DNA-directed RNA polymerase II subunit RPB11

Overview
NameDNA-directed RNA polymerase II subunit RPB11
Smed IDSMED30011622
Length (bp)436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase II subunit RPB11 (SMED30011622) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase II subunit RPB11 (SMED30011622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase II subunit RPB11 (SMED30011622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase II subunit RPB11 (SMED30011622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011622 SmedASXL_003113SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30011622 dd_Smed_v4_4232_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30011622 dd_Smed_v4_4232_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Match: POLR2J (RNA polymerase II subunit J [Source:HGNC Symbol;Acc:HGNC:9197])

HSP 1 Score: 139.813 bits (351), Expect = 3.746e-43
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Match: POLR2J3 (RNA polymerase II subunit J3 [Source:HGNC Symbol;Acc:HGNC:33853])

HSP 1 Score: 136.346 bits (342), Expect = 7.447e-42
Identity = 67/108 (62.04%), Postives = 84/108 (77.78%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
            N P  FE F+L EGEK +   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ CL
Sbjct:    2 NAPPAFESFLLFEGEK-ITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Match: POLR2J3 (RNA polymerase II subunit J3 [Source:HGNC Symbol;Acc:HGNC:33853])

HSP 1 Score: 136.346 bits (342), Expect = 7.447e-42
Identity = 67/108 (62.04%), Postives = 84/108 (77.78%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
            N P  FE F+L EGEK +   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ CL
Sbjct:    2 NAPPAFESFLLFEGEK-ITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Match: POLR2J3 (RNA polymerase II subunit J3 [Source:HGNC Symbol;Acc:HGNC:33853])

HSP 1 Score: 136.346 bits (342), Expect = 7.447e-42
Identity = 67/108 (62.04%), Postives = 84/108 (77.78%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
            N P  FE F+L EGEK +   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ CL
Sbjct:    2 NAPPAFESFLLFEGEK-ITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Match: POLR2J3 (RNA polymerase II subunit J3 [Source:HGNC Symbol;Acc:HGNC:33853])

HSP 1 Score: 136.346 bits (342), Expect = 7.447e-42
Identity = 67/108 (62.04%), Postives = 84/108 (77.78%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
            N P  FE F+L EGEK +   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ CL
Sbjct:    2 NAPPAFESFLLFEGEK-ITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Celegans
Match: rpb-11 (Probable DNA-directed RNA polymerase II subunit RPB11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVH6])

HSP 1 Score: 129.028 bits (323), Expect = 3.108e-39
Identity = 60/109 (55.05%), Postives = 82/109 (75.23%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L + +KK + EK++KVPN A+FT+ KEDHTLGNM+  QLLK P+V FAGYKNPHPLEH I++R+QTT+NTTP +    ++TDL+ E+S +E +    +K
Sbjct:    2 NAPAAFESFLLLD-DKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGYKNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIK 109          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Celegans
Match: rpb-11 (Probable DNA-directed RNA polymerase II subunit RPB11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVH6])

HSP 1 Score: 129.028 bits (323), Expect = 3.108e-39
Identity = 60/109 (55.05%), Postives = 82/109 (75.23%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L + +KK + EK++KVPN A+FT+ KEDHTLGNM+  QLLK P+V FAGYKNPHPLEH I++R+QTT+NTTP +    ++TDL+ E+S +E +    +K
Sbjct:    2 NAPAAFESFLLLD-DKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGYKNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIK 109          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Celegans
Match: rpac-19 (Probable DNA-directed RNA polymerases I and III subunit RPAC2 [Source:UniProtKB/Swiss-Prot;Acc:P34476])

HSP 1 Score: 57.3806 bits (137), Expect = 4.093e-11
Identity = 29/81 (35.80%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  120 PNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKEC 362
            P+     + +EDHT+GN I + L +  +V F GY  PHPLE  I+ RVQT      +EV   +   +    S I  +F+E 
Sbjct:   58 PSNLTLIMYEEDHTIGNSIKHILSRMDEVEFCGYNVPHPLEDKILFRVQTKDGINALEVLAKAFESVEQIFSTIRGKFEES 138          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Celegans
Match: rpac-19 (Probable DNA-directed RNA polymerases I and III subunit RPAC2 [Source:UniProtKB/Swiss-Prot;Acc:P34476])

