVHSRCLDLFINKAFDMHRDLQITPKRLEYTRQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRSLEKSQQESSSHVTSNHLKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRITWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASKDHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRPLMGIVQPML 839          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 534.643 bits (1376), Expect = 7.762e-175
Identity = 303/771 (39.30%), Postives = 446/771 (57.85%), Query Frame = 1
Query:  505 NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEI-DLESFQD-KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN--ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             K D I EE L D     +D A   + ++V     +L + + +VV P    +A+      Y  H+     I++YA     LS  D+ EL EIK      P+FF++        RL    +  +  L   L   + F   G  + N  A  SG                        + +P +             L+ QF+    +L+ +    +Q +LV    ++    S  L   I + +D+     ITPK++E+ +Q+E  LY SL+  S  K EE+  +I E LN M+ Q L DAA ++  D+   Q+ + VS++  K     ++E + S++N A+  KL+ S+D LR ++VGTLER + SL K ++E+ +   +  LK IL+  Y + +   + ST    + E++ Q+I R+ W   PT+   W  R + D + S+S  KL   + +Q  + LK SHE F  S+K+LE     R  K  ++  R+++ + P+LARL LE  SL+D +L G P++ RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DY+Y  GS+ A+L I +R+ RD Y  LK GL   TRLQ++LDV+EGIRFLH+QGL+HRDIKLKNVLLD  +R K+TDLGFCKP AM+SGS+VGTPIHMAPELF+ +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  V+KG RPER    D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  158 GKWDTIPEEDL-DVPEDEEDPAHRLAELEVTLPHQLL-QDVDIVVSPCRSSQAVSMTLEDYVDHVQS---IVVYAVCEERLSQQDEEELTEIKE-KYKLPVFFIRTSSTR--DRLIGGSEGVRSALYEQLME-LGFLKRG--LCNCGAAGSG------------------------STAPSM-------------LVEQFEKL-RQLSTFSRQVLQMHLVDAAIVLNMVHSRCLDLFINKAFDMHRDLQITPKRLEYTRQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRSLEKSQQESSSHVTSNHLKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRITWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASKDHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRPLMGIVQPML 879          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 534.643 bits (1376), Expect = 1.192e-174
Identity = 303/771 (39.30%), Postives = 446/771 (57.85%), Query Frame = 1
Query:  505 NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEI-DLESFQD-KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENIN--ATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             K D I EE L D     +D A   + ++V     +L + + +VV P    +A+      Y  H+     I++YA     LS  D+ EL EIK      P+FF++        RL    +  +  L   L   + F   G  + N  A  SG                        + +P +             L+ QF+    +L+ +    +Q +LV    ++    S  L   I + +D+     ITPK++E+ +Q+E  LY SL+  S  K EE+  +I E LN M+ Q L DAA ++  D+   Q+ + VS++  K     ++E + S++N A+  KL+ S+D LR ++VGTLER + SL K ++E+ +   +  LK IL+  Y + +   + ST    + E++ Q+I R+ W   PT+   W  R + D + S+S  KL   + +Q  + LK SHE F  S+K+LE     R  K  ++  R+++ + P+LARL LE  SL+D +L G P++ RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DY+Y  GS+ A+L I +R+ RD Y  LK GL   TRLQ++LDV+EGIRFLH+QGL+HRDIKLKNVLLD  +R K+TDLGFCKP AM+SGS+VGTPIHMAPELF+ +Y+ SVD+YAFGILFWY+CS  VK+P  F++  +K+ L+  V+KG RPER    D+ECW L+  CW+ DP++RPL G ++  L
Sbjct:  176 GKWDTIPEEDL-DVPEDEEDPAHRLAELEVTLPHQLL-QDVDIVVSPCRSSQAVSMTLEDYVDHVQS---IVVYAVCEERLSQQDEEELTEIKE-KYKLPVFFIRTSSTR--DRLIGGSEGVRSALYEQLME-LGFLKRG--LCNCGAAGSG------------------------STAPSM-------------LVEQFEKL-RQLSTFSRQVLQMHLVDAAIVLNMVHSRCLDLFINKAFDMHRDLQITPKRLEYTRQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRSLEKSQQESSSHVTSNHLKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRITWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASKDHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRPLMGIVQPML 897          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 326/865 (37.69%), Postives = 489/865 (56.53%), Query Frame = 1
Query:  256 PMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMP-IKYDQ-PNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQD---CINEEVLIDNAAKSDDEAFENSYVDV---MHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            PME +   + L D+   ++I+GQ    K  ++N +   +++P +K D   +   + ++F YG +T  SL      ++L     L + QD    I EE   D   + D E   +   D+   MH +  L + + +VV P    +   ++        +D LP++ YA   ++LS   + EL E++      P+FF KVP  E  S                              S++   +S    L+G L  +  +S+ +       +          D K  S L+ Q +   ++L+ + H  +Q  LV     +    S  L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D AA   ++E F+D +V         +  KS    ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   PT+   W  + + + ++S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  +K+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:   98 PME-ETYLQQLVDRLPCILILGQDCNAKCQLLNLLLGVQVLPTLKLDSDESCKLRRLRFTYGTRTRVSLA-LPGQYELVH--TLASHQDNWETIPEE---DLEVQEDSEDAAHVLADLEVTMHHA--LLQEVDIVVAPCPSHRPSVDV---LSDLANDFLPVITYALHKDELSERGEQELREVRQYF-SFPMFFFKVPKLEIIS------------------------------SSSGRAESERSPLYGQLVDLGYLSSSHRNCVPSDQ----------DCKAQSMLVEQSEKL-KQLSTFSHQLLQNRLVDAAKALNVVHSHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAA---NME-FKDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 904          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 484.182 bits (1245), Expect = 5.990e-156
Identity = 304/865 (35.14%), Postives = 455/865 (52.60%), Query Frame = 1
Query:  256 PMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMP-IKYDQ-PNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQD---CINEEVLIDNAAKSDDEAFENSYVDV---MHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            PME +   + L D+   ++I+GQ    K  ++N +   +++P +K D   +   + ++F YG +T  SL      ++L     L + QD    I EE   D   + D E   +   D+   MH +  L + + +VV P    +   ++        +D LP++ YA   ++LS   + EL E++      P+FF KVP  E  S                              S++   +S    L+G L  +  +S+ +       +          D K  S L+ Q +   ++L+ + H  +Q  LV     +    S  L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D AA   ++E F+D +V         +  KS    ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   PT+   W  + + + ++S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF                                              G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:   98 PME-ETYLQQLVDRLPCILILGQDCNAKCQLLNLLLGVQVLPTLKLDSDESCKLRRLRFTYGTRTRVSLA-LPGQYELVH--TLASHQDNWETIPEE---DLEVQEDSEDAAHVLADLEVTMHHA--LLQEVDIVVAPCPSHRPSVDV---LSDLANDFLPVITYALHKDELSERGEQELREVRQYF-SFPMFFFKVPKLEIIS------------------------------SSSGRAESERSPLYGQLVDLGYLSSSHRNCVPSDQ----------DCKAQSMLVEQSEKL-KQLSTFSHQLLQNRLVDAAKALNVVHSHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAA---NME-FKDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFT---------------------------------------------GTRPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 859          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Match: Bmx (BMX non-receptor tyrosine kinase [Source:MGI Symbol;Acc:MGI:1101778])

HSP 1 Score: 88.5817 bits (218), Expect = 1.660e-17
Identity = 77/254 (30.31%), Postives = 120/254 (47.24%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMS---EHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSG---SLVGTPIHM---APELFNQ-EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            L +E+G GQ+GVV     W     +AVK +     K       EFF   Q      H ++   +G     +  Y       +I +    ++  +  +GL+    L++  DV EG+ FL S   IHRD+  +N L+D +   K++D G  +   +L     S VGT   +   APE+F+  +Y+   D++AFGIL W V S   K P  +D + N E + + V +G R  RP       + ++  CWH+ P KRP
Sbjct:  399 LLKELGNGQFGVV-QLGQWKGQYDVAVKMI-----KEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVC---SKKYPIYIVTEYITNGCLLNYLKSHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTR--YVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLG-KQP--YDLYDNSEVVVK-VSQGHRLYRPQLASDTIYQIMYSCWHELPEKRP 637          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Match: Bmx (BMX non-receptor tyrosine kinase [Source:MGI Symbol;Acc:MGI:1101778])

HSP 1 Score: 88.5817 bits (218), Expect = 1.875e-17
Identity = 77/254 (30.31%), Postives = 120/254 (47.24%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMS---EHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSG---SLVGTPIHM---APELFNQ-EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            L +E+G GQ+GVV     W     +AVK +     K       EFF   Q      H ++   +G     +  Y       +I +    ++  +  +GL+    L++  DV EG+ FL S   IHRD+  +N L+D +   K++D G  +   +L     S VGT   +   APE+F+  +Y+   D++AFGIL W V S   K P  +D + N E + + V +G R  RP       + ++  CWH+ P KRP
Sbjct:  395 LLKELGNGQFGVV-QLGQWKGQYDVAVKMI-----KEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVC---SKKYPIYIVTEYITNGCLLNYLKSHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTR--YVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLG-KQP--YDLYDNSEVVVK-VSQGHRLYRPQLASDTIYQIMYSCWHELPEKRP 633          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 87.8113 bits (216), Expect = 2.966e-17
Identity = 50/143 (34.97%), Postives = 88/143 (61.54%), Query Frame = 1