HSP 1 Score: 57.3806 bits (137), Expect = 4.093e-11
Identity = 29/81 (35.80%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  120 PNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKEC 362
            P+     + +EDHT+GN I + L +  +V F GY  PHPLE  I+ RVQT      +EV   +   +    S I  +F+E 
Sbjct:   58 PSNLTLIMYEEDHTIGNSIKHILSRMDEVEFCGYNVPHPLEDKILFRVQTKDGINALEVLAKAFESVEQIFSTIRGKFEES 138          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Fly
Match: Rpb11 (gene:FBgn0032634 transcript:FBtr0081011)

HSP 1 Score: 135.576 bits (340), Expect = 7.885e-42
Identity = 64/109 (58.72%), Postives = 84/109 (77.06%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+  E ++KV N A+FT+NKEDHTLGNMI  QLLK P V FAGYK PHPLEH  +IR+QTT++ +P E F +++TDL++E+S  EE+FK+ +K
Sbjct:    2 NAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Fly
Match: l(2)37Cg (gene:FBgn0086447 transcript:FBtr0081161)

HSP 1 Score: 49.2914 bits (116), Expect = 2.855e-8
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  102 EKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDL 320
            EK  +   T VFT   E HTLGN +   + ++P+V F GY  PHP E  +  R+Q+  +   +++ K  L DL
Sbjct:   11 EKNGEGSRTFVFT--NEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRA-IDILKRGLEDL 80          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Fly
Match: l(2)37Cg (gene:FBgn0086447 transcript:FBtr0332577)

HSP 1 Score: 49.2914 bits (116), Expect = 3.561e-8
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  102 EKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDL 320
            EK  +   T VFT   E HTLGN +   + ++P+V F GY  PHP E  +  R+Q+  +   +++ K  L DL
Sbjct:   22 EKNGEGSRTFVFT--NEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDL 91          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Fly
Match: l(2)37Cg (gene:FBgn0086447 transcript:FBtr0336628)

HSP 1 Score: 49.2914 bits (116), Expect = 4.785e-8
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  102 EKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDL 320
            EK  +   T VFT   E HTLGN +   + ++P+V F GY  PHP E  +  R+Q+  +   +++ K  L DL
Sbjct:   38 EKNGEGSRTFVFT--NEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDL 107          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Zebrafish
Match: polr2j (polymerase (RNA) II (DNA directed) polypeptide J [Source:ZFIN;Acc:ZDB-GENE-050522-120])

HSP 1 Score: 139.813 bits (351), Expect = 2.545e-43
Identity = 66/109 (60.55%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FTLNKEDHTLGN+I  QLLK P+V FAGYK PHPLEH ++IRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITITKDTKVPNACLFTLNKEDHTLGNIIRSQLLKDPQVLFAGYKVPHPLEHKVVIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Zebrafish
Match: polr1d (RNA polymerase I and III subunit D [Source:NCBI gene;Acc:445412])

HSP 1 Score: 56.225 bits (134), Expect = 9.672e-11
Identity = 28/78 (35.90%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            F LN+EDHTLGN + Y ++K   V F GY   HP E  I  R+QT       E  ++ L +L     ++ + F+  +K
Sbjct:   25 FVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQTRDGVPASEPLRNGLNNLTDVCKHVLQTFEARMK 102          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Zebrafish
Match: AL844570.1 (pep chromosome:GRCz11:CHR_ALT_CTG14_1_3:9079125:9083658:-1 gene:ENSDARG00000110760.1 transcript:ENSDART00000181010.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844570.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.655e-10
Identity = 27/75 (36.00%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKE 359
            F LN+EDHTLGN + Y ++K   V F GY   HP E  I  R+QT       E  ++ L +L     ++ + F+ 
Sbjct:   20 FVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQTRDGVPASEPLRNGLNNLTDVCKHVLQTFER 94          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Zebrafish
Match: AL844570.1 (pep chromosome:GRCz11:CHR_ALT_CTG14_1_3:9082721:9085434:-1 gene:ENSDARG00000110760.1 transcript:ENSDART00000185801.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844570.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.890e-10
Identity = 27/74 (36.49%), Postives = 39/74 (52.70%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFK 356
            F LN+EDHTLGN + Y ++K   V F GY   HP E  I  R+QT       E  ++ L +L     ++ + F+
Sbjct:   19 FVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQTRDGVPASEPLRNGLNNLTDVCKHVLQTFE 92          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:Xenbase;Acc:XB-GENE-1011804])

HSP 1 Score: 141.354 bits (355), Expect = 1.009e-43
Identity = 67/109 (61.47%), Postives = 86/109 (78.90%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHT+GN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ C+K
Sbjct:    2 NAPPAFESFLLFEGEKKITITKDTKVPNACLFTINKEDHTIGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVCIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:Xenbase;Acc:XB-GENE-1011804])

HSP 1 Score: 138.658 bits (348), Expect = 8.986e-43
Identity = 66/109 (60.55%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHT+GN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITITKDTKVPNACLFTINKEDHTIGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:Xenbase;Acc:XB-GENE-1011804])

HSP 1 Score: 137.502 bits (345), Expect = 3.231e-42
Identity = 65/105 (61.90%), Postives = 83/105 (79.05%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFK 356
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHT+GN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+
Sbjct:    2 NAPPAFESFLLFEGEKKITITKDTKVPNACLFTINKEDHTIGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR 106          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:Xenbase;Acc:XB-GENE-958519])

HSP 1 Score: 65.0846 bits (157), Expect = 5.435e-14
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:   75 GEGEKKVHFEKESKVPN---TAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
             E E+K   E      N      F L++EDHTLGN + Y ++K+P + F GY   HP E  I  R+QT +    +E F+  LT+L+    ++   F+ C+
Sbjct:    3 AEAERKTALEMVQAQGNDESCVTFVLHEEDHTLGNSLRYMVMKNPDIEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLTELVDVCQHVLNTFEVCV 102          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:Xenbase;Acc:XB-GENE-958519])

HSP 1 Score: 64.6994 bits (156), Expect = 1.259e-13
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 3
Query:   87 KKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            + +H + +    +   F L++EDHTLGN + Y ++K+P + F GY   HP E  I  R+QT +    +E F+  LT+L+    ++   F+  +K
Sbjct:   24 RLIHVQAQGNDESCVTFVLHEEDHTLGNSLRYMVMKNPDIEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLTELVDVCQHVLNTFEASIK 117          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Mouse
Match: Polr2j (polymerase (RNA) II (DNA directed) polypeptide J [Source:MGI Symbol;Acc:MGI:109582])

HSP 1 Score: 139.813 bits (351), Expect = 2.572e-43
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Mouse
Match: Polr2j (polymerase (RNA) II (DNA directed) polypeptide J [Source:MGI Symbol;Acc:MGI:109582])

HSP 1 Score: 137.887 bits (346), Expect = 1.093e-42
Identity = 66/105 (62.86%), Postives = 83/105 (79.05%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFK 356
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR 106          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Mouse
Match: Polr2j (polymerase (RNA) II (DNA directed) polypeptide J [Source:MGI Symbol;Acc:MGI:109582])

HSP 1 Score: 88.5817 bits (218), Expect = 1.582e-23
Identity = 50/109 (45.87%), Postives = 62/109 (56.88%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK                              QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKK------------------------------QLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 80          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Mouse
Match: Polr1d (polymerase (RNA) I polypeptide D [Source:MGI Symbol;Acc:MGI:108403])