Query: 2356 SLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSG---SLVGTPIHMAPELFNQ-EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            + ++I G++FLHS+G+I+RD+KL NV+LD +   K+ D G CK      G   +  GTP ++APE+    +Y+FSVD ++FG+L + +     + P + D   +++ LFE+++    P  P  I +E  D++ + + +DP+KR
Sbjct:  452 AAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIG--QSPFHGD---DEDELFESIRVDT-PHYPRWITKESKDIMEKLFERDPDKR 588          
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Match: sp|Q6XUX2|DUSTY_RAT (Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Dstyk PE=2 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 328/862 (38.05%), Postives = 489/862 (56.73%), Query Frame = 1
Query:  256 PMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMP-IKYDQ-PNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQD---CINEEVLIDNAAKSDDEAFENSYVDV---MHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQD-------KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIE 2793
            PME +   + + D    ++I+GQ    K  ++N +   R++P +K D   +   + ++F YG +T  SL      ++L     L + QD    I EE   D   + D E       D+   MH +  L + + +VV P    +   ++        +D LP++ YA   ++LS  D+ EL+EI+      P+FF KVP  E                       I  + +GR        DS    L G L  +  +S+ +    +  +          D +  S L+ Q +    +L+ + H  +Q  LV     +    S  L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D AA   ++E F+D       + V  +  KS    ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   PT+   W  + + + ++S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  +K+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP+KRPL G ++
Sbjct:   98 PME-EKYLQQIVDHLPCILILGQDCNAKCQLLNLLLAVRVLPTLKLDSDESCKLRRLRFTYGTRTQVSLA-LPGQYELVH--TLASHQDNWETIPEE---DLEVQEDSEDTARVLADLEVTMHHA--LLQEVDIVVAPCHSHRPAVDV---LSDLANDFLPVITYALHKDELSERDEQELQEIRKYF-SFPVFFFKVPTLE-----------------------IIRSSSGRA-------DSERSPLSGQLMDLGYLSSSHRNCMASDQ----------DCRAQSMLVEQSEKL-RQLSTFSHQLLQTRLVDAAKALNAVHSHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAA---NME-FKDVIVPENGETVGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAGLSLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPSKRPLLGIVQ 901          
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Match: sp|Q6XUX1|DUSTY_MOUSE (Dual serine/threonine and tyrosine protein kinase OS=Mus musculus OX=10090 GN=Dstyk PE=1 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 326/865 (37.69%), Postives = 489/865 (56.53%), Query Frame = 1
Query:  256 PMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMP-IKYDQ-PNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQD---CINEEVLIDNAAKSDDEAFENSYVDV---MHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            PME +   + L D+   ++I+GQ    K  ++N +   +++P +K D   +   + ++F YG +T  SL      ++L     L + QD    I EE   D   + D E   +   D+   MH +  L + + +VV P    +   ++        +D LP++ YA   ++LS   + EL E++      P+FF KVP  E  S                              S++   +S    L+G L  +  +S+ +       +          D K  S L+ Q +   ++L+ + H  +Q  LV     +    S  L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D AA   ++E F+D +V         +  KS    ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   PT+   W  + + + ++S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  +K+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:   98 PME-ETYLQQLVDRLPCILILGQDCNAKCQLLNLLLGVQVLPTLKLDSDESCKLRRLRFTYGTRTRVSLA-LPGQYELVH--TLASHQDNWETIPEE---DLEVQEDSEDAAHVLADLEVTMHHA--LLQEVDIVVAPCPSHRPSVDV---LSDLANDFLPVITYALHKDELSERGEQELREVRQYF-SFPMFFFKVPKLEIIS------------------------------SSSGRAESERSPLYGQLVDLGYLSSSHRNCVPSDQ----------DCKAQSMLVEQSEKL-KQLSTFSHQLLQNRLVDAAKALNVVHSHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAA---NME-FKDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 904          
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Match: sp|Q6XUX0|DUSTY_CHICK (Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus OX=9031 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 325/858 (37.88%), Postives = 484/858 (56.41%), Query Frame = 1
Query:  307 LIIMGQTHYTKSVIVNEIFKKRIMPIK--YDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQ-MNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTL-PDAAAVEIDLESFQD-------KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEAL---------------KNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            L+I+GQ    K  ++N +  ++++P      + N   + I+F +G +T  SL   +    +          D I EE L +    S+D A   + ++V+    +L E + VVV P    +  +   A  + +++ +L I+I+A    +LSS D+ EL EIK      PIFF KVP                E  + +++P        +K  N  ++           CQ M+L     N       SP        D    S L+ Q +     L+ +    +QK+LV   T + +     L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E L+ MK+ L  DAA +E     F+D       + VS K  K     ++E + S++N A+A KL+ S+D LR ++VGTLER + SL +  E +++   +L               K IL+  Y + +   + ST    L E++KQ+I R+ W   P + ++W  + + D + S+S  KL   + +Q    L  SHE F  S+++LE+    R  K  ++  ++++ + P+LARL LE  SL+D +L G PKL RE+GRGQYGVVY C++WG +   A+KSVVPPDEKHW DLA+EF Y + +  H+R+  +HGSV+DY Y  GS+ A+L IM+R+ RD Y  LK GL+  TRLQ++LDV+EGIR+LHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F+R  +K+ L+  V++G+RPER P  D+ECW L+  CW  D ++RPL G ++  L
Sbjct:  103 LLILGQNCNAKCQLLNILLGEKLLPTTKISSEENCKRRRIRFTHGTQTRVSLALPEQYELVHMMAAHRGHWDTIPEEDL-EIRGDSEDPAHRIAELEVVLPYSLLKE-VDVVVAPC---RGFQSAEATLEEYMNQVLLIVIFAISEAELSSSDENELREIKE-KFSLPIFFFKVP----------------ESGVELISP--------KKTDNEKSS---------LYCQLMDLEYLSTNHCSCGAPSP--------DAVAQSMLVEQLEKL-RLLSTFSRQVLQKHLVEAATSLNEVHCRCLNIFINQAFDMQRDLQITPKRLEYTRRKENELYESLMNIANRKQEEMKDMIIETLSNMKEELLEDAANME-----FKDIIIPENGEPVSSKDIKCCIKQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLKSLEESWEVSVHPARSLEKSKDVSVHITSNYLKQILNAAYHVEVTFHSGSTVTRMLWEQIKQIIQRITWVSPPAITSDWKRKVAQDAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEDGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHGKPKLGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLQSHERLVDLHGSVIDYGYGGGSSIAVLLIMERLHRDLYTGLKAGLELETRLQIALDVVEGIRYLHSQGLVHRDIKLKNVLLDKKNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGHVKLPEAFERCASKDHLWNNVRRGVRPERLPVFDEECWQLMEACWDGDSSQRPLLGIVQPML 907          
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Match: sp|Q4VSN4|DUSTY_CANLF (Dual serine/threonine and tyrosine protein kinase OS=Canis lupus familiaris OX=9615 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 1.350e-178
Identity = 308/772 (39.90%), Postives = 447/772 (57.90%), Query Frame = 1
Query:  514 DCINEEVLIDNAAKSDDEAFENSYVDV-MHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQD-------KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            D I EE L +    S+D A   + ++V MH +  L + + +VV P    + +     +    ++D LP++ YA   ++LS  D+ EL+EI+      PIFF KVP            K   E            A + R+  N  +     +   G L      S  N G            +   D K  S L+ Q +     L+ + H  +Q +LV     + +     L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK  L D AA   ++E F+D       + V  +  K     ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +I+ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   PT+   W  + + + ++S+S  KL   + +Q    L  SHE F  S+++LE     R     ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP++RPL G ++  L
Sbjct:  187 DTIPEEDL-EVQEDSEDAAHVLAELEVTMHHA--LLQDVDIVVAPC---QGLRPAVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYF-SFPIFFFKVP------------KLGSE----------IIASSTRRTENERSPLHHQLMDLGYLSS----SHCNCG------------VPGQDTKAQSMLVEQSEKL-RHLSTFSHQVLQTHLVDAAKALNRVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMICETLNTMKGELLDDAA---NME-FKDVIVPENGEAVGTRELKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSIHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLEWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLENTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPSQRPLLGIVQPML 908          
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Match: sp|Q20CR4|DUSTY_MACMU (Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta OX=9544 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 5.400e-176
Identity = 300/747 (40.16%), Postives = 434/747 (58.10%), Query Frame = 1
Query:  592 VMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAV--NNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMV-------SIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINATEA-LKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             MH +  L + + VVV P    + +     +    ++D LP++ YA   ++LS  D+ EL+EI+      P+FF KVP                      L   I+        S+T   +S    L+  L  +  +S+   N G      +P        D K  S L+ Q +     L+ + H  +Q  LV     +       L   I Q +D+     ITPK++E+ +++E  LY SL++ +  K EE+  +I E LN MK+ L D AA   ++E F+D +V         +  K     ++E + S++N A+A KL+ S+D LR ++VGTLER + SL K ++ +++ T   LK IL+  Y + +   + S+    L E++KQ+I R+ W   P +   W  + + + + S+S  KL   + +Q    L  SHE F  S+++LE     R  K  ++  ++++ + P+LARL LE  SL+D +L   PKL +E+GRGQYGVVY C+ WG +   A+KSVVPPDEKHW DLA+EF Y + + +H+R+  +HGSV+DYNY  GS+ A+L IM+R+ RD Y  LK GL   TRLQ++LDV+EGIRFLHSQGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+CS  VK+P  F+R  +K+ L+  V++G RPER P  D+ECW L+  CW  DP KRPL G ++  L