HSP 1 Score: 64.3142 bits (155), Expect = 1.376e-13
Identity = 34/102 (33.33%), Postives = 55/102 (53.92%), Query Frame = 3
Query:   72 LGEGEKKVHFEKESKVP---NTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            + EGE+K   E             F L++EDHTLGN + Y ++K+P+V F GY   HP E  I +R+QT      +E F+  L +L++   ++  +F+  +K
Sbjct:   18 MAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIK 119          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Match: sp|O08740|RPB11_MOUSE (DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus OX=10090 GN=Polr2j PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.446e-42
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRGAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Match: sp|P52435|RPB11_HUMAN (DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens OX=9606 GN=POLR2J PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.799e-42
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Match: sp|Q32P79|RPB11_BOVIN (DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus OX=9913 GN=POLR2J PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.799e-42
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Match: sp|Q7PVQ9|RPB11_ANOGA (DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae OX=7165 GN=Rpb11 PE=3 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 1.768e-41
Identity = 66/109 (60.55%), Postives = 83/109 (76.15%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+  E + KVPN A+FT+NKEDHTLGNMI  QLLK P V FAGYK PHPLEH  ++R+QTTS  +P E F +++TDL+SE+S  EE+F+E +K
Sbjct:    2 NAPPTFESFLLYEGEKKIIKELDMKVPNAAIFTVNKEDHTLGNMIRNQLLKDPNVLFAGYKLPHPLEHKFVLRIQTTSEYSPHEAFMNAITDLLSELSLFEERFREAMK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Match: sp|Q9H1A7|RPB1C_HUMAN (DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens OX=9606 GN=POLR2J3 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.439e-41
Identity = 67/108 (62.04%), Postives = 84/108 (77.78%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECL 365
            N P  FE F+L EGEK +   K++KVPN  +FT+NKEDHTLGN+I  QLLK P+V FAGYK PHPLEH IIIRVQTT + +P E F +++TDLISE+S +EE+F+ CL
Sbjct:    2 NAPPAFESFLLFEGEK-ITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Match: A0A0R3SKE0 (RNA_pol_L_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5403 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.177e-47
Identity = 74/109 (67.89%), Postives = 89/109 (81.65%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKKV  EK++ VPN AVFTLN+EDHTLGNMIT QLLK P+V FAGYK PHPLEH ++IRVQTT++ TP+EVF  ++ DLISEIS+IEEQF+  +K
Sbjct:    2 NAPASFESFLLVEGEKKVFIEKDTHVPNAAVFTLNREDHTLGNMITRQLLKDPRVLFAGYKIPHPLEHRVVIRVQTTASVTPVEVFSSAIRDLISEISSIEEQFRSTIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Match: A0A504YB91 (DNA-directed RNA polymerase II subunit J OS=Fasciola gigantica OX=46835 GN=FGIG_12293 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.250e-47
Identity = 72/109 (66.06%), Postives = 88/109 (80.73%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L +GEKK+ FEK+++VPN A+FTLN+EDHT+GNMIT QLLK P+V FAGYK PHPLEH I+IRVQT + TTP++ F  +L DLISE+SNIEEQFK   K
Sbjct:    2 NAPASFEPFLLADGEKKISFEKDTQVPNAAIFTLNREDHTVGNMITCQLLKDPRVLFAGYKAPHPLEHKIVIRVQTAATTTPLDAFVSALKDLISEVSNIEEQFKMATK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Match: A0A4E0S2R9 (DNA-directed RNA polymerase II subunit J OS=Fasciola hepatica OX=6192 GN=D915_002773 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.250e-47
Identity = 72/109 (66.06%), Postives = 88/109 (80.73%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L +GEKK+ FEK+++VPN A+FTLN+EDHT+GNMIT QLLK P+V FAGYK PHPLEH I+IRVQT + TTP++ F  +L DLISE+SNIEEQFK   K
Sbjct:    2 NAPASFEPFLLADGEKKISFEKDTQVPNAAIFTLNREDHTVGNMITCQLLKDPRVLFAGYKAPHPLEHKIVIRVQTAATTTPLDAFVSALKDLISEVSNIEEQFKMATK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Match: A0A0R3TL64 (RNA_pol_L_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7959 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 4.246e-47
Identity = 74/109 (67.89%), Postives = 87/109 (79.82%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKKV  EK++ VPN AVFTLN+EDHTLGNMIT QLLK P+V FAGYK PHPLEH ++IRVQTTS  TP EVF  ++ DL+SEIS+IEEQF+  +K
Sbjct:    2 NAPASFESFLLVEGEKKVFIEKDTHVPNAAVFTLNREDHTLGNMITRQLLKDPRVLFAGYKIPHPLEHRVVIRVQTTSAVTPAEVFSSAIRDLVSEISSIEEQFRSTIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Match: V4C8A9 (RNA_pol_L_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_182011 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 7.304e-46
Identity = 72/109 (66.06%), Postives = 90/109 (82.57%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+  EK++KVPN A+FT+NKEDHTLGNMIT QLLK P+V FAGYKNPHPLEH  ++R+QTTS+ +P E F +++TDLISEIS +EE+FKE +K
Sbjct:    2 NAPPTFEAFLLFEGEKKITIEKDTKVPNAALFTVNKEDHTLGNMITTQLLKDPQVLFAGYKNPHPLEHKFVVRIQTTSDYSPQEAFTNAITDLISEISLLEERFKESVK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Cavefish
Match: polr2j (RNA polymerase II subunit J [Source:NCBI gene;Acc:103025271])