Sbjct:  189 TMHHA--LLQEVDVVVAPC---QGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYF-SFPVFFFKVPK---------------------LGSEITD-------SSTRRTESERSLLYRQLIDLGYLSSSHWNCG------TPG------QDTKAQSVLVEQSEKL-RHLSTFSHQVLQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAA---NME-FKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPML 884          
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Match: A0A1S3JRL5 (dual serine/threonine and tyrosine protein kinase OS=Lingula unguis OX=7574 GN=LOC106175497 PE=4 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 354/851 (41.60%), Postives = 531/851 (62.40%), Query Frame = 1
Query:  307 LIIMGQTHYTKSVIVNEIFKKRIMPIKYDQP-NAPWKMIKFHYG-----IKTITSLCEF-DNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSG---DMKLFGTLCQMNLISAVNNGFFSL--TRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAA----VEIDLESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEEN---INATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             II+GQT Y K+ +VNE+F + ++P   D+  +  W+M +F YG      ++I    E  DN  D       +  QD     VL D+ A+          V++ H  ++L + ++V++ P+    ++ E+ A+Y     D+LPI++YA   + L+  D  EL+E+     + P+FFV+VPP      LP D       +  V   P +   N     N+  N +     + LF  LC +  +S +      +  T S    +     + ++S+L+  FD F   L  Y    +++ LV V  ++ +     LK +I+  +D+    ++TP+++EFA+++E  LYNSL+  + +K +EI ++I E +  MK+ L   AA    + +D+ S   ++ + +  K  T  V E +   +N+AIA KL++S+D+LR++Y GTL R + SL K + +N    + TEALK I++  Y + I I+TSS+F+  L+EKMKQLI  +PW+  P +D NW  + + DM+ S+SE +L   +  Q  E LK SHE F  ++K+LE +   R  K  E + ++++++ PK+A+L LE +S++D + FG+P+L REIGRGQYGVVY+C  W   +  A+KSVVPPDEKHW DLA+EFFY K + EH R+A + GSV+DY+Y  GS+PA+  IMDRM RD YAA+K GLDW +RLQV++DV+EG+RFLHSQGL+HRDIKLKNVL+D  NRGK+TDLGFCKP AM+SGS+VGTPIHMAPELF+  Y+ SVD+YAFGILFWYVC+  V++P  F++ T+K+ L+ +VKKG+RPE+ P  D+ECW+L+  CW  D NKRPL G++E QL
Sbjct:   70 FIILGQTCYAKASVVNEVFNQTVLPPIDDEDFDTKWRMARFKYGEQRTISRSIPGSYELVDNLTDNYHSWRTIPSQDL----VLRDSEAREPVGTLPCLEVNLKH--NVLKDDVQVILSPTNCSASLSEMVALYKE---DVLPIVMYAIGADQLTEKDLEELKELHEAEPELPVFFVRVPP-----PLPLDLTDGPSRVNGV--GPTNDYRNSNSKRNSKRNSAEYKIGLNLFQQLCDIGFLSMLPTSTEQVLQTLSSSTSSGSGEHVIMESELLENFDQFTPSLVQYTQRVLRQMLVAVAGVMNQIHGRCLKMIIMTAFDMQRDMMVTPRRLEFAREKECELYNSLMDIAMKKQDEIKTIIAETVQDMKEKLVAKAAEYDFIGVDI-SDSAEIRTARDLKICTGQVEELLLGALNNAIAGKLVESVDILRDSYTGTLTRCLESLEKADRDNNEHASTTEALKQIINAAYQVEITIRTSSSFVRILLEKMKQLIQSMPWKTPPRVDENWRKKMAQDMIKSLSEARLAKSICAQFKERLKNSHEQFSAALKQLEAKHSGRLEKTEEQRLKVRKIHAPKVAKLALESISMKDFISFGMPQLGREIGRGQYGVVYSCENWAGIHNCAIKSVVPPDEKHWNDLALEFFYTKNVPEHPRVAGLRGSVIDYSYGGGSSPAVYLIMDRMHRDLYAAIKTGLDWQSRLQVAIDVVEGMRFLHSQGLVHRDIKLKNVLMDKQNRGKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGRYDNSVDVYAFGILFWYVCAGHVRLPFAFEQCTSKDQLWMSVKKGMRPEKLPHFDEECWELMQACWAGDQNKRPLLGDVEPQL 903          
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Match: A0A267E1R7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027899g3 PE=4 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 352/896 (39.29%), Postives = 534/896 (59.60%), Query Frame = 1
Query:  286 LTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNA--PWKMIKFHYGIKTITSLCEFDNAFDL-GDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDM--------KLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLK-------IDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMVSIKMY----KSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFE----------------------------EENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKA 2823
            L ++ ++++++GQT Y K+V+VNEI ++ ++P+  D  +    W+MI+F +  K   SL   D+ +DL  D +      D I E+ LI  A +  D A   + ++V  +  +L +G  +VV P    K +  +  ++        PIL+YA E + L+S D +EL++ + LA + P+FF++VP    Y    A+Y+  + +                  +   A+ +GD+        +LF  LC++  +S +  G  S    P       +          + S+L+  F++ F ++  Y    +Q+ LV+  T++       L N IL  +DL+   ++TPKK+ FAK +EL LYNSL+  S+ K EEI  LI   L  M++ L  AA      E+FQ +    + +    +  +  +RE V +K+NSAI+++LLQS+DV R+ Y GTL R + SL   E                                +ATEAL+ I++  Y + I +KT ST++ +L++K+K+L++ +PW   P LD+ W    + +ML ++S+ +L   +  QI+E ++ +HE F  +++RLE R+        + +D I+R + P++ARL LE +S+RD +++G+P++ REIGRGQYGVVY+C  WG ++ +AVKSVVPPD+KHW DLA+EF+Y K + EHDRIA + GSV+DY  +YGS PA+L IM+R+ RD +AA+KQ L+W  RLQV+ DV+EGIRFLHSQGL+HRDIKLKNVLLD  NR KLTDLGFCKP AM+SGS+VGTPIHM PELF+  Y+ SVD+YAFGILFWY+C+  V++P NF++ T K+ L+ +VK+G+RPER P    ECW L+  CW  D   RPLPG +  QL  M  +A
Sbjct:   70 LLNQPVAMVVLGQTRYAKAVLVNEILRQDLLPVATDSDSVYNGWRMIRFRFAAKPAVSLSLPDDNYDLMEDLSAYQQPWDTIPEQDLILQAEERTDLANRAAVMEVALNHPLLRDGAILVVSPC---KELCNVAEVFSQCTRGAQPILVYAIELDHLTSSDLSELQQHRQLAPNLPLFFIRVPQPAAY----ANYRQQRRQFACPPP-------VPPSAAAAAASGTGDLLQQPQAAPRLFADLCELGFLSMMPGGG-SRGGHPAGSAASSSASPADAACQPLASELVENFEANFCRILIYVRRALQQILVQAATLLNDNHCAVLNNFILLAFDLARDVLVTPKKLRFAKSKELELYNSLMEISSRKQEEIRQLIAFTLENMRECLLLAA------EAFQFRYDPAQSHGANARRCSVQIRELVMAKLNSAISDQLLQSIDVFRDAYTGTLTRCLESLEDEEAPQDLPAAAAAAASPATLADVPGGVGPSSSGASATEALRLIVNAAYQVEINVKTGSTYVRALLDKIKELMTSMPWSSPPKLDSEWRRAVAQEMLGNLSDQRLARHMCGQISERVRAAHEAFTAAMRRLEERLSAHTAACEDQRDLIRRRHAPRIARLALESISIRDMIVYGMPQIGREIGRGQYGVVYSCEAWGGFSPVAVKSVVPPDDKHWNDLALEFYYTKHLPEHDRIAHLRGSVIDY--TYGSGPAVLLIMERLTRDLHAAIKQNLNWPGRLQVACDVVEGIRFLHSQGLVHRDIKLKNVLLDRRNRAKLTDLGFCKPHAMMSGSIVGTPIHMPPELFSGVYDSSVDVYAFGILFWYLCAGTVRLPYNFEQCTTKDVLWTSVKRGVRPERLPCFSDECWQLMKLCWAADSELRPLPGALLPQLQSMLAEA 942          
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Match: A0A267GRI3 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027899g1 PE=4 SV=1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 353/896 (39.40%), Postives = 535/896 (59.71%), Query Frame = 1
Query:  286 LTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNA--PWKMIKFHYGIKTITSLCEFDNAFDL-GDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDM--------KLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLK-------IDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMVSIKMY----KSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFE----------------------------EENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKA 2823
            L ++ ++++++GQT Y K+V+VNEI ++ ++P+  D  +    W+MI+F +  K   SL   D+ +DL  D +      D I E+ LI  A +  D A   + ++V  +  +L +G  +VV P    K +  +  ++        PIL+YA E + L+S D +EL++ + LA + P+FF++VP    Y    A+Y+  + +                  +   A+ +GD+        +LF  LC++  +S +  G  S    P   T   +          + S+L+  F++ F ++  Y    +Q+ LV+  T++       L N IL  +DL+   ++TPKK+ FAK +EL LYNSL+  S+ K EEI  LI   L  M++ L  AA      E+FQ +    + +    +  +  +RE V +K+NSAI+++LLQS+DV R+ Y GTL R + SL   E                                +ATEAL+ I++  Y + I +KT ST++ +L++K+K+L++ +PW   P LD+ W    + +ML ++S+ +L   +  QI+E ++ +HE F  +++RLE R+        + +D I+R + P++ARL LE +S+RD +++G+P++ REIGRGQYGVVY+C  WG ++ +AVKSVVPPD+KHW DLA+EF+Y K + EHDRIA + GSV+DY  +YGS PA+L IM+R+ RD +AA+KQ L+W  RLQV+ DV+EGIRFLHSQGL+HRDIKLKNVLLD  NR KLTDLGFCKP AM+SGS+VGTPIHM PELF+  Y+ SVD+YAFGILFWY+C+  V++P NF++ T K+ L+ +VK+G+RPER P    ECW L+  CW  D   RPLPG +  QL  M  +A
Sbjct:   70 LLNQPVAMVVLGQTRYAKAVLVNEILRQDLLPVATDSDSVYNGWRMIRFRFAAKPAVSLSLPDDNYDLMEDLSAYQQPWDTIPEQDLILQAEERTDLANRAAVMEVALNHPLLRDGAILVVSPC---KELCNVAEVFSQCTRGAQPILVYAIELDHLTSSDLSELQQHRQLAPNLPLFFIRVPQPAAY----ANYRQQRRQFACPPP-------VPPSAAAAAASGTGDLLQQPQAAPRLFADLCELGFLSMMPGGG-SRGGHPAGSTASSSASPADAACQPLASELVENFEANFCRILIYVRRALQQILVQAATLLNDNHCAVLNNFILLAFDLARDVLVTPKKLRFAKSKELELYNSLMEISSRKQEEIRQLIAFTLENMRECLLLAA------EAFQFRYDPAQSHGANARRCSVQIRELVMAKLNSAISDQLLQSIDVFRDAYTGTLTRCLESLEDEEAPQDLPAAAAAAASPATLADVPGGVGPSSSGASATEALRLIVNAAYQVEINVKTGSTYVRALLDKIKELMTSMPWSSPPKLDSEWRRAVAQEMLGNLSDQRLARHMCGQISERVRAAHEAFTAAMRRLEERLSAHTAACEDQRDLIRRRHAPRIARLALESISIRDMIVYGMPQIGREIGRGQYGVVYSCEAWGGFSPVAVKSVVPPDDKHWNDLALEFYYTKHLPEHDRIAHLRGSVIDY--TYGSGPAVLLIMERLTRDLHAAIKQNLNWPGRLQVACDVVEGIRFLHSQGLVHRDIKLKNVLLDRRNRAKLTDLGFCKPHAMMSGSIVGTPIHMPPELFSGVYDSSVDVYAFGILFWYLCAGTVRLPYNFEQCTTKDVLWTSVKRGVRPERLPCFSDECWQLMKLCWAADSELRPLPGALLPQLQSMLAEA 942          
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Match: A0A4Y2NKJ8 (Dual serine/threonine and tyrosine protein kinase OS=Araneus ventricosus OX=182803 GN=dstyk_0 PE=4 SV=1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 353/880 (40.11%), Postives = 525/880 (59.66%), Query Frame = 1
Query:  250 QIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIK-----YDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQ-DCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKV-PPYEK-------------YSRL----PADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID-LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEE--ENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLL 2805