HSP 1 Score: 140.198 bits (352), Expect = 1.377e-43
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FTLNKEDHTLGN+I  QLLK P+V FAGYK PHPLEH I+IRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:    2 NAPPAFESFLLFEGEKKITITKDTKVPNACLFTLNKEDHTLGNIIRSQLLKDPQVLFAGYKVPHPLEHKIVIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Cavefish
Match: polr1d (DNA-directed RNA polymerases I and III subunit RPAC2-like [Source:NCBI gene;Acc:103043816])

HSP 1 Score: 60.077 bits (144), Expect = 4.305e-12
Identity = 29/75 (38.67%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKE 359
            F L++EDHTLGN + Y ++K+P V F GY   HP E  I  R+QT       E  +  L DL     ++   F+E
Sbjct:   27 FVLHEEDHTLGNSLRYMVMKNPDVEFCGYSITHPSESKINFRIQTRGGLPATETLRKGLNDLTDASKHVLHTFEE 101          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Cavefish
Match: polr1d (DNA-directed RNA polymerases I and III subunit RPAC2-like [Source:NCBI gene;Acc:103043816])

HSP 1 Score: 59.3066 bits (142), Expect = 5.582e-12
Identity = 31/79 (39.24%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNI----EEQFKE 359
            F L++EDHTLGN + Y ++K+P V F GY   HP E  I  R+QT       E  +  L DL     ++    E Q KE
Sbjct:   27 FVLHEEDHTLGNSLRYMVMKNPDVEFCGYSITHPSESKINFRIQTRGGLPATETLRKGLNDLTDASKHVLHTFEAQVKE 105          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Sea Lamprey
Match: polr1d (RNA polymerase I and III subunit D [Source:NCBI gene;Acc:445412])

HSP 1 Score: 57.3806 bits (137), Expect = 6.628e-12
Identity = 33/95 (34.74%), Postives = 49/95 (51.58%), Query Frame = 3
Query:   78 EGEKKVHFEKESKVPN--TAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFK 356
            EG ++     +S V +     F LN EDHTLGN + Y ++K+P V F GY   HP E  I  R+Q T     ++ F+  L +L +   +I   F+
Sbjct:    6 EGRQRCLSAIQSDVDDDTCVTFVLNGEDHTLGNPLRYMVMKNPDVDFCGYSVTHPSEDKINFRIQ-TRGIPAVDTFRRGLCELTTVCEHILAAFE 99          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Yeast
Match: RPB11 (RNA polymerase II subunit B12.5; part of central core; similar to Rpc19p and bacterial alpha subunit [Source:SGD;Acc:S000005365])

HSP 1 Score: 95.9005 bits (237), Expect = 5.135e-27
Identity = 44/105 (41.90%), Postives = 65/105 (61.90%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFK 356
            N PD+FE+F+LGEGE K+  + ++K PN  V T  KEDHTLGN+I  +LL   KV FA YK  HP      +R+QTT    P +  K++   +I+++  ++  F+
Sbjct:    2 NAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFE 106          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Yeast
Match: RPC19 (RNA polymerase subunit AC19; common to RNA polymerases I and III [Source:SGD;Acc:S000005057])

HSP 1 Score: 72.0182 bits (175), Expect = 2.057e-17
Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  111 SKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            S+   +A F + +EDHTLGN + Y ++K+P V F GY  PHP E+ + IR+QT   TT ++  +  L DL+     +E +F E +K
Sbjct:   55 SEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIK 140          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Nematostella
Match: EDO37254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGE2])

HSP 1 Score: 130.183 bits (326), Expect = 3.971e-40
Identity = 61/109 (55.96%), Postives = 83/109 (76.15%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P+ FE F+L +G+KK+   K++KVPN A F +NKEDHTLGN++  QLLK P+V FAGYK  HPLEH  ++RVQTTS+ +P E F  ++TDLISE+S +EE+FK  ++
Sbjct:    2 NAPEPFEPFLLLDGDKKITITKDTKVPNAAHFVVNKEDHTLGNLLREQLLKDPQVIFAGYKVSHPLEHKFVLRVQTTSDYSPQEAFTHAITDLISEVSLLEERFKAAVR 110          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Nematostella
Match: EDO38993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBE9])

HSP 1 Score: 58.151 bits (139), Expect = 3.406e-12
Identity = 28/64 (43.75%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  135 FTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLIS 326
            F L+ EDHTLGN + Y ++K+P V+F GY  PHP E  I +R+Q T  T   +V +  L++L +
Sbjct:    7 FVLHDEDHTLGNSLRYIIMKNPDVKFCGYSIPHPSESKINLRIQ-THGTPASDVLRRGLSELTA 69          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Medaka
Match: polr2j (RNA polymerase II subunit J [Source:NCBI gene;Acc:101172727])

HSP 1 Score: 141.739 bits (356), Expect = 7.928e-44
Identity = 67/109 (61.47%), Postives = 85/109 (77.98%), Query Frame = 3
Query:   42 NLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            N P  FE F+L EGEKK+   K++KVPN  +FTLNKEDHTLGN+I  QLLK P+V FAGYK PHPLEH I+IRVQTT + +P E F +++TDLISE+S +EE+F+  +K
Sbjct:   26 NAPPAFESFLLFEGEKKISISKDTKVPNACLFTLNKEDHTLGNIIRAQLLKDPQVLFAGYKVPHPLEHKIVIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIK 134          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Medaka
Match: polr1d (DNA-directed RNA polymerases I and III subunit RPAC2 [Source:NCBI gene;Acc:101162457])

HSP 1 Score: 62.3882 bits (150), Expect = 3.976e-13
Identity = 32/87 (36.78%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   69 VLGEGEKKVHFE---KESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDL 320
            + G+GEKK   E    +    +   F ++ EDHTLGN + Y ++K+P V F GY   HP E  I  R+QT      +E  +  L+DL
Sbjct:    1 MAGDGEKKPKLEMVQADGAQEDCVTFVMHDEDHTLGNSLRYMIMKNPDVDFCGYTITHPSESKINFRIQTRGGVPAVEPLQKGLSDL 87          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Medaka
Match: polr1d (DNA-directed RNA polymerases I and III subunit RPAC2 [Source:NCBI gene;Acc:101162457])

HSP 1 Score: 61.6178 bits (148), Expect = 1.475e-12
Identity = 32/87 (36.78%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   69 VLGEGEKKVHFE---KESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDL 320
            + G+GEKK   E    +    +   F ++ EDHTLGN + Y ++K+P V F GY   HP E  I  R+QT      +E  +  L+DL
Sbjct:    1 MAGDGEKKPKLEMVQADGAQEDCVTFVMHDEDHTLGNSLRYMIMKNPDVDFCGYTITHPSESKINFRIQTRGGVPAVEPLQKGLSDL 87          
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Planmine SMEST
Match: SMESG000055029.1 (SMESG000055029.1)

HSP 1 Score: 228.794 bits (582), Expect = 7.499e-79
Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 3
Query:   36 MSNLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 368
            MSNLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK
Sbjct:    1 MSNLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQLLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEISNIEEQFKECLK 111          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR2J3.746e-4361.47RNA polymerase II subunit J [Source:HGNC Symbol;Ac... [more]
POLR2J37.447e-4262.04RNA polymerase II subunit J3 [Source:HGNC Symbol;A... [more]
POLR2J37.447e-4262.04RNA polymerase II subunit J3 [Source:HGNC Symbol;A... [more]
POLR2J37.447e-4262.04RNA polymerase II subunit J3 [Source:HGNC Symbol;A... [more]
POLR2J37.447e-4262.04RNA polymerase II subunit J3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpb-113.108e-3955.05Probable DNA-directed RNA polymerase II subunit RP... [more]
rpb-113.108e-3955.05Probable DNA-directed RNA polymerase II subunit RP... [more]
rpac-194.093e-1135.80Probable DNA-directed RNA polymerases I and III su... [more]
rpac-194.093e-1135.80Probable DNA-directed RNA polymerases I and III su... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpb117.885e-4258.72gene:FBgn0032634 transcript:FBtr0081011[more]
l(2)37Cg2.855e-836.99gene:FBgn0086447 transcript:FBtr0081161[more]
l(2)37Cg3.561e-836.99gene:FBgn0086447 transcript:FBtr0332577[more]
l(2)37Cg4.785e-836.99gene:FBgn0086447 transcript:FBtr0336628[more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polr2j2.545e-4360.55polymerase (RNA) II (DNA directed) polypeptide J [... [more]
polr1d9.672e-1135.90RNA polymerase I and III subunit D [Source:NCBI ge... [more]
AL844570.11.655e-1036.00pep chromosome:GRCz11:CHR_ALT_CTG14_1_3:9079125:90... [more]
AL844570.13.890e-1036.49pep chromosome:GRCz11:CHR_ALT_CTG14_1_3:9082721:90... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem2311.009e-4361.47transmembrane protein 231 [Source:Xenbase;Acc:XB-G... [more]
tmem2318.986e-4360.55transmembrane protein 231 [Source:Xenbase;Acc:XB-G... [more]
tmem2313.231e-4261.90transmembrane protein 231 [Source:Xenbase;Acc:XB-G... [more]
tial15.435e-1434.00TIA1 cytotoxic granule-associated RNA binding prot... [more]
tial11.259e-1331.91TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Polr2j2.572e-4361.47polymerase (RNA) II (DNA directed) polypeptide J [... [more]
Polr2j1.093e-4262.86polymerase (RNA) II (DNA directed) polypeptide J [... [more]
Polr2j1.582e-2345.87polymerase (RNA) II (DNA directed) polypeptide J [... [more]
Polr1d1.376e-1333.33polymerase (RNA) I polypeptide D [Source:MGI Symbo... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08740|RPB11_MOUSE1.446e-4261.47DNA-directed RNA polymerase II subunit RPB11 OS=Mu... [more]
sp|P52435|RPB11_HUMAN1.799e-4261.47DNA-directed RNA polymerase II subunit RPB11-a OS=... [more]
sp|Q32P79|RPB11_BOVIN1.799e-4261.47DNA-directed RNA polymerase II subunit RPB11 OS=Bo... [more]
sp|Q7PVQ9|RPB11_ANOGA1.768e-4160.55DNA-directed RNA polymerase II subunit RPB11 OS=An... [more]
sp|Q9H1A7|RPB1C_HUMAN2.439e-4162.04DNA-directed RNA polymerase II subunit RPB11-b2 OS... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SKE02.177e-4767.89RNA_pol_L_2 domain-containing protein OS=Hymenolep... [more]
A0A504YB912.250e-4766.06DNA-directed RNA polymerase II subunit J OS=Fascio... [more]
A0A4E0S2R92.250e-4766.06DNA-directed RNA polymerase II subunit J OS=Fascio... [more]
A0A0R3TL644.246e-4767.89RNA_pol_L_2 domain-containing protein OS=Rodentole... [more]
V4C8A97.304e-4666.06RNA_pol_L_2 domain-containing protein OS=Lottia gi... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
polr2j1.377e-4361.47RNA polymerase II subunit J [Source:NCBI gene;Acc:... [more]
polr1d4.305e-1238.67DNA-directed RNA polymerases I and III subunit RPA... [more]
polr1d5.582e-1239.24DNA-directed RNA polymerases I and III subunit RPA... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polr1d6.628e-1234.74RNA polymerase I and III subunit D [Source:NCBI ge... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPB115.135e-2741.90RNA polymerase II subunit B12.5; part of central c... [more]
RPC192.057e-1739.53RNA polymerase subunit AC19; common to RNA polymer... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO372543.971e-4055.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389933.406e-1243.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
polr2j7.928e-4461.47RNA polymerase II subunit J [Source:NCBI gene;Acc:... [more]
polr1d3.976e-1336.78DNA-directed RNA polymerases I and III subunit RPA... [more]
polr1d1.475e-1236.78DNA-directed RNA polymerases I and III subunit RPA... [more]
back to top
BLAST of DNA-directed RNA polymerase II subunit RPB11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000055029.17.499e-79100.00SMESG000055029.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011622 ID=SMED30011622|Name=DNA-directed RNA polymerase II subunit RPB11|organism=Schmidtea mediterranea sexual|type=transcript|length=436bp
GTTTAAATATTTATATTTTTAAATATATTTGAAAAATGTCCAATTTACCA
GACAAATTTGAAATTTTTGTTCTTGGAGAGGGAGAAAAAAAAGTTCATTT
TGAGAAAGAGTCCAAAGTTCCAAATACTGCAGTATTTACTTTAAATAAAG
AAGATCATACTTTGGGAAATATGATTACCTATCAATTGTTGAAGCATCCA
AAAGTCAGATTTGCTGGATATAAAAATCCTCATCCACTCGAACACTGCAT
TATTATTAGAGTACAAACCACATCAAATACTACACCAATGGAAGTATTTA
AAGATTCATTGACCGATTTAATTAGTGAAATATCAAATATTGAGGAACAA
TTCAAAGAATGCTTGAAATAAATTACAAATAAATTTAATTATTTTGTATT
TTATCAATTGTTTTCTTATTTAAAGTTATTAATCTG
back to top

protein sequence of SMED30011622-orf-1

>SMED30011622-orf-1 ID=SMED30011622-orf-1|Name=SMED30011622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MSNLPDKFEIFVLGEGEKKVHFEKESKVPNTAVFTLNKEDHTLGNMITYQ
LLKHPKVRFAGYKNPHPLEHCIIIRVQTTSNTTPMEVFKDSLTDLISEIS
NIEEQFKECLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001055RNA polymerase II activity
GO:0003677DNA binding
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005665DNA-directed RNA polymerase II, core complex
Vocabulary: biological process
TermDefinition
GO:0006366transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036603RBP11-like
IPR037685RBP11
IPR008193RNA_pol_Rpb11_13-16kDa_CS
IPR009025RBP11-like_dimer
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..105
NoneNo IPR availablePANTHERPTHR13946DNA-DIRECTED RNA POLYMERASE I,II,IIIcoord: 3..108
IPR009025DNA-directed RNA polymerase, RBP11-like dimerisation domainPFAMPF13656RNA_pol_L_2coord: 32..105
e-value: 2.1E-27
score: 94.7
IPR036603RNA polymerase, RBP11-like subunitGENE3DG3DSA:3.30.1360.10coord: 2..111
e-value: 1.5E-44
score: 152.2
IPR036603RNA polymerase, RBP11-like subunitSUPERFAMILYSSF55257RBP11-like subunits of RNA polymerasecoord: 3..110
IPR008193DNA-directed RNA polymerase Rpb11, 13-16kDa subunit, conserved sitePROSITEPS01154RNA_POL_L_13KDcoord: 36..67
IPR037685RNA polymerase RBP11CDDcd06926RNAP_II_RPB11coord: 14..106
e-value: 2.13396E-48
score: 147.354