            Q+ +E +     +    + + I+G   + K+ + NE+F ++I+P +      D     W+M++F YG++T  SL    N+++L D      +Q   +  E L       +D AFE + +DV     +L + + V+V P+    + E+I ++    +     I+IYA     LS  + +EL EIK      PIFF+ V PP  +             Y R     P  Y  +   L  VL          RK S  +   S  + L   LC +  ++      FS     KL       ++++S LI  F++F   L  +    +Q  LV+V TI+ +  +  L+  IL  +D+++  +ITPK++ +A+Q+E  LY SL+S +  K EEI  LI E +N M  + L  A+  E   +E   D+  S++  +  T+ ++  V   +NSA+A KL+ S+D LR ++VGTLER + SL   +E  E   A+ ALK IL+  Y + + ++TSS+ +  L EKMKQL+  LPW+  P +D  W  + + DML S+SE +L   + +Q  E L+ SHE F  S++ LE     R  +  E + ++++L+ PKLA+  LE  SLRD +L+G+P + REIGRGQYGVVYAC++W  Y+  A+KSVVPPD+KHW DLAMEF+Y + + EHDRI  I GSV+D  Y+ GS PA+L +MDR+ RD Y+ALK GL W TRLQ++LDV++GIRFLH QGL+HRDIKLKNVLLD +NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF+  Y+ SVD+YAFGILFWY+C++ V++P  +++  +K+ L+ +VKKG RPER P+ D+ CW L+  CW+ +P+ RPL GE+E +L+
Sbjct:   48 QLKLENEQTVYGVIYSSIGITILGHDCWAKAAVANELFGQKILPTEPQDAESDSSKMAWRMVRFIYGVETQVSLA-LPNSYELLDHLVSHEQQWHTVPLEDLELKGKPGEDPAFETAVLDVKLRHQLLRDDVVVMVSPTNVNASFEQILSVC---MDGFTSIVIYAISNGVLSQSEVSELMEIKKKFPKLPIFFICVFPPSSELTESEQHVRNIGLYGRRSVFKPHSYHESSPMLQTVLK---------RKESLDSKLGSASLTLCQQLCGLGFLNV-----FSPNLKKKLCRQPSGGIEVESKLIEDFENFSSILL-HIRQILQAELVQVATILNEAHNTCLRMFILSAFDMTWDMLITPKRIAYARQRENELYESLMSIANCKQEEIRQLIVETINAMTDELLLKASEYEFQGVELSDDEPPSVRELQICTSEIQSLVLHSLNSAVAGKLIGSVDYLRESFVGTLERCLVSLENVKEGSEPSQASNALKQILNAAYQVEVTVRTSSSLLRVLFEKMKQLVQTLPWKAPPVIDCEWKRKVAYDMLMSLSESRLARSICSQFRERLRASHEQFAASLRHLEAMHSGRLERTEEQRLKVRKLHAPKLAKFALESTSLRDIILYGMPHIGREIGRGQYGVVYACDSWAGYSPCAIKSVVPPDDKHWNDLAMEFYYTRSIPEHDRIVQIRGSVIDLTYAGGSTPAVLLVMDRLQRDLYSALKMGLPWKTRLQLALDVVQGIRFLHGQGLVHRDIKLKNVLLDKHNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGRYDNSVDVYAFGILFWYICADHVRLPYVYEQCQSKDQLWTSVKKGARPERLPQFDENCWRLMEDCWNGNPSLRPLLGEVEPRLM 908          
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Match: A0A210R406 (Dual serine/threonine and tyrosine protein kinase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11176 PE=4 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 342/877 (39.00%), Postives = 532/877 (60.66%), Query Frame = 1
Query:  304 SLIIMGQTHYTKSVIVNEIFKKRIMP-IKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQ-DCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSR-----LPADYKFTKEELLAVLN--------------------PPISFAPNGRKVSNTNANDSGDMKL-------FGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAA----VEIDLESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEENINA------TEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
             ++I GQ  Y KS +VNEIF + I P  +    N   +M++F YG      L    + +DL +      +    I  E +  +   S D A   + ++V  +  +L  G KV+V PS+      ++   Y      + PIL++AF+  +L+  D + L++++ ++   P+ FV V   +  S         +   +K++L A  N                    P    +P    +S+  +  +   ++       F  LC +  +S  + G  +LT      T+  +  ++DS+LI  F SF  ++  +    IQ+YLV   T++      +L   I+  +D++   +ITPKK+EFA+ +E  LY SL+  S EK +EI  +I E +  + Q+L D AA    + +D +  Q  +++ K  K  T  ++E V   +N AIA  L++S+DVLR+TY GTL R + SL +F+ ++  +      +EALK IL+  Y + I +++SS+F+ +++E+MKQL+  +PW   P +D  W  + ++D+L ++SE +L   + +QI E L +SH+ F I++++LE +   R +K  + + ++++++ P++A++ LE  SL+D +L G P+++REIGRGQYGVVY+C++W  +   A+KSVVPPD+KHW DLA+EF+Y K +  H+RI  + GSV+DY Y  G++PA+L IMDR+ RD YAA+KQGLDWV+RLQVS+DV+EGIRFLHSQGL+HRDIKLKNVLLD +NRGK+TDLGFCKP AM+SGS+VGTPIHMAPELF+  Y+ SVD+YAFGILFWYVC+  VK+P+ F++  NK+ L+ +VKKGLRPE+    D +CW+L+  CW  +P KRPL G +E +L
Sbjct:   65 GIVIFGQNAYCKSCVVNEIFSRNIFPRFENGDINGNNRMVQFKYGSNLSVGL-SLPDGYDLAENLEAYKRPWSTIPIEDIEISENPSLDGANGTAVLEVSINHSMLRHGAKVIVSPSMNDSG-SDLEQKYSKCCEKVSPILLFAFQTQELTENDLSFLKKLQTISHYQPVCFVGVSTEKSDSSDGSRTTEKNLNASKQKLEAGCNGSIEDLDDHENQNHLTNIDEPNYCVSPMSSPLSSVCSKGTCKGRVILTSSLVFHQLCDIGYLSE-SPGSRNLT-----NTMATDYYEVDSELIDNFASFPSRIVYFVQQTIQRYLVNAATVLNNCHERSLNMFIVSAFDMARDMMITPKKLEFARGKETELYKSLMKISVEKGDEIKLMISETIQSIHQSLVDKAAQYEFLGVDFDE-QSVILTTKGLKICTYQIQELVLGALNQAIAGNLVRSVDVLRDTYTGTLSRCLESLERFDVDHGQSANSKSTSEALKQILNAAYQVEISLQSSSSFIRNILERMKQLVKAMPWSTPPRIDEEWKKKAAADILANLSEARLAKSISSQIKERLNKSHDAFAIALRQLEQKHSGRLDKIEDERLKLRKVHAPRVAKVALESTSLKDVILHGTPQMSREIGRGQYGVVYSCDSWSGFAPCAIKSVVPPDDKHWNDLALEFYYTKNIPPHERIVVLRGSVIDYMYGGGTSPAVLLIMDRLQRDLYAAIKQGLDWVSRLQVSIDVVEGIRFLHSQGLVHRDIKLKNVLLDKDNRGKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGRYDNSVDVYAFGILFWYVCAGHVKLPSAFEKCDNKDHLWTSVKKGLRPEKHLTFDADCWNLMVECWEGEPLKRPLLGNVETRL 932          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 434.491 bits (1116), Expect = 2.641e-137
Identity = 225/536 (41.98%), Postives = 321/536 (59.89%), Query Frame = 1
Query: 1216 ILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID--LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEEE----NINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            I Q +D+     ITP+++E+ +++E  L+ SL++ +  K EE+  +I E L+ MK Q L DAA +E    + +   + V+ K  KS    ++E +  ++N A+A KL+ S+D LR ++VGTLER ++SL K   +    N+ +   LK IL+  Y + +   + S+    + E++KQ+I RL W   P +   W  + + D + S+S  KL   + +Q    L  SH+ F  S+++LE     R  +  ++  R+++ + P+LARL LE  SLRD +L+G PKL RE+GRGQYGVVY C+ WG  N  A+KSVVPPD+KHW DLA+EF Y + + +H+R+  +HGSV+D+ Y  GS+ A+L IM+R+ RD Y  LK GL    RLQ++LDV+EGIRFLH QGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF                                              G RPER P  D+ECW L+  CW+ DP +RPL G ++  L
Sbjct:  354 INQAFDMQRDLQITPRRLEYTREKESELFASLMAIANRKQEEMKEMIVETLSTMKEQLLEDAANLEFTDIIVTPNGEPVTTKEIKSCIQQIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSSLEKSTTDSSVHNVTSNH-LKQILNAAYHVEVTFHSGSSVTRLVWEQIKQIIQRLTWVNPPAITPEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHDAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLYGKPKLGRELGRGQYGVVYLCDKWGEQNPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHGSVIDHTYGGGSSIAVLLIMERLHRDLYTGLKAGLSLKERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFT---------------------------------------------GSRPERLPTFDEECWQLMEACWNGDPLQRPLLGIVQPSL 843          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 92.4337 bits (228), Expect = 8.896e-19
Identity = 58/181 (32.04%), Postives = 101/181 (55.80%), Query Frame = 1
Query: 2251 SYGSNPAILFIMDRMARD---FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAM---LSGSLVGTPIHMAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            ++ S   + F+M+ +      F+   K   D       S ++I G++FLHS+G+I+RD+KL NV+LD +   K+ D G CK   +    + +  GTP ++APE L  Q+Y FSVD ++FG+L + +     + P   D   +++ LFE+++  + P  P  I +E  DL+ + + +DP +R
Sbjct:  393 TFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIG--QSPFQGD---DEDELFESIRMDV-PHYPRWITKESKDLLEKLFERDPTRR 567          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 92.4337 bits (228), Expect = 9.927e-19
Identity = 58/181 (32.04%), Postives = 101/181 (55.80%), Query Frame = 1
Query: 2251 SYGSNPAILFIMDRMARD---FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAM---LSGSLVGTPIHMAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            ++ S   + F+M+ +      F+   K   D       S ++I G++FLHS+G+I+RD+KL NV+LD +   K+ D G CK   +    + +  GTP ++APE L  Q+Y FSVD ++FG+L + +     + P   D   +++ LFE+++  + P  P  I +E  DL+ + + +DP +R
Sbjct:  429 TFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIG--QSPFQGD---DEDELFESIRMDV-PHYPRWITKESKDLLEKLFERDPTRR 603          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 91.6633 bits (226), Expect = 2.966e-18
Identity = 71/265 (26.79%), Postives = 122/265 (46.04%), Query Frame = 1
Query: 2056 IGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQG----LDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLD-YNNRGKLTDLGFCK------PCAMLSGSLVGTPIHMAPELFNQ---EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLL 2808
            +GRG YGVVYA        ++A+K +   D ++   L  E    K + + +        +V Y  S   +  I   M+++     +AL +     L   T +  +  ++EG+R+LH   ++HRDIK  NVL++ Y+   K++D G  K      PC   + +  GT  +MAPE+ ++    Y    DI++ G     + + K   P   +    + ++F+     + PE P  +  E    I RC+  DPNKR   G++   L +
Sbjct:  647 LGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKQRN--------IVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPC---TETFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGK---PPFHELGEPQAAMFKVGMFKIHPEIPESLSTEAKSFILRCFEPDPNKRATAGDLLKDLFV 897          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Match: BMX (BMX non-receptor tyrosine kinase [Source:NCBI gene;Acc:103025345])

HSP 1 Score: 89.3521 bits (220), Expect = 8.456e-18
Identity = 89/333 (26.73%), Postives = 153/333 (45.95%), Query Frame = 1
Query: 1825 LTHEVINQITENLKQSHENFII-SIKRLENRVEVRQNKHAEMQDRIKRLYT-----PKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMS---EHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHM------APELFN-QEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            ++H +IN   E      EN +  +I R+   +E  Q+  A M  R++R  T     P  A  + E    R++V     +L +E+G GQ+GVV     W   +++A+K V     K  C  + +F    Q+     H ++  +HG   +    Y       F+ +    DF  +  + +     L + LDV E + +L  Q  IHRD+  +N L+D +   K++D G  +   +L      +P         APE+ N  +++   D++AFG+L W V S   K P  ++ + N + + E V +G R  RP     + + ++  CWH+ P +RP
Sbjct:  340 VSHYLINVNAEGKYYLAENHLFDTIPRM---IEYHQHNSAGMSTRLRRPATESDDTPPSA--HGEWELCREDV-----ELVKELGSGQFGVV-QLGMWKGQHEVAIKMV-----KEGCMSSDDFIDEAQIMMKLRHPKLVRLHGVCTERFPIY---IVTEFMSNGCLLDFLRSHGKEMQPPQLLNMCLDVCEAMAYLEDQQFIHRDLAARNCLVDKDLTVKVSDFGMAR--YVLDDQYTSSPGTKFPVKWSAPEVLNYTKFSSKSDVWAFGVLMWEVYSLG-KQP--YEHYDNGQ-VAEKVMQGHRLYRPQLATDQIYQVMKACWHEAPEERP 647          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 160.229 bits (404), Expect = 1.672e-41
Identity = 155/599 (25.88%), Postives = 262/599 (43.74%), Query Frame = 1
Query:  307 LIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEV----LIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIK----QKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQD--SPIFFVKVPPYEK---------YSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIM-KQTLPDAAAVEI-DLESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSL---GKFEEENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLIS-RLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVL 2028
            L+I G +   K   +  I  +R++P       AP   + F +  K  TS+       DL         + C+   V     I  A ++D            H      + + VV+ PS +      A+EE+R       S LLP+L+YA     LS  D  EL  +K   Q+   P+FF+++PP            Y+RL   Y   + +L                   +  N  G   L   L  ++ +     G    T + +  +  L D               ++L ++    +   LV    ++    +  L   I   +D++    ITP+++++ + +E  LY SL+  + EK EEI  +I + L+ M KQ L +AA  E  D+     +  S +  +  +  ++E V +++  A+A KL+ S+D LR ++VGTL R ++SL   G     N   +  LK IL+  Y + +  ++ S+    L E++KQ+    L W   P L A W  + + D ++S+S  KL   + +Q    L  SHE F  S+++LE +   R  +  +M  R+++ + P+LARL LE  SLRD +L
Sbjct:   27 LLIAGTSDGAKLRALECILGERVLPDLPSDGTAPLSSLAFVFDAKGPTSI-------DLPHIYLRTYVRACVFRAVRSHTWIIGAGRADRTTRVTPCARPRH------QEVSVVLAPSRQLQPLTSALEELR-------SHLLPVLLYAVASERLSEADALELARLK---QNFSEPVFFLRLPPAPPAPPAPAAPPYARLTTTYAKLERDL------------------PSAGNSCGGTVLHRQLVGLDYLGGTTAG----TSAGRAHSA-LTDCA-------------DRLPHFSRLALHARLVEATGVLGGVHARGLDLFISHAFDMARDLQITPRRLQYTRAKEEELYASLLEIANEKQEEIRQMIVDTLDSMRKQLLEEAATTEFADVPVSNGEPGSGRGVQRCSKHIQELVLNRLKEAVASKLIASVDYLRESFVGTLARCLDSLEKSGGDVTSNSLTSSHLKQILNAAYHVEVTFQSGSSVAYILWEQIKQVGQVYLTWTTPPALTAEWKRKVAQDTMDSLSASKLAKNICSQFRARLNHSHEAFASSLRQLEAKHSGRLERTEDMWLRVRKDHAPRLARLSLESRSLRDILL 566          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 88.5817 bits (218), Expect = 1.174e-19
Identity = 51/150 (34.00%), Postives = 89/150 (59.33%), Query Frame = 1
Query: 2356 SLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKP---CAMLSGSLVGTPIHMAPEL-FNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR-PLPGEI 2790
            + +++ G++FLH QG+I+RD+KL N+LLD +   K+ D G CK      + +G+  GTP ++APE+   Q+YN SVD ++FG+L + +   +        R  ++E LFE+++  + P  P  I ++  D++     ++P KR  + GEI
Sbjct:   94 AAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPF-----RGDDEEELFESIRTSV-PYYPRWITKDSRDILPLLLEREPMKRLGVTGEI 237          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Match: ripk2 (receptor-interacting serine-threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030902-3])

HSP 1 Score: 81.6481 bits (200), Expect = 3.281e-16
Identity = 59/173 (34.10%), Postives = 80/173 (46.24%), Query Frame = 1
Query: 2314 ALKQGLDWVTRLQVSLDVIEGIRFLHS--QGLIHRDIKLKNVLLDYNNRGKLTDLGFCK------PCAML-SGSLVGTPIHMAPELFNQEYNFSV--DIYAFGILFWYVCSNKVKVPTNFDRFT--------NKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            A+   L W  RL+V  +V  G+ FLHS    L+HRD+K  NVLLD     KL D G  K       C+ + S +  GT  +M PE F   Y  S+  D+Y++ IL W V + +       D           N+ S  E+      P R P +      L+ RCW QDP +RP
Sbjct:  111 AVYPELPWPLRLRVLHEVALGVNFLHSLEPPLLHRDLKASNVLLDEEFHVKLGDFGLAKWRQLSLACSSVHSQAGTGTVFYMPPEAFEMHYRPSIKYDVYSYAILSWEVLTRQRSFEDAVDSTQVIFSVFRGNRPSTSESALPLSTPHRAPLL-----ALVQRCWAQDPEQRP 278          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000985.1 (pep scaffold:Pmarinus_7.0:GL478231:26303:40782:-1 gene:ENSPMAG00000000890.1 transcript:ENSPMAT00000000985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 5.251e-16
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 2323 QGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLG--FCKPCAML-----------SGSL-----VGTPIHMAPELFNQ---EYNFSVDIYAFGILFWYVCSNK-------VKVPTNFDRFTNKESLFEAVKKGLRPER---PPKIDQECWDLISRCWHQDPNKRP 2775
            + + W  R ++ L+VIEG+ ++HSQ +IH+D+K +NVL++ +   K+ D G   CK  + L           SG       +GT  +MAPE FN    + N   D+Y+F IL W + + K           T +D   N        +K  RP+    PP+       L+  CW+Q P +RP
Sbjct:  108 ENVPWCLRARIMLEVIEGMLYVHSQKIIHQDLKPENVLVNGDFHAKIADFGVSICKTWSRLGKEEQTRRNTVSGEKKKKLGMGTAAYMAPERFNNVNLQANEKTDVYSFAILTWVIITQKEPYQHLQCGDQTTYDVLKN------CTEKNQRPDMNLVPPRSPHCIIKLMESCWNQRPEERP 283          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Match: btk (Bruton agammaglobulinemia tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070531-1])

HSP 1 Score: 78.5666 bits (192), Expect = 3.010e-15
Identity = 70/260 (26.92%), Postives = 123/260 (47.31%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATI-------HGSVVD-YNYSYGSNPAILFI--MDRMARDFYAALKQGLDWVTRL-QVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPC---AMLSGSLVGTPIHMA-PELF-NQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            L +E+G GQ+GVV          ++ V   V  +      +A++  +   MSE D I          H  +V  Y  S    P +L    M+    + +   ++G +  ++L Q+  DV E + +L  +  +HRD+  +N L++     K++D G  +        S S    P+  + PE+F N +++   D++AFGIL W V S  + +P  +D ++N  ++ E V+ G R  RP +  Q    ++  CWH+ P +RP
Sbjct:  311 LLQELGSGQFGVV----------RLGVWKRVRGN------VAIKMLHEATMSEDDFIEEAKTMMRLWHPKLVHFYGVSCRKRPFLLVTEYMEAGNLESFVRERRGANSASQLLQMCADVCEAMAYLERESFLHRDLAARNCLVNAQGTVKVSDFGMSRYVLDDQYTSSSGTKFPVRWSPPEVFLNNKFSSKSDVWAFGILMWEVFSEGM-LP--YDPWSNS-NVVEQVQAGYRLYRPERATQPVHLIMHSCWHERPEERP 550          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 81.6481 bits (200), Expect = 3.651e-16
Identity = 73/278 (26.26%), Postives = 117/278 (42.09%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELF-NQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKT---KAQNLNIFNQSIISRD 2865
            L + IGRG YGVVY          +A+K VV  +++   D+  E    K ++ H+ I   HG +     SY     + +  +   R   +    GL            + G+++LH +G+IHRDIK  N+LL  +N  KL D G        + +L GT   MAPE+  N+  +   DI++ G     V     K P  +   T+    +        P  P    +   D +S+C+ ++  KRP   ++   + +  T   K   LN F +     D
Sbjct:   27 LKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLN-HNNIVKYHGFI---RKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGAT---VVEMLTKNPP-YHNLTDANIYYAVENDTYYP--PSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINSTENVKVDKLNKFKEDFTDAD 294          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 77.411 bits (189), Expect = 2.041e-15
Identity = 48/148 (32.43%), Postives = 83/148 (56.08%), Query Frame = 1
Query: 2356 SLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFN-QEYNFSVDIYAFGILFW--------YVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            + +V   + +LHS+ +I+RD+K +N+LLD N   K+TD GF K    ++ +L GTP ++APE+ + + YN S+D ++FGIL +        +  SN +K    +++  N E  F           PP  +++  DL+SR   +D ++R
Sbjct:  191 AAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKT---YEKILNAELRF-----------PPFFNEDVKDLLSRLITRDLSQR 324          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 75.8702 bits (185), Expect = 6.661e-15
Identity = 44/140 (31.43%), Postives = 77/140 (55.00%), Query Frame = 1
Query: 2356 SLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELF-NQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            + +VI  + +LH+  +I+RD+K +N+LLD N   K+TD GF K    ++ +L GTP ++APE+   + YN SVD ++ G+L + + +        +D  T     +E + +G +   PP    +  DL+S+    D  +R
Sbjct:  174 AAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPF---YD--TTPMKTYEKILQG-KVVYPPYFHPDVVDLLSKLITADLTRR 307          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Match: YPL150W_mRNA (Protein kinase of unknown cellular role; binds phosphatidylinositols and cardiolipin in a large-scale study [Source:SGD;Acc:S000006071])

HSP 1 Score: 76.6406 bits (187), Expect = 1.334e-14
Identity = 44/139 (31.65%), Postives = 76/139 (54.68%), Query Frame = 1
Query: 2374 GIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSG--SLVGTPIHMAPELFNQEY--NFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPK-IDQECWDLISRCWHQDPNKRP 2775
             + + HS   +HRD+KL+N+LLD N   KLTD GF + C   +   ++ GT ++MAPEL  +     F +DI++ G++ + + +  +     FD     ++ ++ V +   P+   K I  +  DLISR   ++P +RP
Sbjct:  144 AVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLP----FDDDDEAKTKWKIVNE--EPKYDAKVIPDDARDLISRLLAKNPGERP 276          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 75.485 bits (184), Expect = 2.476e-14
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 1
Query: 2053 EIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARD------FYAALKQG-LDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLS---GSLVGTPIHMAPELFN-QEYNFSVDIYAFGILF 2598
            +IG+G  G VY     G    +A+K +    +     +  E    K         + H ++V++  SY     +  IM+ M          +  L +G +  V R     + + G+ FLHS+G++HRDIK  N+LL      KLTD GFC     L+    ++VGTP  MAPE+ + +EY   VDI++ GI+ 
Sbjct:  625 KIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMK--------GSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCR-----ETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 804          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Match: EDO44458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW1])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 328/873 (37.57%), Postives = 509/873 (58.30%), Query Frame = 1
Query:  241 IPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYD-QPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNK-QDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLK------IDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLI-GEILNIMKQTLPDAAAVEI-DLE-SFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGKFEE-------ENINATEALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLL 2805
            + T +P +       + +K  ++I++GQT + K  ++NE+  + ++P   D + +  W+MI+  YG  +  SL    ++F+L    N       C+    L  N  +  D A  ++  ++  +  +L  G ++V  PS  +   E I   + +   D+LPIL+Y+ E + LS  D+ EL +IK LA D PIFFVK       SR   D          + N    +A +        A      ++F    Q+  I  +        ++ + E +D+ + K      I   ++ +  S F     +    +Q +LV   T++      AL   I   +D++   +ITP+++E+AK++E  L+ +L+  +T K EEI  +I   I N+  Q L +  ++E   +E S + K+++ K     T  ++E V  ++N A+A  ++ S++ LR ++VGTL+R ++SL K +        E  +AT ALK+++   Y + +  + SS+    L EKMKQ I  LP +  P +D+ W  + + DML S+SE +L   +  Q    L +SHE+F   ++ LE     R  K  E + ++++ + PK+ARL LE  SLRD VL+G+P+L+RE+GRGQYGVVYAC+ W   +  A+KSVVPPD+KHW DLA+EFFY + +  HDR+ +I GSV+DY+Y  GS+PA+L +MDR+ RD Y  +K GL +  R+ V++DV+EGIRFLHSQGL+HRDIKLKNVLLD  NRGK+TDLGFCKP AM+SGS+VGTPIHMAPELF+  Y+ SVD+YA GIL WY+C+  V++P  F++  +K+ L+ AV++G+RPER    D+ECW L+  CW  DP+ RPL G+I+ QL+
Sbjct:   44 LATFLPADKCQSLDSVCEKPPTIIVVGQTCFAKVCVINELLGEPVLPSVEDLEGDRSWRMIRIKYGNISNVSLV-LPDSFELAAALNAYEGCWQCVPRGDLELNDEEKADPAMASAVAEISLNHALLKAGAQLVCSPSNPEGDAENI---FSACCEDVLPILVYSIEQDFLSDKDEAELLQIKALAPDLPIFFVKC------SRKKPD----------LTNSMTEYAQHEAIEEFAEAR----TRIFE---QLRKIGYLTQESPEQKKALQHEVLDIRNAKAILDSVIPKSMLIENFSLFPCFLLFVRQVLQFHLVEAATVMNDAHCRALSLFITTAFDMARDMIITPRRLEYAKEKEEELFLALMETATRKQEEIKEVIKSTIENLSPQILKEVESLEFRGVECSGEQKLLNPKDLDHCTFQIQELVLGRINKAVAGNMISSVEYLRESFVGTLQRCIDSLEKMDSDSRRNACEYTSATVALKHVIDAAYQVEVTYRASSSLARLLWEKMKQAIQTLPGKTPPKVDSAWKRKVAQDMLTSLSETRLAKHICLQFRTRLIKSHESFTSCMRMLEANHTGRLEKTEEQRMKVRKSHAPKIARLALESWSLRDVVLYGMPQLSREVGRGQYGVVYACDRWAGRHPCAIKSVVPPDDKHWNDLALEFFYTRSLPLHDRVVSIIGSVIDYSYGGGSSPAVLLVMDRLQRDLYQGIKAGLSFRARMHVAVDVVEGIRFLHSQGLVHRDIKLKNVLLDSKNRGKITDLGFCKPEAMMSGSIVGTPIHMAPELFSGHYDNSVDVYALGILLWYICAGTVRLPLAFEQCASKDHLWNAVRRGVRPERLANFDEECWMLMEACWSGDPSARPLLGDIQPQLV 889          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Match: EDO49815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG13])

HSP 1 Score: 154.836 bits (390), Expect = 1.112e-42
Identity = 77/180 (42.78%), Postives = 108/180 (60.00%), Query Frame = 1
Query: 2272 ILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQ---ECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            +L + +RMA D + AL +      RL++ LDV   +++LHS  LIHRD+KL+NVL+D  ++G LTD G CK   ++  SLVGTP  MAPE+  Q YN SVD+YAFGIL W VC  +   P N     +   +   V+  L   +P ++D+    CW+L+ RCW   P++RP   EIE  L
Sbjct:   32 VLIVSERMASDLHRALPRLTSLRKRLEILLDVARALKYLHSLDLIHRDVKLQNVLVDEKSQGSLTDFGLCKAEGVMENSLVGTPTSMAPEMVKQNYNKSVDVYAFGILMWRVCEGQGNQPRNI--ALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCWATVPDQRPNFQEIESDL 209          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Match: EDO35752 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM7])

HSP 1 Score: 131.724 bits (330), Expect = 2.073e-33
Identity = 97/343 (28.28%), Postives = 166/343 (48.40%), Query Frame = 1
Query: 1783 RTSSDMLNSISEVKLTHEVINQITENLKQSHENF---IISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNT--WGAYNQMAVKSVV--PPDEKHWCDLAME--FFYCKQMSEHDRIATIHGSV-VDYNYSYG-----SNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQ----EYNFSVDIYAFGILFWYVCSNKV-KVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCW 2751
            + +  +L+ +   K++   I    E L    E F   I +IKRL + +    +      D ++ ++ P +A L   G SL++ +  G  KL   + R    VVY C++  WG  ++  VK V     D+K W    ++  F Y       D ++ + G   V++   +G         +  +M+R+  D   AL++GL W  RL V+ DV  G++ +H    ++RD+K +NV++ +N   K+     CKP      + +G P H++PE++ +      + S DIYAFG L+W +C     K P  F+   + ES+ +A  +G  PERP  +    WDL+ +CW
Sbjct:    3 KVAQTLLSKLDSKKISDSAIKTCKEILNHMLEKFVGRIETIKRLNDTLASIPDDF----DNLRLVHVPHVAELVARGYSLQNIMNKGPVKLGAVLSRTANSVVYECSSPAWGGLDKSVVKVVKRDALDDKVWKQYILDAPFLY----PFRDIMSRLGGKCPVNHLRLFGWCLLPPCEEMYIVMERVRCDLLTALQEGLSWEQRLTVAKDVARGLQKIHKAEYVYRDLKPQNVMISFNGCAKIN---MCKPEKPFEITKLGLPFHISPEMYKRPSPGSSSSSFDIYAFGSLWWVICEGTGNKRPRAFEFCHDSESMEQATLEGRWPERPQGVSDASWDLMVQCW 334          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Match: EDO25348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWR2])

HSP 1 Score: 104.375 bits (259), Expect = 3.500e-26
Identity = 56/133 (42.11%), Postives = 75/133 (56.39%), Query Frame = 1
Query: 2437 LDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQ---ECWDLISRCWHQDPNKRPLPGEIEDQL---LLMKT 2817
            +D  ++G LTD G CK   ++  SLVGTP  MAPE+  Q YN SVD+YAFGIL W VC  +   P N     +   +   V+  L   +P ++D+    CW+L+ RCW   P++RP   EIE  L   LL KT
Sbjct:    1 VDEKSQGSLTDFGLCKAEGVMENSLVGTPTSMAPEMVKQNYNKSVDVYAFGILMWRVCEGQGNQPRNI--ALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCWATVPDQRPNFQEIESDLQEILLDKT 131          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 83.9593 bits (206), Expect = 1.079e-17
Identity = 67/266 (25.19%), Postives = 120/266 (45.11%), Query Frame = 1
Query: 2044 LNREIGRGQYGVVYACNTWGAYNQMAVKSV----VPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMAR--DFYAALK----------QGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCK---PCAMLSGSLVGTPIHMAPELF-NQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKE--SLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRP 2775
            + + IG+G YG V+         Q  +K V        E+   +L  +     Q+         H ++V Y  S+  +   L+I        D Y+ LK          Q ++W  ++ ++L      +++H + ++HRD+K +N+ L  +   K+ DLG  +     + ++ +L+GTP +M+PELF N+ YN   D++A G   + +C+ +         F  K+  SL   + KG  P  P +   +   +I     QDP+KRP
Sbjct:    8 IGKCIGKGSYGEVFLSKHKKDKKQYVLKKVDLQKASVRERKAAELEAKLL--SQLR--------HPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQKGIPLDENQIVEWFVQIAMAL------QYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLR-------HAFNAKDMSSLVYKILKGKTPPLPKQYSTDLCSIIKSMLDQDPDKRP 250          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 518.85 bits (1335), Expect = 6.917e-169
Identity = 287/738 (38.89%), Postives = 430/738 (58.27%), Query Frame = 1
Query:  613 LFEGIKVVVMPSIKQKAIEEIRAIYD-SHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPN-GRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID--LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGK--FEEENINATE-ALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            L +  KV+V+P    + IEE  A+ D SH   ++PI++YA   + L++   +EL +++ +    PI FV++P                       +  ++ +P  GR        +     L   L  +  +++          +P L  I     K  S L   FD     L  +    +Q   V    ++       L   I Q +D+     ITP+++E+ +++E  L++SL++ +  K EE+  +I E L  MK Q L DAA +E    + +   + V+ K  KS  + ++E +  ++N A+A KL+ S+D LR ++VGTLER ++SL K   +    N T   LK +L+  Y + +   + S+    + E++KQ+I R+ +   P +   W  + + D + S+S  KL   + +Q    L  SHE F  S+++LE     R  +  ++  R+++ + P+LARL LE  SLRD +L G P+L RE+GRGQYGVVY C +WG +   A+KSVVPPD+KHW DLA+EF Y + + +H+R+  +HGSV+D++Y  GS+ A+L IM+R+ RD Y  LK GL    RLQ++LDV+EGIRFLH QGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF  +Y+ SVD+YAFGILFWY+C+  VK+P  F++ ++K+ L+  VKKG RPER P  D+ECW L+  CW+ DP+ RPL G +E  L
Sbjct:  183 LLQEAKVMVVPCPSVQPIEE--ALEDCSHC--VIPIILYAVNQDSLTADQVSELWKVREML-SFPICFVRLP-----------------------DGALNASPEPGRGADKEKEKEREKSSLHKQLLSLGFLTSPTGN--CSCGAPTL--IPAPGAKPQSMLGESFDRLHRLLVPFTRQVLQNQQVEAANVLNGLHCRCLDLFINQAFDMQRDLQITPRRLEYTREKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTPNGEPVTSKEIKSCIHLIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSSLEKSTLDSSVHNVTSNHLKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQIIHRITFVNPPAITPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAGLSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWYLCTGSVKLPEAFEKCSSKDQLWNNVKKGARPERLPSFDEECWQLMEACWNGDPSLRPLLGIVEPGL 888          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 443.351 bits (1139), Expect = 3.270e-140
Identity = 264/738 (35.77%), Postives = 395/738 (53.52%), Query Frame = 1
Query:  613 LFEGIKVVVMPSIKQKAIEEIRAIYD-SHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPN-GRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMK-QTLPDAAAVEID--LESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTVNSLGK--FEEENINATE-ALKNILHFTYGLHIPIKTSSTFMSSLIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQL 2802
            L +  KV+V+P    + IEE  A+ D SH   ++PI++YA   + L++   +EL +++ +    PI FV++P                       +  ++ +P  GR        +     L   L  +  +++          +P L  I     K  S L   FD     L  +    +Q   V    ++       L   I Q +D+     ITP+++E+ +++E  L++SL++ +  K EE+  +I E L  MK Q L DAA +E    + +   + V+ K  KS  + ++E +  ++N A+A KL+ S+D LR ++VGTLER ++SL K   +    N T   LK +L+  Y + +   + S+    + E++KQ+I R+ +   P +   W  + + D + S+S  KL   + +Q    L  SHE F  S+++LE     R  +  ++  R+++ + P+LARL LE  SLRD +L G P+L RE+GRGQYGVVY C +WG +   A+KSVVPPD+KHW DLA+EF Y + + +H+R+  +HGSV+D++Y  GS+ A+L IM+R+ RD Y  LK GL    RLQ++LDV+EGIRFLH QGL+HRDIKLKNVLLD  NR K+TDLGFCKP AM+SGS+VGTPIHMAPELF                                              G RPER P  D+ECW L+  CW+ DP+ RPL G +E  L
Sbjct:  215 LLQEAKVMVVPCPSVQPIEE--ALEDCSHC--VIPIILYAVNQDSLTADQVSELWKVREML-SFPICFVRLP-----------------------DGALNASPEPGRGADKEKEKEREKSSLHKQLLSLGFLTSPTGNCS--CGAPTL--IPAPGAKPQSMLGESFDRLHRLLVPFTRQVLQNQQVEAANVLNGLHCRCLDLFINQAFDMQRDLQITPRRLEYTREKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTPNGEPVTSKEIKSCIHLIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSSLEKSTLDSSVHNVTSNHLKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQIIHRITFVNPPAITPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAGLSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFT---------------------------------------------GARPERLPSFDEECWQLMEACWNGDPSLRPLLGIVEPGL 875          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001008.2 (receptor-interacting serine/threonine-protein kinase 3-like [Source:NCBI gene;Acc:101168093])

HSP 1 Score: 92.8189 bits (229), Expect = 1.875e-19
Identity = 55/158 (34.81%), Postives = 82/158 (51.90%), Query Frame = 1
Query: 2359 LDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGS------LVGTPIHMAPELFNQEYN--FSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRP--ERPPKIDQ----ECWDLISRCWHQDPNKRPLPGEI 2790
            L+V  G+RFLHS G++HRD+K++NV+L  +   KL D G C   A    S      + GT  +M PE ++  Y    S D+Y+F I  W + S +   PT      +   L + + KG RP  +   K D+    +  DL+ +CW+ DP +RP   EI
Sbjct:  135 LEVASGMRFLHSMGILHRDLKMQNVMLSEDLHAKLADFGLCTMSATCCPSDEEETEISGTVKYMPPEAYDINYKPVRSFDVYSFAIFLWAILSGEEPFPT-----AHPSRLRKCIAKGQRPPLDDLSKTDKAGMSDLLDLMQKCWNGDPTQRPTFEEI 287          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:NCBI gene;Acc:101156777])

HSP 1 Score: 94.3597 bits (233), Expect = 3.589e-19
Identity = 72/259 (27.80%), Postives = 121/259 (46.72%), Query Frame = 1
Query: 2056 IGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQG----LDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLD-YNNRGKLTDLGFCK------PCAMLSGSLVGTPIHMAPELFNQ---EYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEI 2790
            +GRG YGVVYA        ++A+K +   D ++   L  E    K +         H ++V Y  S   N  I   M+++     +AL +     L   T +  +  ++EG+R+LH   ++HRDIK  NVL++ Y+   K++D G  K      PC   + +  GT  +MAPE+ ++    Y    DI++ G     + + K   P   +    + ++F+     + PE P  +  E    I RC+  DPNKRP+  ++
Sbjct:  624 LGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLK--------HRNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPC---TETFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGK---PPFHELGEPQAAMFKVGMFKIHPEIPESLSLEAKSFILRCFEPDPNKRPITTDL 868          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 91.2781 bits (225), Expect = 1.980e-18
Identity = 82/315 (26.03%), Postives = 149/315 (47.30%), Query Frame = 1
Query: 1897 KRLENRVEVRQNKHAEMQDRIKRL--YTPKLARLYLEGMSLR-------------DNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYS-YGSNPAILFIMDRMARD---FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAM---LSGSLVGTPIHMAPE-LFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKR 2772
            K++ N   + Q   AE   ++ ++  Y     RL+ EG S R             DN +F     ++ +G+G +G V      G+    AVK++     K    L  +   C  + +           + + YS + +   + F+M+ +      F+   K   D       S +++ G+ FLHS+G+I+RD+KL NV+L++    K+ D G CK        + +  GTP ++APE L  Q+Y+FSVD ++FG+L + +     + P + D   +++ LFE+++    P  P  I++E  DL+ + + ++P  R
Sbjct:  263 KKVANLCGINQKLLAEALTQVSQVSSYASPYGRLW-EGCSPRPQSRITHLTRINVDNFIF-----HKVLGKGSFGKVLLAELKGSGEYFAVKAL-----KKEVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGDNRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVG--QSPFHGD---DEDELFESIRMDT-PHYPRWINKEAKDLLEQLFDREPTHR 560          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Match: SMESG000012973.1 (SMESG000012973.1)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 505/510 (99.02%), Postives = 506/510 (99.22%), Query Frame = 1
Query:   55 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQXXXXXXXXXXXXXYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTV 1584
            MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLS WDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLE   +KMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTV
Sbjct:    1 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSPWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLE---NKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRNTYVGTLERTV 507          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Match: SMESG000012973.1 (SMESG000012973.1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 457/465 (98.28%), Postives = 458/465 (98.49%), Query Frame = 1
Query:   55 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQXXXXXXXXXXXXXYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMVSI 1449
            MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLS WDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLE    K+  I
Sbjct:    1 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSPWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLERMGTKLYEI 465          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Match: SMESG000012973.1 (SMESG000012973.1)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 426/465 (91.61%), Postives = 427/465 (91.83%), Query Frame = 1
Query:   55 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQXXXXXXXXXXXXXYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLESFQDKMVSI 1449
            MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQK                                DKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLE    K+  I
Sbjct:    1 MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSNDENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVNEIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLLNKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIKQK--------------------------------DKTELEEIKLLAQDSPIFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNANDSGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQFDSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVITPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAAVEIDLERMGTKLYEI 433          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Match: SMESG000012972.1 (SMESG000012972.1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 369/369 (100.00%), Postives = 369/369 (100.00%), Query Frame = 1
Query: 1780 MRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR 2886
            MRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR
Sbjct:    1 MRTSSDMLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR 369          
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Match: SMESG000012972.1 (SMESG000012972.1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 363/363 (100.00%), Postives = 363/363 (100.00%), Query Frame = 1
Query: 1798 MLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR 2886
            MLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR
Sbjct:    1 MLNSISEVKLTHEVINQITENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEGMSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKHWCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARDFYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNRGKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWYVCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWHQDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR 363          
The following BLAST results are available for this feature:
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DSTYK3.094e-17640.16dual serine/threonine and tyrosine protein kinase ... [more]
DSTYK1.144e-14737.08dual serine/threonine and tyrosine protein kinase ... [more]
DSTYK5.593e-4043.21dual serine/threonine and tyrosine protein kinase ... [more]
MAP3K55.669e-1724.73mitogen-activated protein kinase kinase kinase 5 [... [more]
TXK1.456e-1627.63TXK tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-23.023e-2026.94Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.714e-1926.81Serine/threonine-protein kinase max-2 [Source:Uni... [more]
C18H7.44.396e-1926.97Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
max-21.451e-1826.98Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.464e-1826.98Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
png8.378e-1725.48gene:FBgn0000826 transcript:FBtr0070234[more]
Abl2.643e-1628.24gene:FBgn0000017 transcript:FBtr0330131[more]
Abl2.843e-1628.24gene:FBgn0000017 transcript:FBtr0330132[more]
Abl3.210e-1628.24gene:FBgn0000017 transcript:FBtr0330130[more]
Abl3.274e-1628.24gene:FBgn0000017 transcript:FBtr0330133[more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk2.125e-17038.35dual serine/threonine and tyrosine protein kinase ... [more]
dstyk3.325e-16337.82dual serine/threonine and tyrosine protein kinase ... [more]
btk2.421e-1828.52Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
prkcdb9.297e-1829.83protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX005175.19.942e-1829.83protein kinase C, delta b [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk1.296e-17539.30dual serine/threonine and tyrosine protein kinase ... [more]
dstyk1.691e-17539.30dual serine/threonine and tyrosine protein kinase ... [more]
dstyk2.483e-17539.30dual serine/threonine and tyrosine protein kinase ... [more]
dstyk7.762e-17539.30dual serine/threonine and tyrosine protein kinase ... [more]
dstyk1.192e-17439.30dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dstyk0.000e+037.69dual serine/threonine and tyrosine protein kinase ... [more]
Dstyk5.990e-15635.14dual serine/threonine and tyrosine protein kinase ... [more]
Bmx1.660e-1730.31BMX non-receptor tyrosine kinase [Source:MGI Symbo... [more]
Bmx1.875e-1730.31BMX non-receptor tyrosine kinase [Source:MGI Symbo... [more]
Prkcd2.966e-1734.97protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XUX2|DUSTY_RAT0.000e+038.05Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX1|DUSTY_MOUSE0.000e+037.69Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX0|DUSTY_CHICK0.000e+037.88Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q4VSN4|DUSTY_CANLF1.350e-17839.90Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q20CR4|DUSTY_MACMU5.400e-17640.16Dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JRL50.000e+041.60dual serine/threonine and tyrosine protein kinase ... [more]
A0A267E1R70.000e+039.29Protein kinase domain-containing protein OS=Macros... [more]
A0A267GRI30.000e+039.40Protein kinase domain-containing protein OS=Macros... [more]
A0A4Y2NKJ80.000e+040.11Dual serine/threonine and tyrosine protein kinase ... [more]
A0A210R4060.000e+039.00Dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk2.641e-13741.98dual serine/threonine and tyrosine protein kinase ... [more]
prkcdb8.896e-1932.04protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcdb9.927e-1932.04protein kinase C delta type [Source:NCBI gene;Acc:... [more]
map3k152.966e-1826.79mitogen-activated protein kinase kinase kinase 15 ... [more]
BMX8.456e-1826.73BMX non-receptor tyrosine kinase [Source:NCBI gene... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk1.672e-4125.88dual serine/threonine and tyrosine protein kinase ... [more]
PRKCD1.174e-1934.00protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ripk23.281e-1634.10receptor-interacting serine-threonine kinase 2 [So... [more]
ENSPMAT00000000985.15.251e-1630.77pep scaffold:Pmarinus_7.0:GL478231:26303:40782:-1 ... [more]
btk3.010e-1526.92Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC153.651e-1626.26Protein kinase of the Mitotic Exit Network; locali... [more]
TPK12.041e-1532.43cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK26.661e-1531.43cAMP-dependent protein kinase catalytic subunit; p... [more]
YPL150W_mRNA1.334e-1431.65Protein kinase of unknown cellular role; binds pho... [more]
STE202.476e-1430.57Cdc42p-activated signal transducing kinase; involv... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444580.000e+037.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498151.112e-4242.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357522.073e-3328.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253483.500e-2642.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO496901.079e-1725.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk6.917e-16938.89dual serine/threonine and tyrosine protein kinase ... [more]
dstyk3.270e-14035.77dual serine/threonine and tyrosine protein kinase ... [more]
ENSORLT00000001008.21.875e-1934.81receptor-interacting serine/threonine-protein kina... [more]
map3k153.589e-1927.80mitogen-activated protein kinase kinase kinase 15 ... [more]
prkcda1.980e-1826.03protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of dual serine/threonine and tyrosine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012973.10.000e+099.02SMESG000012973.1[more]
SMESG000012973.10.000e+098.28SMESG000012973.1[more]
SMESG000012973.10.000e+091.61SMESG000012973.1[more]
SMESG000012972.10.000e+0100.00SMESG000012972.1[more]
SMESG000012972.10.000e+0100.00SMESG000012972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011629 ID=SMED30011629|Name=dual serine/threonine and tyrosine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3002bp
TTTTAAAATAAATTAATTTTTGTTAATTCTAAGTTTTTTATTACAGATTT
AGTTATGAATTCTGGACAGACAAAGAAAAAAAAATTAAAAAATTATAGTT
ATACTTACTGTCTGGCGGAAGAAATCAAAAGGTTTCGAGTAGCAAAAAAT
CAAATTAAAAAAATATTTAAGGAATTTAAAAAATCATTTTCTTATTTATC
AAATGATGAAAACATAAAACTTGAGGCTGTTAAAGCGAACATACCGACAC
AAATTCCAATGGAAATAGACAATGAAACACGATTTCTAACCGATAAAGAT
TTATCTTTAATTATTATGGGTCAAACGCATTACACTAAAAGCGTTATTGT
TAACGAAATCTTTAAAAAACGAATAATGCCTATTAAATATGACCAACCGA
ATGCTCCATGGAAAATGATCAAATTTCACTATGGGATAAAAACTATAACT
TCGCTCTGTGAATTTGATAATGCTTTCGATCTGGGGGACAGGACAAACTT
ATTGAACAAACAAGATTGCATAAACGAAGAAGTATTGATAGACAATGCAG
CGAAATCAGATGACGAAGCCTTTGAAAATTCCTACGTCGATGTGATGCAT
TCAAGCGATATTCTCTTCGAAGGAATAAAAGTGGTCGTCATGCCGTCAAT
AAAGCAAAAAGCAATTGAAGAAATCAGAGCGATATATGATAGCCATATAT
CTGACCTGCTTCCTATTTTGATCTATGCATTTGAATTTAACGACCTTTCT
TCATGGGACAAAACAGAATTGGAAGAAATTAAATTATTAGCCCAAGACAG
TCCAATATTTTTCGTCAAAGTTCCCCCTTATGAAAAATATTCCCGATTAC
CTGCAGATTATAAATTCACCAAGGAAGAGCTTTTGGCAGTTCTAAATCCA
CCAATTTCTTTTGCGCCTAACGGCCGGAAAGTTTCAAATACAAATGCAAA
CGACAGTGGAGATATGAAATTGTTTGGGACACTTTGCCAAATGAATTTAA
TATCCGCTGTAAATAACGGATTTTTCTCACTAACTCGATCCCCAAAACTA
GAAACCATAGACCTAAATGATCTCAAAATTGACTCAGACCTCATCACACA
ATTCGACTCATTTTTTGAAAAACTGACAAATTATTGTCACAGCTGCATCC
AGAAATATCTAGTTCGAGTTCTAACAATCATTACGAAATTTGCGTCAGAT
GCTTTGAAAAACCTCATTCTTCAGGTATATGATTTGTCATATAGTAGTGT
CATCACCCCGAAAAAAGTAGAATTTGCAAAACAACAAGAACTTCTACTTT
ACAACTCCCTTATTTCAAGAAGTACGGAAAAACATGAAGAAATCTGTTCA
CTTATCGGAGAGATTCTTAATATCATGAAACAAACTCTTCCCGATGCAGC
CGCAGTTGAAATTGACTTAGAGAGTTTCCAAGACAAAATGGTATCAATCA
AAATGTACAAATCTGCTACAAATACAGTTAGAGAATACGTTGCATCAAAA
GTCAATTCAGCTATAGCAGAAAAGCTTCTACAGTCAATGGACGTTTTACG
AAATACATACGTAGGCACTCTCGAAAGAACAGTCAACAGTTTGGGTAAAT
TTGAAGAGGAAAACATAAATGCAACAGAAGCTTTAAAGAACATTCTCCAT
TTTACCTATGGCCTTCATATACCGATAAAAACCAGCTCAACATTCATGAG
TAGTCTAATTGAAAAAATGAAACAACTAATATCAAGACTACCTTGGCAGC
CTGATCCAACTCTTGATGCAAATTGGGTCATGAGGACATCCTCAGACATG
TTGAACAGCATTTCAGAAGTCAAGCTAACCCATGAAGTTATCAATCAAAT
TACGGAGAATCTTAAACAATCCCATGAAAATTTCATAATAAGCATCAAAC
GCTTAGAGAATCGCGTTGAAGTTCGTCAGAATAAACACGCAGAAATGCAA
GATCGAATTAAAAGATTGTATACGCCAAAGTTGGCAAGACTCTATCTTGA
AGGAATGTCTTTGAGGGATAATGTTTTGTTTGGAGTTCCAAAATTAAATA
GAGAAATCGGAAGGGGGCAATATGGAGTTGTTTATGCTTGTAATACCTGG
GGAGCATACAATCAGATGGCAGTAAAAAGCGTTGTTCCCCCCGATGAAAA
ACATTGGTGCGATCTGGCAATGGAATTCTTTTATTGCAAACAAATGTCAG
AACACGACAGAATAGCTACTATACATGGTTCAGTTGTTGATTACAATTAT
TCTTATGGCAGCAACCCAGCCATTCTTTTTATTATGGATAGAATGGCAAG
GGACTTTTACGCAGCTTTAAAGCAAGGACTTGATTGGGTAACAAGGTTGC
AAGTGTCTCTAGATGTGATTGAAGGCATTCGGTTTTTGCACAGTCAAGGA
CTGATCCATAGAGATATCAAATTGAAAAATGTTCTTCTTGATTATAATAA
TAGAGGAAAACTCACAGACCTTGGATTCTGTAAACCTTGCGCGATGCTAA
GCGGAAGTCTAGTTGGTACACCCATCCACATGGCTCCTGAATTGTTTAAT
CAAGAATATAATTTTTCTGTTGACATTTATGCTTTTGGAATACTTTTCTG
GTATGTTTGCAGTAATAAGGTAAAGGTTCCAACCAATTTTGACAGATTTA
CAAATAAAGAAAGCTTATTTGAAGCGGTTAAAAAAGGACTCAGACCAGAA
AGACCTCCGAAAATTGATCAGGAATGCTGGGATCTGATTTCCCGGTGTTG
GCACCAAGATCCAAATAAAAGACCACTTCCTGGAGAAATAGAAGATCAAT
TGTTGCTCATGAAAACGAAAGCTCAGAATTTAAATATTTTTAACCAATCA
ATTATTTCTAGGGACAACAGCAATTGTTTAGGGAGGTGAAAATGAACTTT
TGAATTTCCTGCAATATTAAAATACATTTTTATTAAAAAAGTGATTTATC
AAATGGAATTTTGTAATCTAGTTCAGATAAATTTTCATTTGCGAAAAAAA
AA
back to top

protein sequence of SMED30011629-orf-1

>SMED30011629-orf-1 ID=SMED30011629-orf-1|Name=SMED30011629-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=945bp
MNSGQTKKKKLKNYSYTYCLAEEIKRFRVAKNQIKKIFKEFKKSFSYLSN
DENIKLEAVKANIPTQIPMEIDNETRFLTDKDLSLIIMGQTHYTKSVIVN
EIFKKRIMPIKYDQPNAPWKMIKFHYGIKTITSLCEFDNAFDLGDRTNLL
NKQDCINEEVLIDNAAKSDDEAFENSYVDVMHSSDILFEGIKVVVMPSIK
QKAIEEIRAIYDSHISDLLPILIYAFEFNDLSSWDKTELEEIKLLAQDSP
IFFVKVPPYEKYSRLPADYKFTKEELLAVLNPPISFAPNGRKVSNTNAND
SGDMKLFGTLCQMNLISAVNNGFFSLTRSPKLETIDLNDLKIDSDLITQF
DSFFEKLTNYCHSCIQKYLVRVLTIITKFASDALKNLILQVYDLSYSSVI
TPKKVEFAKQQELLLYNSLISRSTEKHEEICSLIGEILNIMKQTLPDAAA
VEIDLESFQDKMVSIKMYKSATNTVREYVASKVNSAIAEKLLQSMDVLRN
TYVGTLERTVNSLGKFEEENINATEALKNILHFTYGLHIPIKTSSTFMSS
LIEKMKQLISRLPWQPDPTLDANWVMRTSSDMLNSISEVKLTHEVINQIT
ENLKQSHENFIISIKRLENRVEVRQNKHAEMQDRIKRLYTPKLARLYLEG
MSLRDNVLFGVPKLNREIGRGQYGVVYACNTWGAYNQMAVKSVVPPDEKH
WCDLAMEFFYCKQMSEHDRIATIHGSVVDYNYSYGSNPAILFIMDRMARD
FYAALKQGLDWVTRLQVSLDVIEGIRFLHSQGLIHRDIKLKNVLLDYNNR
GKLTDLGFCKPCAMLSGSLVGTPIHMAPELFNQEYNFSVDIYAFGILFWY
VCSNKVKVPTNFDRFTNKESLFEAVKKGLRPERPPKIDQECWDLISRCWH
QDPNKRPLPGEIEDQLLLMKTKAQNLNIFNQSIISRDNSNCLGR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000299FERM_domain
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity