Long-chain-fatty-acid--CoA ligase

Overview
NameLong-chain-fatty-acid--CoA ligase
Smed IDSMED30011604
Length (bp)2395
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain-fatty-acid--CoA ligase (SMED30011604) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase (SMED30011604) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain-fatty-acid--CoA ligase (SMED30011604) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase (SMED30011604) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011604

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011604SMESG000081754.1 dd_Smed_v4_2153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30011604SMESG000081754.1 dd_Smed_v4_2153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011604SMESG000081754.1 dd_Smed_v4_2153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011604SMESG000081754.1 dd_Smed_v4_2153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30011604SMESG000081754.1 dd_Smed_v6_2153_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011604SMESG000081754.1 dd_Smed_v6_2153_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011604SMESG000081754.1 dd_Smed_v4_2153_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL3 (acyl-CoA synthetase long chain family member 3 [Source:HGNC Symbol;Acc:HGNC:3570])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 465/722 (64.40%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY F + + E    + A P+ ++   S +R+V +LD LA+   PGC+TL  ++  A   + +   LGTREV++ + E QPNG+ FKK+ LG+Y W ++++   R  N    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVH +NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  + + T++ +E +GA++  E      +KP    +AVIMYTSGSTGLPKGV I+  NI+A + GM + +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD S+L+PTLM  VP I++RI K V +KV++   F   LF  AY+YK +++ +G  +   D  VFR+++ LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG +V +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S  S+ I F+ P QK+L +LA K G+  +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P+PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPV-NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKP-KTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGIIVHTMAAVEALGAKASME--NQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGT---WEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL3 (acyl-CoA synthetase long chain family member 3 [Source:HGNC Symbol;Acc:HGNC:3570])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 465/722 (64.40%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY F + + E    + A P+ ++   S +R+V +LD LA+   PGC+TL  ++  A   + +   LGTREV++ + E QPNG+ FKK+ LG+Y W ++++   R  N    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVH +NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  + + T++ +E +GA++  E      +KP    +AVIMYTSGSTGLPKGV I+  NI+A + GM + +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD S+L+PTLM  VP I++RI K V +KV++   F   LF  AY+YK +++ +G  +   D  VFR+++ LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG +V +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S  S+ I F+ P QK+L +LA K G+  +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P+PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPV-NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKP-KTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGIIVHTMAAVEALGAKASME--NQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGT---WEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL4 (acyl-CoA synthetase long chain family member 4 [Source:HGNC Symbol;Acc:HGNC:3571])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 326/722 (45.15%), Postives = 458/722 (63.43%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG+EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 K++ P    + ++  +E++G  S  E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + ++F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ +  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E++  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAIN--------------KAEYPEGFEIHSMQSVEELG--SNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL4 (acyl-CoA synthetase long chain family member 4 [Source:HGNC Symbol;Acc:HGNC:3571])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 326/722 (45.15%), Postives = 458/722 (63.43%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG+EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 K++ P    + ++  +E++G  S  E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + ++F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ +  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E++  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAIN--------------KAEYPEGFEIHSMQSVEELG--SNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL4 (acyl-CoA synthetase long chain family member 4 [Source:HGNC Symbol;Acc:HGNC:3571])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 326/722 (45.15%), Postives = 458/722 (63.43%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG+EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 K++ P    + ++  +E++G  S  E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + ++F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ +  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E++  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAIN--------------KAEYPEGFEIHSMQSVEELG--SNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-17 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18660])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 319/720 (44.31%), Postives = 456/720 (63.33%), Query Frame = 1
Query:   85 ILKLWVLIYEFITF-PFYIFF--KDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITS-CPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNV---EEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +LK+   IY+ +TF PF IF    +K E    V A P  + D ++PW+NV A D L  +   G + L + WE     + +   +GTREV+    E Q NG+ F+K  +G Y+W ++ + D+R+N +A  + +LG    K+ +++++ET+ EWM  A A  K N  I T+YATLG+EA+   INE  A  I+TS  L+ K+   +++    I+ I+F D        +++       +   LP   TL++  +L   G          +  +  KD LA IMYTSG+TG PKGV I+  NIVA  AG       FN+    ++ YI YLPLAH++E+  E+++ T G+++GYSS  TL D + KI     GD  VL+PTLM CVP +++RI KAV D+V      F +LFK  Y+ KR R   GY S  ++++VF RI KLLGG+V+ +LSGGAPLS E Q F+NICF CP+VQGYGLTETC GG+I +++DL TG  GPP+T  +I L++WAE GYSP++ P P+GE+LI G NVALGY+K  EKT+E F +  +G  +F TGDIG   +DG L I+DRKKDL+KL  GEY+SLGKVE  +  +P V++VCVY DS++SF +  + P QK L QLA K G   S+++ E LC+DKK+++A+ K+++Q     K++R EIPQK+F+  +PWTP SGL+T+ALKLKR+ I+  F+  +D  Y
Sbjct:   26 LLKIVFFIYDVVTFIPFKIFADPAEKLEKSERVKAEP-DNGDPTTPWKNVSAKDGLMNSSFEGIHDLGTQWEECVRRYGNQPCMGTREVLKVHKEKQSNGKIFEKWQMGDYHWRSYAQVDKRVNMIASGLTSLGQ-QEKEPIILFAETREEWMTTALACMKMNFPIATMYATLGDEAVQFAINEVGAKTIFTSEALISKVKKAMSNGATSIENIIFFD--------SVDPASRGESVDVDLP--FTLLSFDQLLSRGEPYP------VPTRSKKDDLAFIMYTSGTTGNPKGVMISHQNIVAVTAGQA-----FNIVLGPDDRYIGYLPLAHILEVCAEMVVFTKGVRIGYSSAQTLFDRAPKIMKGEHGDCWVLQPTLMACVPAVMDRIFKAVIDEVNANSELFKQLFKTCYERKRSRYEEGYTSFILNKLVFNRIGKLLGGKVRQILSGGAPLSPETQRFMNICFCCPVVQGYGLTETCGGGTIADIHDLSTGTVGPPLTCCEILLQEWAEAGYSPKNDP-PQGEILISGPNVALGYFKNDEKTKEEFVK-VNGKTFFATGDIGEFREDGSLKIIDRKKDLLKLAHGEYISLGKVETNLLTNPNVDNVCVYGDSNKSFLVALVVPNQKNLTQLASKAG--ASNDNFEKLCEDKKVVEALQKELAQYG-ASKLQRVEIPQKIFICHEPWTPASGLLTEALKLKRKNIEKAFRKELDELY 717          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-17 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18660])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 319/720 (44.31%), Postives = 456/720 (63.33%), Query Frame = 1
Query:   85 ILKLWVLIYEFITF-PFYIFF--KDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITS-CPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNV---EEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +LK+   IY+ +TF PF IF    +K E    V A P  + D ++PW+NV A D L  +   G + L + WE     + +   +GTREV+    E Q NG+ F+K  +G Y+W ++ + D+R+N +A  + +LG    K+ +++++ET+ EWM  A A  K N  I T+YATLG+EA+   INE  A  I+TS  L+ K+   +++    I+ I+F D        +++       +   LP   TL++  +L   G          +  +  KD LA IMYTSG+TG PKGV I+  NIVA  AG       FN+    ++ YI YLPLAH++E+  E+++ T G+++GYSS  TL D + KI     GD  VL+PTLM CVP +++RI KAV D+V      F +LFK  Y+ KR R   GY S  ++++VF RI KLLGG+V+ +LSGGAPLS E Q F+NICF CP+VQGYGLTETC GG+I +++DL TG  GPP+T  +I L++WAE GYSP++ P P+GE+LI G NVALGY+K  EKT+E F +  +G  +F TGDIG   +DG L I+DRKKDL+KL  GEY+SLGKVE  +  +P V++VCVY DS++SF +  + P QK L QLA K G   S+++ E LC+DKK+++A+ K+++Q     K++R EIPQK+F+  +PWTP SGL+T+ALKLKR+ I+  F+  +D  Y
Sbjct:   26 LLKIVFFIYDVVTFIPFKIFADPAEKLEKSERVKAEP-DNGDPTTPWKNVSAKDGLMNSSFEGIHDLGTQWEECVRRYGNQPCMGTREVLKVHKEKQSNGKIFEKWQMGDYHWRSYAQVDKRVNMIASGLTSLGQ-QEKEPIILFAETREEWMTTALACMKMNFPIATMYATLGDEAVQFAINEVGAKTIFTSEALISKVKKAMSNGATSIENIIFFD--------SVDPASRGESVDVDLP--FTLLSFDQLLSRGEPYP------VPTRSKKDDLAFIMYTSGTTGNPKGVMISHQNIVAVTAGQA-----FNIVLGPDDRYIGYLPLAHILEVCAEMVVFTKGVRIGYSSAQTLFDRAPKIMKGEHGDCWVLQPTLMACVPAVMDRIFKAVIDEVNANSELFKQLFKTCYERKRSRYEEGYTSFILNKLVFNRIGKLLGGKVRQILSGGAPLSPETQRFMNICFCCPVVQGYGLTETCGGGTIADIHDLSTGTVGPPLTCCEILLQEWAEAGYSPKNDP-PQGEILISGPNVALGYFKNDEKTKEEFVK-VNGKTFFATGDIGEFREDGSLKIIDRKKDLLKLAHGEYISLGKVETNLLTNPNVDNVCVYGDSNKSFLVALVVPNQKNLTQLASKAG--ASNDNFEKLCEDKKVVEALQKELAQYG-ASKLQRVEIPQKIFICHEPWTPASGLLTEALKLKRKNIEKAFRKELDELY 717          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-17 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18660])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 319/720 (44.31%), Postives = 456/720 (63.33%), Query Frame = 1
Query:   85 ILKLWVLIYEFITF-PFYIFF--KDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITS-CPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNV---EEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +LK+   IY+ +TF PF IF    +K E    V A P  + D ++PW+NV A D L  +   G + L + WE     + +   +GTREV+    E Q NG+ F+K  +G Y+W ++ + D+R+N +A  + +LG    K+ +++++ET+ EWM  A A  K N  I T+YATLG+EA+   INE  A  I+TS  L+ K+   +++    I+ I+F D        +++       +   LP   TL++  +L   G          +  +  KD LA IMYTSG+TG PKGV I+  NIVA  AG       FN+    ++ YI YLPLAH++E+  E+++ T G+++GYSS  TL D + KI     GD  VL+PTLM CVP +++RI KAV D+V      F +LFK  Y+ KR R   GY S  ++++VF RI KLLGG+V+ +LSGGAPLS E Q F+NICF CP+VQGYGLTETC GG+I +++DL TG  GPP+T  +I L++WAE GYSP++ P P+GE+LI G NVALGY+K  EKT+E F +  +G  +F TGDIG   +DG L I+DRKKDL+KL  GEY+SLGKVE  +  +P V++VCVY DS++SF +  + P QK L QLA K G   S+++ E LC+DKK+++A+ K+++Q     K++R EIPQK+F+  +PWTP SGL+T+ALKLKR+ I+  F+  +D  Y
Sbjct:   26 LLKIVFFIYDVVTFIPFKIFADPAEKLEKSERVKAEP-DNGDPTTPWKNVSAKDGLMNSSFEGIHDLGTQWEECVRRYGNQPCMGTREVLKVHKEKQSNGKIFEKWQMGDYHWRSYAQVDKRVNMIASGLTSLGQ-QEKEPIILFAETREEWMTTALACMKMNFPIATMYATLGDEAVQFAINEVGAKTIFTSEALISKVKKAMSNGATSIENIIFFD--------SVDPASRGESVDVDLP--FTLLSFDQLLSRGEPYP------VPTRSKKDDLAFIMYTSGTTGNPKGVMISHQNIVAVTAGQA-----FNIVLGPDDRYIGYLPLAHILEVCAEMVVFTKGVRIGYSSAQTLFDRAPKIMKGEHGDCWVLQPTLMACVPAVMDRIFKAVIDEVNANSELFKQLFKTCYERKRSRYEEGYTSFILNKLVFNRIGKLLGGKVRQILSGGAPLSPETQRFMNICFCCPVVQGYGLTETCGGGTIADIHDLSTGTVGPPLTCCEILLQEWAEAGYSPKNDP-PQGEILISGPNVALGYFKNDEKTKEEFVK-VNGKTFFATGDIGEFREDGSLKIIDRKKDLLKLAHGEYISLGKVETNLLTNPNVDNVCVYGDSNKSFLVALVVPNQKNLTQLASKAG--ASNDNFEKLCEDKKVVEALQKELAQYG-ASKLQRVEIPQKIFICHEPWTPASGLLTEALKLKRKNIEKAFRKELDELY 717          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-4 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q20121])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 316/727 (43.47%), Postives = 454/727 (62.45%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDN---DLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVF---MDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREK 2232
            + + IL++W  IY+ + +  Y  F   S  E +  +  +K N   D   P RN++     A+   PG +T+  +W +   L+ ++  LGTR++I    + QP GR F+K  LG+Y W+++KE + ++  +A  + +L       KVVI++ET+A+W+I A A F++N+ I T+YATLGE+AI H I E+EA+++ TS ELLPKI ++   CP +KT+++   +DQK      A   ++ KH           +++LS L     E   E      +   K  +A+IMYTSG+TG PKGV +   N+VA++ G  D +       + YI YLPLAH++EL  EL  +T G K+GYSSPLTL D +SKI+  T GD   LRPTLM  VP I++RI KAV ++V     F  ELFK  Y+ KR R   GY S F+DRIVF++I++LLGG+++ +LSGGAPL+ E Q F+NIC  CP+VQGYGLTETC    + ++ DL TG  GPP+    I LR+W+EGGYSP + P P+GE+LI G N++ GYYKQPEKT E F     G  +F TGDIG    DG L I+DRKKDLVKLQ GEYVSL KVE A+   P+V+++CVY    E   +  + P QK L ++AE  G+  S+++++ +C+DKK+I A  K + +   + K+ R EIP  + L P+ WTPD+GL+T+ALKLKR+ I+  +Q  +D  Y + K
Sbjct:   30 VAMAILRVWFFIYDCLNYLPYQLFN--SPTEKLRKSERVKANWVDDRDGPIRNIQGH---ASETFPGKDTVDKVWRKCVELYDESPCLGTRQLIEVHEDKQPGGRVFEKWHLGEYVWQSYKEVETQVARLAAGIKDLAHEEQNPKVVIFAETRADWLITALACFRANVTIVTVYATLGEDAIAHAIGETEATILVTSSELLPKIVTLGKKCPTLKTLIYFAPVDQKAPAPELAPFRDQFKH-----------VLSLSGLLTRNQEQVKE------STAVKSDIALIMYTSGTTGQPKGVILLHQNVVAALLGQGDGV-GIICNADTYIGYLPLAHILELDAELTCLTKGAKVGYSSPLTLHDRASKIQKGTHGDCHALRPTLMAAVPAIMDRIFKAVSEEVAASPRFMQELFKLNYERKRSRYLEGYCSPFLDRIVFKKIRRLLGGKLRGVLSGGAPLNAETQRFMNICMCCPVVQGYGLTETCGAACVADINDLSTGTVGPPVRCSDIALREWSEGGYSPFNDP-PQGEILISGENISPGYYKQPEKTAEDFI-TYKGKVYFATGDIGQKRDDGSLLIIDRKKDLVKLQHGEYVSLAKVECALLNCPIVDNICVYGSGMEDSVVALVVPNQKHLEKIAEAEGV--STSEMKTMCEDKKVIAAYKKQLEEHAKKSKLSRSEIPAAIHLCPEIWTPDTGLLTEALKLKRKPIQMAYQKTLDDLYKQLK 729          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-5 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q9XWD1])

HSP 1 Score: 268.47 bits (685), Expect = 6.367e-79
Identity = 195/621 (31.40%), Postives = 315/621 (50.72%), Query Frame = 1
Query:  406 YYWETFKETDERINNVAKAMIN-LGLVPTKD-KVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITS---CPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVL----PKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRK----RLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNR 2226
            Y + T+ +  E+  N++  +++  GL P     + IY+    +W++ A A  + ++++  LY TLG EA    I+++E S++    +   K  S+I +    P +K I+ +D            +ELK    + +   + + +L+   ++G  S+     NL   P  D   +I YTSG+TG PKGV +T  NIVA+++G   +L    P      +++ISYLPL+H+ME +    L+  G K+GY                   DI  L+PT+   VP +L R+  A+  KV  QG  F+    + + + RK    + G+       DR+VF +I++ +GG+V  M++G AP+S        +     IV+GYG TE  A  +   M D  TGH G P     +KL D  +  Y  +D    +GE+ I G  V  GYYK PE+T E F  DE G  +  TGDIG +  +G + I+DRKK + KL  GEYV+  K+E    ++PVV+ V V  DS E + I  + P+   L +  +K G    S  +E +C D+K  + V  ++  I    K+   E  +KV L    +T ++GL+T  LK KR +++ K++D + + Y +
Sbjct:  102 YEFLTYDDVHEQAKNLSMTLVHEFGLTPANTTNIGIYARNSPQWLVSAVACVEQSMVVVPLYDTLGAEAATFIISQAEISVVIV--DSFKKAESLIKNRENMPTLKNIIVIDSA----------DELKDG--TAIIDTIRVESLTNALNLG--SRYPFTNNL---PKPDDNYIICYTSGTTGTPKGVMLTHSNIVANISGFLKILFAFQPSMIDATQVHISYLPLSHMMEQLTHWTLLGFGSKIGY---------FRGSIQGLTDDIKTLKPTVFPVVPRLLNRLYDAITSKVQQQG--FMAKLVYNFAFARKLSLVKAGKVGRDTIWDRLVFNKIQQQIGGKVDLMVTGSAPISSTVLETCRVTLGTTIVEGYGQTECTALATFTWMGDPSTGHCGAPAPCALVKLGDVPDLNYFAKDG---KGEIRIKGPCVTKGYYKDPERTAELF--DEEG--FLQTGDIGEMLPNGTIRIIDRKKHIFKLAQGEYVAPEKIEQVYIRTPVVQQVYVDGDSLERWLIAVVVPEPDVLKEWNDKQG--SGSRKIEEICNDEKAKEFVLSELHAIGKANKLNSIEQVKKVILTSDTFTVENGLLTPTLKAKRPQLRLKYKDGMAKVYKQ 683          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0088701)

HSP 1 Score: 521.931 bits (1343), Expect = 1.900e-175
Identity = 298/719 (41.45%), Postives = 439/719 (61.06%), Query Frame = 1
Query:   79 LNILKLWVLIYEFITFPFYIFFKD---KSENEIVVSAVPIKDNDLSSPWRNVKA-LDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  +K    +Y+ IT P Y+  +    + ++   V A  ++++D    +R      D          +TL  ++      +     LGTR+++S + E Q NGR FKK  LG Y W+TF E +    N  + +  LG  P ++ +VI++ET+AEWMI A   FK  + I T+YATLG++ + H I E+E + + TSH+LLPK  +++  CPL+KTI++++ ++ K     E    K  +K  LP N  + T       G +SK E +      P  D +A+IMYTSGSTG PKGV ++  N +A+M G  D++P +   +++ I +LPLAHV ELV E + +  G+ +GYS+PLTL DTSSKIK   KGD +VL+PT M  VP IL+RI+K + DKV     F   LFK+ Y YK K + RGY +  +D++VF+++ KL+GG+V+ ++SGGAPLS +    +  C C  ++QGYGLTET +G ++M+  D+  G  G P+T   I+L +W EG Y   +KPYP+GEVLIGG  V+ GYYK P KT E FFE E G RWF TGDIG I  DG L I+DRKKDLVKLQ GEYVSLGKVE  +    ++E++CVY D ++ +++  + P Q  L +LA+K G+       E LC    I  A+ K+I++   + K++++E+P  + L  + W+PD GLVT A KLKR++I+ ++Q  I+R Y
Sbjct:   10 IGAIKAIAFVYDIITLPVYLVLQKPWKRRQDSRRVKAKIVRNDDNELTYRTTDPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWKTFTEAERTAANFGRGLRELGQKP-RENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQK----TETTGFKEGVKI-LPFNQVVKT-------GQDSKFEHVP-----PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVPIY--PDDVLIGFLPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGL--GDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 705          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0100428)

HSP 1 Score: 521.931 bits (1343), Expect = 1.900e-175
Identity = 298/719 (41.45%), Postives = 439/719 (61.06%), Query Frame = 1
Query:   79 LNILKLWVLIYEFITFPFYIFFKD---KSENEIVVSAVPIKDNDLSSPWRNVKA-LDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  +K    +Y+ IT P Y+  +    + ++   V A  ++++D    +R      D          +TL  ++      +     LGTR+++S + E Q NGR FKK  LG Y W+TF E +    N  + +  LG  P ++ +VI++ET+AEWMI A   FK  + I T+YATLG++ + H I E+E + + TSH+LLPK  +++  CPL+KTI++++ ++ K     E    K  +K  LP N  + T       G +SK E +      P  D +A+IMYTSGSTG PKGV ++  N +A+M G  D++P +   +++ I +LPLAHV ELV E + +  G+ +GYS+PLTL DTSSKIK   KGD +VL+PT M  VP IL+RI+K + DKV     F   LFK+ Y YK K + RGY +  +D++VF+++ KL+GG+V+ ++SGGAPLS +    +  C C  ++QGYGLTET +G ++M+  D+  G  G P+T   I+L +W EG Y   +KPYP+GEVLIGG  V+ GYYK P KT E FFE E G RWF TGDIG I  DG L I+DRKKDLVKLQ GEYVSLGKVE  +    ++E++CVY D ++ +++  + P Q  L +LA+K G+       E LC    I  A+ K+I++   + K++++E+P  + L  + W+PD GLVT A KLKR++I+ ++Q  I+R Y
Sbjct:   10 IGAIKAIAFVYDIITLPVYLVLQKPWKRRQDSRRVKAKIVRNDDNELTYRTTDPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWKTFTEAERTAANFGRGLRELGQKP-RENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQK----TETTGFKEGVKI-LPFNQVVKT-------GQDSKFEHVP-----PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVPIY--PDDVLIGFLPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGL--GDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 705          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0100431)

HSP 1 Score: 521.931 bits (1343), Expect = 1.900e-175
Identity = 298/719 (41.45%), Postives = 439/719 (61.06%), Query Frame = 1
Query:   79 LNILKLWVLIYEFITFPFYIFFKD---KSENEIVVSAVPIKDNDLSSPWRNVKA-LDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  +K    +Y+ IT P Y+  +    + ++   V A  ++++D    +R      D          +TL  ++      +     LGTR+++S + E Q NGR FKK  LG Y W+TF E +    N  + +  LG  P ++ +VI++ET+AEWMI A   FK  + I T+YATLG++ + H I E+E + + TSH+LLPK  +++  CPL+KTI++++ ++ K     E    K  +K  LP N  + T       G +SK E +      P  D +A+IMYTSGSTG PKGV ++  N +A+M G  D++P +   +++ I +LPLAHV ELV E + +  G+ +GYS+PLTL DTSSKIK   KGD +VL+PT M  VP IL+RI+K + DKV     F   LFK+ Y YK K + RGY +  +D++VF+++ KL+GG+V+ ++SGGAPLS +    +  C C  ++QGYGLTET +G ++M+  D+  G  G P+T   I+L +W EG Y   +KPYP+GEVLIGG  V+ GYYK P KT E FFE E G RWF TGDIG I  DG L I+DRKKDLVKLQ GEYVSLGKVE  +    ++E++CVY D ++ +++  + P Q  L +LA+K G+       E LC    I  A+ K+I++   + K++++E+P  + L  + W+PD GLVT A KLKR++I+ ++Q  I+R Y
Sbjct:   10 IGAIKAIAFVYDIITLPVYLVLQKPWKRRQDSRRVKAKIVRNDDNELTYRTTDPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWKTFTEAERTAANFGRGLRELGQKP-RENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQK----TETTGFKEGVKI-LPFNQVVKT-------GQDSKFEHVP-----PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVPIY--PDDVLIGFLPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGL--GDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 705          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0100429)

HSP 1 Score: 521.931 bits (1343), Expect = 1.900e-175
Identity = 298/719 (41.45%), Postives = 439/719 (61.06%), Query Frame = 1
Query:   79 LNILKLWVLIYEFITFPFYIFFKD---KSENEIVVSAVPIKDNDLSSPWRNVKA-LDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  +K    +Y+ IT P Y+  +    + ++   V A  ++++D    +R      D          +TL  ++      +     LGTR+++S + E Q NGR FKK  LG Y W+TF E +    N  + +  LG  P ++ +VI++ET+AEWMI A   FK  + I T+YATLG++ + H I E+E + + TSH+LLPK  +++  CPL+KTI++++ ++ K     E    K  +K  LP N  + T       G +SK E +      P  D +A+IMYTSGSTG PKGV ++  N +A+M G  D++P +   +++ I +LPLAHV ELV E + +  G+ +GYS+PLTL DTSSKIK   KGD +VL+PT M  VP IL+RI+K + DKV     F   LFK+ Y YK K + RGY +  +D++VF+++ KL+GG+V+ ++SGGAPLS +    +  C C  ++QGYGLTET +G ++M+  D+  G  G P+T   I+L +W EG Y   +KPYP+GEVLIGG  V+ GYYK P KT E FFE E G RWF TGDIG I  DG L I+DRKKDLVKLQ GEYVSLGKVE  +    ++E++CVY D ++ +++  + P Q  L +LA+K G+       E LC    I  A+ K+I++   + K++++E+P  + L  + W+PD GLVT A KLKR++I+ ++Q  I+R Y
Sbjct:   10 IGAIKAIAFVYDIITLPVYLVLQKPWKRRQDSRRVKAKIVRNDDNELTYRTTDPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWKTFTEAERTAANFGRGLRELGQKP-RENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQK----TETTGFKEGVKI-LPFNQVVKT-------GQDSKFEHVP-----PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVPIY--PDDVLIGFLPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGL--GDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 705          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0088700)

HSP 1 Score: 521.931 bits (1343), Expect = 2.779e-175
Identity = 298/719 (41.45%), Postives = 439/719 (61.06%), Query Frame = 1
Query:   79 LNILKLWVLIYEFITFPFYIFFKD---KSENEIVVSAVPIKDNDLSSPWRNVKA-LDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  +K    +Y+ IT P Y+  +    + ++   V A  ++++D    +R      D          +TL  ++      +     LGTR+++S + E Q NGR FKK  LG Y W+TF E +    N  + +  LG  P ++ +VI++ET+AEWMI A   FK  + I T+YATLG++ + H I E+E + + TSH+LLPK  +++  CPL+KTI++++ ++ K     E    K  +K  LP N  + T       G +SK E +      P  D +A+IMYTSGSTG PKGV ++  N +A+M G  D++P +   +++ I +LPLAHV ELV E + +  G+ +GYS+PLTL DTSSKIK   KGD +VL+PT M  VP IL+RI+K + DKV     F   LFK+ Y YK K + RGY +  +D++VF+++ KL+GG+V+ ++SGGAPLS +    +  C C  ++QGYGLTET +G ++M+  D+  G  G P+T   I+L +W EG Y   +KPYP+GEVLIGG  V+ GYYK P KT E FFE E G RWF TGDIG I  DG L I+DRKKDLVKLQ GEYVSLGKVE  +    ++E++CVY D ++ +++  + P Q  L +LA+K G+       E LC    I  A+ K+I++   + K++++E+P  + L  + W+PD GLVT A KLKR++I+ ++Q  I+R Y
Sbjct:   18 IGAIKAIAFVYDIITLPVYLVLQKPWKRRQDSRRVKAKIVRNDDNELTYRTTDPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWKTFTEAERTAANFGRGLRELGQKP-RENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQK----TETTGFKEGVKI-LPFNQVVKT-------GQDSKFEHVP-----PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVPIY--PDDVLIGFLPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGL--GDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 713          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 326/720 (45.28%), Postives = 452/720 (62.78%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIK--DNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + L + +  V +Y  ITF  +      S N+     V  +  + + + P+R V +  KLA+    G +TL  ++E A + +P+ D LGTRE++S + E QPNG+ FKK+ LG Y W ++++T          +  LG  P  + + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E + I TS +LL  ++ +++   P +K I+ +D K                    LP  + +  ++ ++++G  SK E +     +P    +AVIMYTSGSTG+PKGV I+  NI+A + GM + +P  + E + YI YLPLAHV+EL  EL+ V+ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V  KV +       LF  AY+YK +++ +GY +   DR+VFR+++ LLGG  + +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  M D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NV +GYYK  +K  E FFED++G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +   P+++++C YA+S ES+ I F+ P QKQL  LA + GI  S    E +C   ++   V + I+   I  K+ERFEIP+K+ L  +PWTP++GLVTDA KLKR+E+K  +QD I+R Y
Sbjct:   10 LLLQVFRSVVWVYSVITFLPWYLLSGASGNQARAKRVKARAINGNPAGPYRAVNSQLKLASLLHEGVDTLDKVFEYAVVHFPERDCLGTRELLSEEDEIQPNGKVFKKVILGDYNWLSYQDTFHLAQRFGSGLAALGQKPLCN-IAIFCETRAEWVIAAQACFMYNFPLVTLYSTLGGSAIAHGLNETEVTHIVTSKDLLQSRLKAILLEVPRLKHIIVVDTKPTS--------------WPDLPRGIMVHNMAAVQELG--SKPENIMVSRRQPVPSDIAVIMYTSGSTGIPKGVMISHSNIIAGITGMAERIPNLD-ENDTYIGYLPLAHVLELSAELVCVSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMTKVEEMSSVQKTLFVLAYNYKMEQISKGYTTPLCDRLVFRKVRSLLGGNTRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISEMSDYSTGRVGAPLVCSEIMLKDWEEGGYFSTDKPNPRGEILIGGPNVTMGYYKNEQKNREDFFEDKNGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNICAYANSDESYVIGFVVPNQKQLTALAGQKGIRGS---WEEICNHAEMEKEVLRIITDAAISGKLERFEIPKKICLSAEPWTPETGLVTDAFKLKRKELKTHYQDDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 326/720 (45.28%), Postives = 452/720 (62.78%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIK--DNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + L + +  V +Y  ITF  +      S N+     V  +  + + + P+R V +  KLA+    G +TL  ++E A + +P+ D LGTRE++S + E QPNG+ FKK+ LG Y W ++++T          +  LG  P  + + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E + I TS +LL  ++ +++   P +K I+ +D K                    LP  + +  ++ ++++G  SK E +     +P    +AVIMYTSGSTG+PKGV I+  NI+A + GM + +P  + E + YI YLPLAHV+EL  EL+ V+ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V  KV +       LF  AY+YK +++ +GY +   DR+VFR+++ LLGG  + +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  M D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NV +GYYK  +K  E FFED++G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +   P+++++C YA+S ES+ I F+ P QKQL  LA + GI  S    E +C   ++   V + I+   I  K+ERFEIP+K+ L  +PWTP++GLVTDA KLKR+E+K  +QD I+R Y
Sbjct:   10 LLLQVFRSVVWVYSVITFLPWYLLSGASGNQARAKRVKARAINGNPAGPYRAVNSQLKLASLLHEGVDTLDKVFEYAVVHFPERDCLGTRELLSEEDEIQPNGKVFKKVILGDYNWLSYQDTFHLAQRFGSGLAALGQKPLCN-IAIFCETRAEWVIAAQACFMYNFPLVTLYSTLGGSAIAHGLNETEVTHIVTSKDLLQSRLKAILLEVPRLKHIIVVDTKPTS--------------WPDLPRGIMVHNMAAVQELG--SKPENIMVSRRQPVPSDIAVIMYTSGSTGIPKGVMISHSNIIAGITGMAERIPNLD-ENDTYIGYLPLAHVLELSAELVCVSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMTKVEEMSSVQKTLFVLAYNYKMEQISKGYTTPLCDRLVFRKVRSLLGGNTRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISEMSDYSTGRVGAPLVCSEIMLKDWEEGGYFSTDKPNPRGEILIGGPNVTMGYYKNEQKNREDFFEDKNGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNICAYANSDESYVIGFVVPNQKQLTALAGQKGIRGS---WEEICNHAEMEKEVLRIITDAAISGKLERFEIPKKICLSAEPWTPETGLVTDAFKLKRKELKTHYQDDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 326/720 (45.28%), Postives = 452/720 (62.78%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIK--DNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + L + +  V +Y  ITF  +      S N+     V  +  + + + P+R V +  KLA+    G +TL  ++E A + +P+ D LGTRE++S + E QPNG+ FKK+ LG Y W ++++T          +  LG  P  + + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E + I TS +LL  ++ +++   P +K I+ +D K                    LP  + +  ++ ++++G  SK E +     +P    +AVIMYTSGSTG+PKGV I+  NI+A + GM + +P  + E + YI YLPLAHV+EL  EL+ V+ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V  KV +       LF  AY+YK +++ +GY +   DR+VFR+++ LLGG  + +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  M D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NV +GYYK  +K  E FFED++G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +   P+++++C YA+S ES+ I F+ P QKQL  LA + GI  S    E +C   ++   V + I+   I  K+ERFEIP+K+ L  +PWTP++GLVTDA KLKR+E+K  +QD I+R Y
Sbjct:   10 LLLQVFRSVVWVYSVITFLPWYLLSGASGNQARAKRVKARAINGNPAGPYRAVNSQLKLASLLHEGVDTLDKVFEYAVVHFPERDCLGTRELLSEEDEIQPNGKVFKKVILGDYNWLSYQDTFHLAQRFGSGLAALGQKPLCN-IAIFCETRAEWVIAAQACFMYNFPLVTLYSTLGGSAIAHGLNETEVTHIVTSKDLLQSRLKAILLEVPRLKHIIVVDTKPTS--------------WPDLPRGIMVHNMAAVQELG--SKPENIMVSRRQPVPSDIAVIMYTSGSTGIPKGVMISHSNIIAGITGMAERIPNLD-ENDTYIGYLPLAHVLELSAELVCVSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMTKVEEMSSVQKTLFVLAYNYKMEQISKGYTTPLCDRLVFRKVRSLLGGNTRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISEMSDYSTGRVGAPLVCSEIMLKDWEEGGYFSTDKPNPRGEILIGGPNVTMGYYKNEQKNREDFFEDKNGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNICAYANSDESYVIGFVVPNQKQLTALAGQKGIRGS---WEEICNHAEMEKEVLRIITDAAISGKLERFEIPKKICLSAEPWTPETGLVTDAFKLKRKELKTHYQDDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl3a (acyl-CoA synthetase long chain family member 3a [Source:ZFIN;Acc:ZDB-GENE-050420-181])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 319/719 (44.37%), Postives = 463/719 (64.39%), Query Frame = 1
Query:   85 ILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIK----DNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            + +L V +Y  I++  Y+  +      +   +  +K      D + P+R+V AL  L     PG NTL  +++ +   +P++D LGTRE++S + ETQ +G+ FKK+ LG+Y W ++++  + +N     +  LG  P K+ + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E S I TS +LL  K+ S+    P +  ++ +D K+                 S+ P  +++ +++ ++++GA  + E      N P    +AVIMYTSGSTG+PKGV I+  NI++ + GM   +PK  VE++ YI YLPLAHV+EL  E++ +  G ++GYSSP TL+D S+KIK  ++GDISVLRPTLM  VP I++RI K V  +V     F   LF  AY+YK ++L  GY +   D++VFR+++ LLGGR++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I +++D  TG  G P+   +++L+DW EGGY   D P PRGE+L+GG ++ +GYYK   KT E FF D+ G RWFCTGDIG I  DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S ES+ I F+ P QKQL+ LAE+  +       E LC +  I +AV   +++  +  ++ERFEIP+K+ L  +PWTPD+GLVTD+ KLKR+E+K  +Q+ I+R Y 
Sbjct:   14 VFRLVVWLYSLISYLPYLLLRSPESQSLSECSRRLKARSVSGDPAGPYRDVAALKGLEMCLHPGINTLDQVFQSSVSHFPNSDCLGTRELLSEEDETQEDGKVFKKVILGEYRWMSYEQVFKEVNAFGSGLAALGQKPMKN-IAIFCETRAEWIIAAQACFMYNFPLVTLYSTLGGPAIAHGLNEAEVSHIITSKDLLETKLKSIFIEVPRLCHVIVVDDKL--------------STSSEYPRGISIHSMASVKELGA--RPENASKPKNPPCSSDVAVIMYTSGSTGVPKGVMISHSNIISGITGMTHRIPKL-VEDDTYIGYLPLAHVLELSAEMVCLAHGCRIGYSSPQTLSDQSTKIKKGSRGDISVLRPTLMAAVPEIMDRIYKNVMLRVEQMSGFQRTLFLLAYNYKMEQLAMGYSTPLCDKLVFRKVRALLGGRLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISHLWDYSTGRVGAPLVCCELQLKDWIEGGYHSTDLPCPRGEILVGGPSITMGYYKNTHKTSEDFFVDKKGQRWFCTGDIGEIHGDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLVDNICAYANSDESYVIGFVVPNQKQLLALAERKRV---RGLWEELCNNPVIEEAVLTVLTEAALTAQLERFEIPRKIRLSVEPWTPDTGLVTDSFKLKRKELKTHYQNDIERMYG 711          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl3a (acyl-CoA synthetase long chain family member 3a [Source:ZFIN;Acc:ZDB-GENE-050420-181])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 319/719 (44.37%), Postives = 463/719 (64.39%), Query Frame = 1
Query:   85 ILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIK----DNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            + +L V +Y  I++  Y+  +      +   +  +K      D + P+R+V AL  L     PG NTL  +++ +   +P++D LGTRE++S + ETQ +G+ FKK+ LG+Y W ++++  + +N     +  LG  P K+ + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E S I TS +LL  K+ S+    P +  ++ +D K+                 S+ P  +++ +++ ++++GA  + E      N P    +AVIMYTSGSTG+PKGV I+  NI++ + GM   +PK  VE++ YI YLPLAHV+EL  E++ +  G ++GYSSP TL+D S+KIK  ++GDISVLRPTLM  VP I++RI K V  +V     F   LF  AY+YK ++L  GY +   D++VFR+++ LLGGR++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I +++D  TG  G P+   +++L+DW EGGY   D P PRGE+L+GG ++ +GYYK   KT E FF D+ G RWFCTGDIG I  DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S ES+ I F+ P QKQL+ LAE+  +       E LC +  I +AV   +++  +  ++ERFEIP+K+ L  +PWTPD+GLVTD+ KLKR+E+K  +Q+ I+R Y 
Sbjct:   14 VFRLVVWLYSLISYLPYLLLRSPESQSLSECSRRLKARSVSGDPAGPYRDVAALKGLEMCLHPGINTLDQVFQSSVSHFPNSDCLGTRELLSEEDETQEDGKVFKKVILGEYRWMSYEQVFKEVNAFGSGLAALGQKPMKN-IAIFCETRAEWIIAAQACFMYNFPLVTLYSTLGGPAIAHGLNEAEVSHIITSKDLLETKLKSIFIEVPRLCHVIVVDDKL--------------STSSEYPRGISIHSMASVKELGA--RPENASKPKNPPCSSDVAVIMYTSGSTGVPKGVMISHSNIISGITGMTHRIPKL-VEDDTYIGYLPLAHVLELSAEMVCLAHGCRIGYSSPQTLSDQSTKIKKGSRGDISVLRPTLMAAVPEIMDRIYKNVMLRVEQMSGFQRTLFLLAYNYKMEQLAMGYSTPLCDKLVFRKVRALLGGRLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISHLWDYSTGRVGAPLVCCELQLKDWIEGGYHSTDLPCPRGEILVGGPSITMGYYKNTHKTSEDFFVDKKGQRWFCTGDIGEIHGDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLVDNICAYANSDESYVIGFVVPNQKQLLALAERKRV---RGLWEELCNNPVIEEAVLTVLTEAALTAQLERFEIPRKIRLSVEPWTPDTGLVTDSFKLKRKELKTHYQNDIERMYG 711          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: acsl3 (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:100036652])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 312/675 (46.22%), Postives = 438/675 (64.89%), Query Frame = 1
Query:  208 SPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGA-ESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            S +R+V +   LA++   GC+TL  +++  T L+   D LGTREV+S + E QPNG+ FKK+ LG+Y W +++E     +     +  LG  P +  + I+ ET+AEW+I AQA F  N  + TLYATLG  AI HG+ E+E + I TS ELL  K+ +++   PL++ I+ +D         M  ++      +  P N+T+ ++  ++  GA +S   +L    + P    +AVIMYTSGSTG+PKGV I+  N+++ + GM   +P     +  YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL+D S+KIK  +KGD S L+PTLM  VP I++RI K V  KV    P    LF  AY+YK K++ RGY +   DR+VF +++KLLGG+++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL++W EGGY   D+P PRGE+LIGG NV +GYYK   KT E FF DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S +S+ I F+ P QK+L++LAEK G   +    E LC +  +   V K +++      +E+FE+P K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y 
Sbjct:   20 SAYRSVDSFHSLASSLYTGCDTLDKVFKHGTELFKHKDCLGTREVLSEEDEVQPNGKVFKKVILGRYNWMSYEEAYLFASQFGSGLAALGQKP-RSNIAIFCETRAEWIISAQACFMYNFPLVTLYATLGGPAIAHGLAETEVTHIITSKELLQTKLKAILPQVPLLRHIILVD--------GMGAQQ------TDFPKNITVHSMGAVQAFGAKQSNLSVLNTQRSFPEARDIAVIMYTSGSTGIPKGVMISHSNLISGITGMAQRIPNLGATD-TYIGYLPLAHVLELSAELVCLSRGCRVGYSSPQTLSDQSTKIKKGSKGDASELQPTLMAAVPEIMDRIYKNVMSKVASMSPVQKGLFSLAYNYKMKQISRGYSTPVCDRVVFWKVRKLLGGKLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTITEVWDYSTGRVGAPLVCCEIKLKNWEEGGYYNTDRPCPRGEILIGGPNVTMGYYKNKAKTREDFFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPIVDNICAYANSDQSYVIGFVVPNQKELLKLAEKKG---AQGCWESLCNNSVMEREVLKVLAESPAAATLEKFEVPVKIRLVSEPWTPETGLVTDAFKLKRKELKSHYQEDIERMYG 675          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: acsl3 (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:100036652])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 311/674 (46.14%), Postives = 436/674 (64.69%), Query Frame = 1
Query:  208 SPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            S +R+V +   LA++   GC+TL  +++  T L+   D LGTREV+S + E QPNG+ FKK+ LG+Y W +++E     +     +  LG  P +  + I+ ET+AEW+I AQA F  N  + TLYATLG  AI HG+ E+E + I TS ELL  K+ +++   PL++ I+ +D         M  ++      +  P N+T+ ++  ++  GA+     L    + P    +AVIMYTSGSTG+PKGV I+  N+++ + GM   +P     +  YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL+D S+KIK  +KGD S L+PTLM  VP I++RI K V  KV    P    LF  AY+YK K++ RGY +   DR+VF +++KLLGG+++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL++W EGGY   D+P PRGE+LIGG NV +GYYK   KT E FF DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S +S+ I F+ P QK+L++LAEK G   +    E LC +  +   V K +++      +E+FE+P K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y 
Sbjct:   17 SAYRSVDSFHSLASSLYTGCDTLDKVFKHGTELFKHKDCLGTREVLSEEDEVQPNGKVFKKVILGRYNWMSYEEAYLFASQFGSGLAALGQKP-RSNIAIFCETRAEWIISAQACFMYNFPLVTLYATLGGPAIAHGLAETEVTHIITSKELLQTKLKAILPQVPLLRHIILVD--------GMGAQQ------TDFPKNITVHSMGAVQAFGAKQ----LNTQRSFPEARDIAVIMYTSGSTGIPKGVMISHSNLISGITGMAQRIPNLGATD-TYIGYLPLAHVLELSAELVCLSRGCRVGYSSPQTLSDQSTKIKKGSKGDASELQPTLMAAVPEIMDRIYKNVMSKVASMSPVQKGLFSLAYNYKMKQISRGYSTPVCDRVVFWKVRKLLGGKLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTITEVWDYSTGRVGAPLVCCEIKLKNWEEGGYYNTDRPCPRGEILIGGPNVTMGYYKNKAKTREDFFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPIVDNICAYANSDQSYVIGFVVPNQKELLKLAEKKG---AQGCWESLCNNSVMEREVLKVLAESPAAATLEKFEVPVKIRLVSEPWTPETGLVTDAFKLKRKELKSHYQEDIERMYG 667          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: acsl3 (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:100036652])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 321/735 (43.67%), Postives = 458/735 (62.31%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIF--FKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPT-------------ILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            + L +L  ++ +Y  +TF P+++    +D+      V A  + D    S +R+V +   LA++   GC+TL  +++  T L+   D LGTREV+S + E QPNG+ FKK+ LG+Y W +++E     +     +  LG  P +  + I+ ET+AEW+I AQA F  N  + TLYATLG  AI HG+ E+E + I TS ELL  K+ +++   PL++ I+ +D         M  ++      +  P N+T+ ++  ++  GA+     L    + P    +AVIMYTSGSTG+PKGV I+  N+++ + GM   +P     +  YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL+D S+KIK  +KGD S L+PTLM  VP              I++RI K V  KV    P    LF  AY+YK K++ RGY +   DR+VF +++KLLGG+++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL++W EGGY   D+P PRGE+LIGG NV +GYYK   KT E FF DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S +S+ I F+ P QK+L++LAEK G   +    E LC +  +   V K +++      +E+FE+P K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y 
Sbjct:   15 VLLYLLHFFMWLYGVVTFVPWFLLSGARDRQARASRVKAKSVADKP-ESAYRSVDSFHSLASSLYTGCDTLDKVFKHGTELFKHKDCLGTREVLSEEDEVQPNGKVFKKVILGRYNWMSYEEAYLFASQFGSGLAALGQKP-RSNIAIFCETRAEWIISAQACFMYNFPLVTLYATLGGPAIAHGLAETEVTHIITSKELLQTKLKAILPQVPLLRHIILVD--------GMGAQQ------TDFPKNITVHSMGAVQAFGAKQ----LNTQRSFPEARDIAVIMYTSGSTGIPKGVMISHSNLISGITGMAQRIPNLGATD-TYIGYLPLAHVLELSAELVCLSRGCRVGYSSPQTLSDQSTKIKKGSKGDASELQPTLMAAVPVSSSPDNFCKKSVEIMDRIYKNVMSKVASMSPVQKGLFSLAYNYKMKQISRGYSTPVCDRVVFWKVRKLLGGKLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTITEVWDYSTGRVGAPLVCCEIKLKNWEEGGYYNTDRPCPRGEILIGGPNVTMGYYKNKAKTREDFFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPIVDNICAYANSDQSYVIGFVVPNQKELLKLAEKKG---AQGCWESLCNNSVMEREVLKVLAESPAAATLEKFEVPVKIRLVSEPWTPETGLVTDAFKLKRKELKSHYQEDIERMYG 725          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: acsl3 (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:100036652])

HSP 1 Score: 531.561 bits (1368), Expect = 2.276e-179
Identity = 294/668 (44.01%), Postives = 417/668 (62.43%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIF--FKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQ 2061
            + L +L  ++ +Y  +TF P+++    +D+      V A  + D    S +R+V +   LA++   GC+TL  +++  T L+   D LGTREV+S + E QPNG+ FKK+ LG+Y W +++E     +     +  LG  P +  + I+ ET+AEW+I AQA F  N  + TLYATLG  AI HG+ E+E + I TS ELL  K+ +++   PL++ I+ +D         M  ++      +  P N+T+ ++         + +   KN    P    +AVIMYTSGSTG+PKGV I+  N+++ + GM   +P     +  YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL+D S+KIK  +KGD S L+PTLM  VP I++RI K V  KV    P    LF  AY+YK K++ RGY +   DR+VF +++KLLGG+++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL++W EGGY   D+P PRGE+LIGG NV +GYYK   KT E FF DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S +S+ I F+ P QK+L++LAEK G   +    E LC +  +   V K +++
Sbjct:   10 VLLYLLHFFMWLYGVVTFVPWFLLSGARDRQARASRVKAKSVADKP-ESAYRSVDSFHSLASSLYTGCDTLDKVFKHGTELFKHKDCLGTREVLSEEDEVQPNGKVFKKVILGRYNWMSYEEAYLFASQFGSGLAALGQKP-RSNIAIFCETRAEWIISAQACFMYNFPLVTLYATLGGPAIAHGLAETEVTHIITSKELLQTKLKAILPQVPLLRHIILVD--------GMGAQQ------TDFPKNITVHSMG--------APNLHFKN----PGARDIAVIMYTSGSTGIPKGVMISHSNLISGITGMAQRIPNLGATD-TYIGYLPLAHVLELSAELVCLSRGCRVGYSSPQTLSDQSTKIKKGSKGDASELQPTLMAAVPEIMDRIYKNVMSKVASMSPVQKGLFSLAYNYKMKQISRGYSTPVCDRVVFWKVRKLLGGKLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTITEVWDYSTGRVGAPLVCCEIKLKNWEEGGYYNTDRPCPRGEILIGGPNVTMGYYKNKAKTREDFFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPIVDNICAYANSDQSYVIGFVVPNQKELLKLAEKKG---AQGCWESLCNNSVMEREVLKVLAE 645          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: acsl3 (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:100036652])

HSP 1 Score: 523.087 bits (1346), Expect = 1.482e-177
Identity = 276/580 (47.59%), Postives = 381/580 (65.69%), Query Frame = 1
Query:  490 KDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            +  + I+ ET+AEW+I AQA F  N  + TLYATLG  AI HG+ E+E + I TS ELL  K+ +++   PL++ I+ +D         M  ++      +  P N+T+ ++  ++  GA+     L    + P    +AVIMYTSGSTG+PKGV I+  N+++ + GM   +P     +  YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL+D S+KIK  +KGD S L+PTLM  VP I++RI K V  KV    P    LF  AY+YK K++ RGY +   DR+VF +++KLLGG+++ +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL++W EGGY   D+P PRGE+LIGG NV +GYYK   KT E FF DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S +S+ I F+ P QK+L++LAEK G   +    E LC +  +   V K +++      +E+FE+P K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y 
Sbjct:    5 RSNIAIFCETRAEWIISAQACFMYNFPLVTLYATLGGPAIAHGLAETEVTHIITSKELLQTKLKAILPQVPLLRHIILVD--------GMGAQQ------TDFPKNITVHSMGAVQAFGAKQ----LNTQRSFPEARDIAVIMYTSGSTGIPKGVMISHSNLISGITGMAQRIPNLGATD-TYIGYLPLAHVLELSAELVCLSRGCRVGYSSPQTLSDQSTKIKKGSKGDASELQPTLMAAVPEIMDRIYKNVMSKVASMSPVQKGLFSLAYNYKMKQISRGYSTPVCDRVVFWKVRKLLGGKLRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTITEVWDYSTGRVGAPLVCCEIKLKNWEEGGYYNTDRPCPRGEILIGGPNVTMGYYKNKAKTREDFFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPIVDNICAYANSDQSYVIGFVVPNQKELLKLAEKKG---AQGCWESLCNNSVMEREVLKVLAESPAAATLEKFEVPVKIRLVSEPWTPETGLVTDAFKLKRKELKSHYQEDIERMYG 562          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl4 (acyl-CoA synthetase long-chain family member 4 [Source:MGI Symbol;Acc:MGI:1354713])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 459/722 (63.57%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 +++ P  + + ++  +E++GA  K E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + I+F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ S  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTIN--------------RAEYPEGLEIHSMQSVEELGA--KPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl4 (acyl-CoA synthetase long-chain family member 4 [Source:MGI Symbol;Acc:MGI:1354713])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 459/722 (63.57%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 +++ P  + + ++  +E++GA  K E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + I+F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ S  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTIN--------------RAEYPEGLEIHSMQSVEELGA--KPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl3 (acyl-CoA synthetase long-chain family member 3 [Source:MGI Symbol;Acc:MGI:1921455])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 327/722 (45.29%), Postives = 459/722 (63.57%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY   + K E    + A P+      S +R++ ++D LA+   PGC+TL  ++  A   + +   LGTRE+++ + E QPNG+ FKK+ LG Y W ++++   R  +    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVHG+NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  V + T++ ++ +G ++  E  K   +KP    +AVIMYTSGSTG+PKGV I+  NI+AS+ GM   +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V +KV +   F   LF  AY+YK +++ +G  +   DR VFR +++LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG NV +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C YA+S  S+ I F+ P QK+L +LA   G   +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFIISLYTILTYIPFYFLCESKQEKPNQIKAKPVSSKP-DSAYRSINSVDGLASVLYPGCDTLDKVFMYAKNKFKNKRLLGTREILNEEDEIQPNGKIFKKVILGHYNWLSYEDVFIRALDFGNGLQMLGQKP-KANIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGVIVHTMAAVQALGVKANVE--KKAHSKPLPSDIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQISKGCSTPLCDRFVFRNVRRLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKTDFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLIDNICAYANSYHSYVIGFVVPNQKELTELARTKGFKGT---WEELCNSSEMENEVLKVLSEAAISASLEKFEIPLKIRLSPDPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl3 (acyl-CoA synthetase long-chain family member 3 [Source:MGI Symbol;Acc:MGI:1921455])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 327/722 (45.29%), Postives = 459/722 (63.57%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY   + K E    + A P+      S +R++ ++D LA+   PGC+TL  ++  A   + +   LGTRE+++ + E QPNG+ FKK+ LG Y W ++++   R  +    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVHG+NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  V + T++ ++ +G ++  E  K   +KP    +AVIMYTSGSTG+PKGV I+  NI+AS+ GM   +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V +KV +   F   LF  AY+YK +++ +G  +   DR VFR +++LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG NV +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C YA+S  S+ I F+ P QK+L +LA   G   +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFIISLYTILTYIPFYFLCESKQEKPNQIKAKPVSSKP-DSAYRSINSVDGLASVLYPGCDTLDKVFMYAKNKFKNKRLLGTREILNEEDEIQPNGKIFKKVILGHYNWLSYEDVFIRALDFGNGLQMLGQKP-KANIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGVIVHTMAAVQALGVKANVE--KKAHSKPLPSDIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQISKGCSTPLCDRFVFRNVRRLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKTDFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLIDNICAYANSYHSYVIGFVVPNQKELTELARTKGFKGT---WEELCNSSEMENEVLKVLSEAAISASLEKFEIPLKIRLSPDPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl4 (acyl-CoA synthetase long-chain family member 4 [Source:MGI Symbol;Acc:MGI:1354713])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 320/685 (46.72%), Postives = 445/685 (64.96%), Query Frame = 1
Query:  172 VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 +++ P  + + ++  +E++GA  K E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + I+F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ S  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y
Sbjct:    5 IKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTIN--------------RAEYPEGLEIHSMQSVEELGA--KPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMY 667          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q9QUJ7|ACSL4_MOUSE (Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus OX=10090 GN=Acsl4 PE=1 SV=2)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 459/722 (63.57%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 +++ P  + + ++  +E++GA  K E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + I+F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ S  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTIN--------------RAEYPEGLEIHSMQSVEELGA--KPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|O95573|ACSL3_HUMAN (Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 465/722 (64.40%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY F + + E    + A P+ ++   S +R+V +LD LA+   PGC+TL  ++  A   + +   LGTREV++ + E QPNG+ FKK+ LG+Y W ++++   R  N    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVH +NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  + + T++ +E +GA++  E      +KP    +AVIMYTSGSTGLPKGV I+  NI+A + GM + +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD S+L+PTLM  VP I++RI K V +KV++   F   LF  AY+YK +++ +G  +   D  VFR+++ LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG +V +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S  S+ I F+ P QK+L +LA K G+  +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P+PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPV-NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKP-KTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGIIVHTMAAVEALGAKASME--NQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGT---WEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|O35547|ACSL4_RAT (Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus OX=10116 GN=Acsl4 PE=1 SV=2)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 326/721 (45.21%), Postives = 463/721 (64.22%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            I L  + L + IY  + F P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG+EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 +++ P  + + ++  +E++G++ ++  +    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + I+F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ S  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y
Sbjct:   10 IVLLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKAALLDINCVKHIIYVDNKTIN--------------RAEYPEGLEIHSMQSVEELGSKPENSSIP--PSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q63151|ACSL3_RAT (Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus OX=10116 GN=Acsl3 PE=1 SV=1)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 329/722 (45.57%), Postives = 460/722 (63.71%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            I L  +   + +Y  +T+ PFY   + K E    + A P+      S +R+V ++D LA+   PGC+TL  ++  A   + D   LGTRE+++ + E QPNG+ FKK+ LG Y W ++++   R  +    +  LG  P K  + I+ ET+AEWMI AQA F  N  + TLYATLG  AIVHG+NE+E + I TS ELL  K+  +++  P ++ I+ +D K                  S+ P  V + T++ ++ +G   K ++ K   +KP    +AVIMYTSGSTG+PKGV I+  NI+AS+ GM   +P+   EE++YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D SSKIK  +KGD SVL+PTLM  VP I++RI K V +KV +   F   LF  AY+YK +++ +G  +   DR VFR +++LLGG ++ +L GGAPLS   Q F+NICFC P+ QGYGLTE+   G+I  ++D  TG  G P+   +IKL++W EGGY   DKP+PRGE+LIGG NV +GYYK   KT+  FFEDE+G RW CTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C YA+S  S+ I F+ P QK+L +LA   G + +    E LC   ++ + V K +S+  I   +E+FEIP K+ L P PWTP++GLVTDA KLKR+E+K  +Q  I+R Y R+
Sbjct:   21 ILLYFIHFIISLYTILTYIPFYFLCESKQEKPNHIKAKPVSSKP-DSAYRSVNSMDGLASVLYPGCDTLDKVFMYAKNKFKDKRLLGTREILNEEDEIQPNGKVFKKVILGHYNWLSYEDVFIRALDFGNGLQMLGQKP-KANIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK--------------PPTWSEFPKGVIVHTMAAVQALGV--KADVDKKAHSKPLPSDIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLG-EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQISKGCSTPLCDRFVFRNVRRLLGGNIRVLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLIDNICAYANSYHSYVIGFVVPNQKELTELARTKGFNGT---WEELCNSSEMENEVLKVLSEAAISASLEKFEIPLKIRLSPDPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK 720          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|O60488|ACSL4_HUMAN (Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4 PE=1 SV=2)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 326/722 (45.15%), Postives = 458/722 (63.43%), Query Frame = 1
Query:   67 TFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIV--VSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            T I L +  L  +    I  P+Y     K +N +   + A P  D    SP+R+V   D LA   +PG +TL  L++ A   +   D+LGTRE++S + E QPNG+ FKKL LG Y W  + E + R+NN    +  LGL P K+ + I+ ET+AEWMI AQ  FK N  + TLYATLG+EA+VHG+NESEAS + TS ELL  K+ + +     +K I+++D K                 K++ P    + ++  +E++G  S  E L    ++PT   +A++MYTSGSTG PKGV +   N++A M G  + +P     ++ YI YLPLAHV+EL  E+   T G ++GYSSPLTL+D SSKIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LFK  YDYK +++ +GY +   + ++F+++K LLGG V+ MLSGGAPLS +   F+N+CFC PI QGYGLTE+C  G++  + D  TG  G P+   +IKL+DW EGGY+  DKP PRGE++IGG N+++GY+K  EKT E +  DE+G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C +A S +S+ I F+ P QK+L  LA++ G++ +  D   +C +  +   + K+I +     K+ERFEIP KV L P+PWTP++GLVTDA KLKR+E++  +   I+R Y
Sbjct:    9 TIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKP-GSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKP-KNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAIN--------------KAEYPEGFEIHSMQSVEELG--SNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLG-PKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVD---ICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A0R3SHM8 (AMP-binding domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4441 PE=4 SV=1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 370/793 (46.66%), Postives = 519/793 (65.45%), Query Frame = 1
Query:   52 MSSLSTFIFLNILKLWVLIYEFITFPFYI-----------------FFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDK---------VVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEEL-------KHKIKSK---LPSNVTLMTLSKLEDIGAE------SKDEILKN----LSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXX-XXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGI------------------DCSSNDL---EVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNR 2226
             S L   + +  +KL V  YE++T P Y                  +FK  +  E    ++P+  ND  +PWR V+ +D LAT  +PGC TL  LW R   LWP   ALGTR ++ +D+E  PNG+   KLT+G+Y WET+ E + R++++A  + +L    T+D+         +V++SET+AEW+  A+AS++ N  I TLYATLG++A+VHG+ E+EAS+I+TS ELL K+ +++  CPL+K +++    + +    + +++L       +H +++    +P  V L  + +LE IGA       SK E + N       +P  + LAVIMYTSGSTG PKGV+IT  NI+ + AG+   LPK N++ + YI YLPLAHV+EL  EL ++ MGI +GYS+P TLTDTS+KIK    +GDI VL+P+L   VPT+L+RITK+VW+KV + GP    +F +AYDYK +RL  G+PS  +D ++F +++ L+GGR+++++SGGAPLSEE+  F N+CF PI+QGYGLTET A  ++M   DLR  H G PI S+QI+LR W EGGYSP DKP+PRGE+LI GG+V  GYYK PE TE+ F+ D  G RWFCTGDIGMI +DG  SI+DRKKDLVKLQ GEYVSL KVELA+S+S  VE+VCVYADS E+F+ICF+ PK   + +L  +  +                  D ++  L     LCK  ++I+ VT+DI Q+   K++  FEIP+ V+LDP+PWTP+SGLVTDALK+KR  IK KF+DVI + Y++
Sbjct:    4 FSDLYVAVAMVFIKLMVYAYEYLTLPIYFMFSKTEYFMPFPEDEQSYFKKFAAEESRTLSMPVDQNDPGTPWRAVEYIDNLATVALPGCPTLSDLWLRTIKLWPKKPALGTRRILKTDYEPAPNGKVMIKLTMGEYLWETYAEAENRVSSLAAGLRSLLGPSTEDRKGENTCPTPLVLFSETRAEWLYAAEASWRLNRPIATLYATLGDDAVVHGLEETEASVIFTSDELLSKVVNLLPRCPLVKHVIYFSNGVVQKHTGLGVDDLARLNDTARHSVEAARKAVPEGVRLYDILELEAIGAAEIRGAGSKMECILNWQPPADERPKPNDLAVIMYTSGSTGTPKGVEITHDNIICTTAGIFRRLPKLNLDSDAYIGYLPLAHVLELTSELSILIMGIPIGYSNPQTLTDTSTKIKKGACRGDIVVLKPSLFATVPTVLDRITKSVWEKVKEGGPLMEAIFHFAYDYKCRRLHTGFPSFLVDLLIFHKVRALVGGRLRYIVSGGAPLSEESHLFTNVCFAPIMQGYGLTETAAAATLMECGDLRGHHVGAPIPSVQIRLRPWQEGGYSPYDKPFPRGEILIAGGSVTRGYYKNPEATEDAFYTDSKGVRWFCTGDIGMIHQDGSFSIIDRKKDLVKLQAGEYVSLVKVELALSQSIYVENVCVYADSRENFTICFVCPKLSAIRKLGTELNLMEAATEAANATLPPEKREDSTTRSLAEHAFLCKQPQVIERVTRDIQQVGATKRLANFEIPKMVYLDPEPWTPESGLVTDALKIKRFNIKSKFEDVIKKMYSK 796          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A504YR83 (Long-chain-fatty-acid--CoA ligase OS=Fasciola gigantica OX=46835 GN=FGIG_07350 PE=4 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 371/812 (45.69%), Postives = 516/812 (63.55%), Query Frame = 1
Query:   55 SSLSTFIFLNILKLWVLIYEFITFPFYIFFKDK-----------------SENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDK---VVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKS----------KLPSNVTLMTLSKLEDIGA---------------------ESKDEILKN----------------LSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXX-XXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGID--------------------CSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNR 2226
            S +   + + I+KL V  YE++T+P Y                       SE+E    A+PI+DND + PWR V+++D L +T +PGC  LVS+W R   LWPD  A GTR V+ +D+ T P+GR+  +L LG+Y WETF E + R++ +A  + ++ L P +++   + I+SET+AEW+  AQA+F+ +  + TLYATLG++A+VHG NE+E ++++TS ELL K+  ++  CP I  I++    +F      E++ L     S          K PS++ +  L ++E  GA                     ES ++  ++                +S +P    LAVIMYTSGSTG PKGV+++  N+++++AG    LPK     +IYI YLPLAHV+EL  EL  V MG+++GYS+P TLTDTSS+IK    KGDI++LRPTL   VPT+LER++KAVW +V   G FF  LF++AYDYK +R+  G+PS  +DR++FRR++KL+GGR+++++SGGAPLSE++Q F NIC  PIVQGYGLTET A G++M   DLR  H G P  S+QIKLR W EGGYSP DKP PRGEVLI GG V+ GYYKQP+ T   F++DE G RWFCTGDIG++  DG LSI+DRKKDLVKLQ GEY+SL KVELA+S+S  VE VCVYA+SS+ F++CF+SPK   L+ LA++ G+                         +L  LCK  +II  V KD+ ++  EK++  FEIP+K+ LDP  WTPD+GLVTDALKLKR  ++ +FQ  ID+ Y +
Sbjct:    5 SQILASVGIGIIKLVVYTYEYLTWPLYYLCSKTLRYMPLPNSPVESDWTYSEDESRTLALPIRDNDPAYPWRAVESMDGLISTALPGCKDLVSIWLRTVKLWPDLPAFGTRAVLGTDYRTAPDGRRMVELILGEYSWETFGEAERRVSRLAAGLFSM-LGPVRERNTPIAIFSETRAEWLYAAQAAFRLSRPVVTLYATLGDDALVHGFNEAEVNVVFTSDELLSKVVKIVQRCPSISRIIYFTNGVFNRELYTEVDNLAVPTGSATASIAEALTKAPSSLHIHDLIEVERRGAAIMLAAGEKKRKNQDLLSASGESNEKTKEDGNHGTDGPDEGLWMPPMSERPKVSDLAVIMYTSGSTGQPKGVELSHENLISAIAGHLKRLPKMRSNYDIYIGYLPLAHVLELCSELCCVIMGVRIGYSNPQTLTDTSSRIKHGACKGDITLLRPTLFASVPTVLERVSKAVWQQVNSSGEFFKALFRFAYDYKCRRIHGGFPSFLVDRLIFRRVRKLMGGRIRYIVSGGAPLSEDSQLFANICLAPIVQGYGLTETSASGALMECGDLRCNHVGAPCPSVQIKLRAWPEGGYSPYDKPSPRGEVLIAGGPVSNGYYKQPDLTARDFYKDEDGVRWFCTGDIGLMHTDGSLSIIDRKKDLVKLQAGEYLSLSKVELALSQSSFVEQVCVYANSSQDFAVCFVSPKYTTLMDLAQRLGLSHLVEEARAKFTSDQLKNTNLVHQAELAALCKAPQIIGEVLKDLQRVAREKRLSTFEIPRKLHLDPLQWTPDTGLVTDALKLKRFNLQARFQREIDQMYQK 815          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A158REW4 (AMP-binding domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8200 PE=4 SV=1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 363/793 (45.78%), Postives = 515/793 (64.94%), Query Frame = 1
Query:   52 MSSLSTFIFLNILKLWVLIYEFITFPFYI-----------------FFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDK----------VVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKH----------KIKSKLPSNVTLMTLSKLEDIGAES-KDEILKN----------LSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXX-XXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCG-IDCSS---------NDLE-----------VLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +S +   + +  +KL V  YE++T P Y                  +FK  +  E    ++P+   D SSPWR V+ +D LAT  +PGC TL  LW R   LWP+  ALGTRE++ +D+E  PNG++  KLT+G+Y WET+ E + R++ +A  + NL L P  +           +V++SET+AEW+  AQA ++ N  + TLY++LG++AIVHG+ ++EA +++TS ELL K+ +++  CPL+K ++F    + +     ++E+L              +  +P  V L  + +LE+ G  + + E   N          +  +P    LAVIMYTSGSTG PKGV++   NI+ ++AG+   +PK N E +IYI YLPLAHV+EL CEL ++ M I +GYS+P TLT+TS++IK    +GDI+VL+PTL   VP +L+RI KAVW+KV + GP    +F +AYDYK +RL  G+PS  ++ ++FR+++ L+GGR++ ++SGGAPLSEE+  F N+CF PI+QGYGLTETCA  ++M   DLR  H G PI S+QI+LR W EGGYSP DKP+PRGE+LI GG+V+ GYYK PE T + FF D++G RWFCTGDIGMI +DG  SI+DRKKDLVKLQGGEYVSL KVELA+S+S  VE+VCVYAD  E+++ICFI PK  Q+ +L  + G +D +S         + LE            LC + ++I+ +T+D+ ++   K++  FEIP+KV LDP PWTP+SGLVTDALK+KR  IK KF+D I R Y
Sbjct:    4 ISDIYVTVAMVFIKLMVYAYEYLTLPIYFMFSKTEYFMPFPEDEQTYFKKFAAEESRTLSLPVVQGDPSSPWRAVEYIDSLATVALPGCPTLADLWLRTIKLWPNKPALGTREILETDYEVLPNGKKMVKLTMGEYVWETYVEAERRVSALAMGLWNL-LGPLDESKRNADGFPTPLVLFSETRAEWLYAAQACWRLNRPVATLYSSLGDDAIVHGLEQTEAFVVFTSDELLSKVVNLLPRCPLVKYVIFFSNGVIQKHTNKDIEDLSRFNETARLSVEAARKAIPEGVKLYDILELEEQGRSAFRRENPTNTGALVNWQPPVEERPKPSDLAVIMYTSGSTGTPKGVEMMHDNIICTIAGVFRRMPKLNPESDIYIGYLPLAHVLELTCELCILIMSIPIGYSNPQTLTNTSTRIKKGACQGDINVLKPTLFATVPVVLDRIAKAVWEKVKEGGPLLEAIFHFAYDYKCRRLHTGFPSFLVNLLIFRKVRDLVGGRLRLLVSGGAPLSEESHLFTNVCFAPIMQGYGLTETCAAATLMECGDLRGHHVGAPIPSIQIRLRAWQEGGYSPYDKPFPRGEILIAGGSVSRGYYKNPEATADAFFTDKNGIRWFCTGDIGMIHQDGSFSIIDRKKDLVKLQGGEYVSLVKVELALSQSVYVENVCVYADPRENYTICFIYPKLTQVRKLGAELGLLDAASEAAHASLPPDKLEESTAVSLAEHAFLCHNPQVIERITEDVRRVGGAKRLASFEIPRKVVLDPDPWTPESGLVTDALKIKRFNIKRKFEDDIKRMY 795          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A068XW80 (Long chain fatty acid coenzyme A ligase 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000376500 PE=4 SV=1)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 359/794 (45.21%), Postives = 510/794 (64.23%), Query Frame = 1
Query:   52 MSSLSTFIFLNILKLWVLIYEFITFPFY-----------------IFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINL-----------GLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKH----------KIKSKLPSNVTLMTLSKLEDIG-AESKDEILKN----------LSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXX-XXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGI---------------------DCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +S +   + +  +KL V  YE++T P Y                  +FK  +  E    ++P+  +D  SPWR V+ +D LAT  +PGC+TL  LW R   LWP+  ALGTR+++ +D+E  PNG++  KLT+G+Y WET+ E + R++ +A  + NL           G  PT   +V++SET+AEW+  A+AS++ N  I TLYA+LG++AIVHG+ ++EA +++TS ELL K+ +++  CPL+K ++F    + +  +   +E+L+             +  LP  V L  + +LE+ G A  ++E   N             +P  + LAVIMYTSGSTG PKGV+I   NI+ ++AG+   +PK N E ++YI YLPLAHV+EL CEL ++ M I +G+S+P TL DTS++IK     GDI+VL+PTL+  VP +L+RI K+VW+KV + GP    +F +AYDYK +RL  G+PS  ++ ++FR+++ L+GGR++ ++SGGAPLSEE+  F N+CF PI+QGYGLTETCA  ++M   DLR  H G PI S+QI+LR W EGGYSP DKP+PRGE+LI GG++  GYYK PE T E FF D++G RWFCTGDIGMI +DG  SI+DRKKDLVKLQGGEYVSL KVELA+ +S  VE+VCVYAD  E+++ICFI PK   L +L ++ G+                       S  +   LC   ++I+ VT+D+ ++   K++  FEIP KV LDP PWTP+SGLVTDALK+KR  IK +F++ I R Y
Sbjct:    4 ISDIYVTVAMVFIKLMVYAYEYLTLPIYYMFSETGYFMPFPEDEQTYFKKFAAEESRTLSLPVIQDDPGSPWRAVEYIDNLATVALPGCSTLADLWLRTIKLWPNKSALGTRQILQTDYEVLPNGKKMVKLTMGEYIWETYVEAESRVSALAAGLRNLLGPLEKNRKGDGDSPTP--LVLFSETRAEWLYAAEASWRINRPIATLYASLGDDAIVHGLEQTEAFVVFTSDELLSKVVNLLPRCPLVKYVIFFSNGVIQKHSGRAVEDLERFNDTARLSVETARKALPEGVKLYDILELEEQGRAIIREEFATNTEPLINWQPPAEERPKPNDLAVIMYTSGSTGTPKGVEIVHDNIICTIAGLFRRMPKLNPESDLYIGYLPLAHVLELTCELCILIMSIPIGFSNPQTLMDTSTRIKKGACHGDINVLKPTLLATVPVVLDRIAKSVWEKVKEGGPLMEAIFHFAYDYKCRRLHTGFPSFLVNLLIFRKVRALVGGRLRLLVSGGAPLSEESHLFTNVCFAPIMQGYGLTETCAAATLMECGDLRGHHVGAPIPSVQIRLRAWKEGGYSPYDKPFPRGEILIAGGSITRGYYKNPEATTEAFFTDKNGLRWFCTGDIGMIHQDGSFSIIDRKKDLVKLQGGEYVSLVKVELALGQSVYVENVCVYADPRENYTICFIYPKLTTLRKLGDELGLLDAAAEAAIASLPPDKAEEPTARSLAEHAFLCHHPQVIERVTEDVRRVGAAKRLASFEIPLKVVLDPNPWTPESGLVTDALKIKRFNIKKRFEEDIKRMY 795          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A068X2B8 (Long chain fatty acid coenzyme A ligase 4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000376500 PE=4 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 359/794 (45.21%), Postives = 510/794 (64.23%), Query Frame = 1
Query:   52 MSSLSTFIFLNILKLWVLIYEFITFPFY-----------------IFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINL-----------GLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKH----------KIKSKLPSNVTLMTLSKLEDIG-AESKDEILKN----------LSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXX-XXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGI---------------------DCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +S +   + +  +KL V  YE++T P Y                  +FK  +  E    ++P+  +D  SPWR V+ +D LAT  +PGC+TL  LW R   LWP+  ALGTR+++ +D+E  PNG++  KLT+G+Y WET+ E + R++ +A  + NL           G  PT   +V++SET+AEW+  A+AS++ N  I TLYA+LG++AIVHG+ ++EA +++TS ELL K+ +++  CPL+K ++F    + +  +   +E+L              +  LP  V L  + +LE+ G A  ++E+  +             +P  + LAVIMYTSGSTG PKGV+I   NI+ ++AG+   +PK N E ++YI YLPLAHV+EL CEL ++ M I +G+S+P TL DTS++IK     GDI+VL+PTL+  VP +L+RI K+VW+KV + GP    +F +AYDYK +RL  G+PS  ++ ++FR+++ L+GGR++ ++SGGAPLSEE+  F N+CF PI+QGYGLTETCA  ++M   DLR  H G PI S+QI+LR W EGGYSP DKP+PRGE+LI GG++  GYYK PE T E FF D++G RWFCTGDIGMI +DG  SI+DRKKDLVKLQGGEYVSL KVELA+ +S  VE+VCVYAD  E+++ICFI PK   L +L ++ G+                       S  +   LC   ++I+ VT+D+ ++   K++  FEIP KV LDP PWTP+SGLVTDALK+KR  IK KF++ I R Y
Sbjct:    4 ISDIYVTVAMVFIKLMVYAYEYLTLPIYYMFSETGYFMPFPEDEQTYFKKFAAEESRTLSLPVIQDDPGSPWRAVEYIDNLATVALPGCSTLADLWLRTIKLWPNKSALGTRQILQTDYEVLPNGKKMVKLTMGEYIWETYVEAESRVSALAAGLRNLLGPLEKNRKGDGDSPTP--LVLFSETRAEWLYAAEASWRINRPIATLYASLGDDAIVHGLEQTEAFVVFTSDELLSKVVNLLPRCPLVKYVIFFSNGVIQKHSGRAVEDLGRFNDTARLSVETARKALPEGVKLYDILELEEQGRAIIREELATDTEPLINWQPPAEERPKPNDLAVIMYTSGSTGTPKGVEIVHDNIICTIAGLFRRMPKLNPESDLYIGYLPLAHVLELTCELCILIMSIPIGFSNPQTLMDTSTRIKKGACHGDINVLKPTLLATVPVVLDRIAKSVWEKVKEGGPLMEAIFHFAYDYKCRRLHTGFPSFLVNLLIFRKVRALVGGRLRLLVSGGAPLSEESHLFTNVCFAPIMQGYGLTETCAAATLMECGDLRGHHVGAPIPSVQIRLRAWKEGGYSPYDKPFPRGEILIAGGSITRGYYKNPEATAEAFFTDKNGLRWFCTGDIGMIHQDGSFSIIDRKKDLVKLQGGEYVSLVKVELALGQSVYVENVCVYADPRENYTICFIYPKLTTLRKLGDELGLLDAAAEAAIASLPPDKAEEPTARSLAEHAFLCHHPQVIERVTEDVRRVGAAKRLASFEIPLKVVLDPNPWTPESGLVTDALKIKRFNIKKKFEEDIKRMY 795          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: ACSL3 (long-chain-fatty-acid--CoA ligase 3 [Source:NCBI gene;Acc:103040373])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 324/722 (44.88%), Postives = 453/722 (62.74%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITF-PFYIFFKDKSENEIVVSAVPIKD--NDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            I L + +  V +Y  ITF P+YI       N+     +  +      S P+R V +  +L +    G +TL  ++E A   +P+ D LGTREV+S + E QPNG+ FKK+ LG Y W +++E  +        +  LG  P  + + ++ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE+E + I TS +L+  ++  ++   P ++ I+ +D+K                    LP  + + +++ ++D+GA  K E +     +P    +AVIMYTSGSTG+PKGV I+  NI+A + GM + +P  + E++ YI YLPLAHV+EL  EL+ V+ G ++GYSSP TL D S+KIK  +KGD SVL+PTLM  VP I++RI K V  KV D   F   LF  AY+YK +++ RGY +   D +VFR+++ LLGG  + +LSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I +M+D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NV +GYYK   K +E FF D++G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+++++C YA+S ES+ I F+ P QKQL  LAE+ G+  S    E +C    +   V   I++  +  K+ERFEIP+K+ L  + WTP++GLVTDA KLKR+E+K  +Q+ I+R Y 
Sbjct:   10 ILLQVFRSVVWVYSVITFIPWYIL-SGAGANQARAKRIKARSVSGHPSGPYRAVNSEQRLVSQLHEGVDTLDKVFEYAVKFFPERDCLGTREVLSEEDEVQPNGKVFKKVILGDYNWLSYEEVFQVAQRFGSGLAALGQKPQCN-IALFCETRAEWIIAAQACFMYNFPVVTLYSTLGGPAIAHGLNETEVTHIITSKDLMQSRLKEIVLDVPRLQHIILVDRKPTS--------------WPGLPRGIQVHSMASVQDLGA--KPENMAVQRQRPLPHDIAVIMYTSGSTGIPKGVMISHSNIIAGVTGMAERIPGLD-EKDTYIGYLPLAHVLELSAELVCVSHGCRIGYSSPQTLADQSTKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMVKVDDMSRFQKTLFVLAYNYKMEQISRGYGTPLCDNLVFRKVRSLLGGNTRVLLSGGAPLSAATQRFMNICFCCPVGQGYGLTETCGAGTISDMFDYSTGRVGAPLVCSEIMLKDWEEGGYYSTDKPNPRGEILIGGPNVTMGYYKNEAKNKEDFFVDKNGQRWFCTGDIGEFGPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAYANSDESYVISFVVPNQKQLQALAEQKGVKGS---WEEICNRPDMEKEVLHIITEAAVTAKLERFEIPKKIRLSAEAWTPETGLVTDAFKLKRKELKTHYQEDIERMYG 709          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl4a (acyl-CoA synthetase long chain family member 4 [Source:NCBI gene;Acc:103036866])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 323/727 (44.43%), Postives = 450/727 (61.90%), Query Frame = 1
Query:   61 LSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKD--NDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            LST + L +  L+V +Y  ++F  + F    S  +I+   +  K        P+R+V   + LA    PG +TL  L++ A   +     LGTR V+S + ETQPNG+ FKKL LG Y W T++E +  +N+    +  LG  P ++ + I+ ET+AEWMI AQ+ F+ N  + T YATLGE+A+  G+NE   + + TS ELL  K+ SV+   P +K I+++D K                  +  P  + + ++  ++++GA  K E L     +P    LAVIMYTSGSTG PKGV I   N++A M G  + +P     ++ YI+YLPLAHV+EL  E+  VT G ++GYSSP TL+D S+KIK  +KGD +VL+PTLM  VP I++RI K V  KV +       LF  AY+YK +++ +GY +   + I+F++++ LLGG V+ MLSGGAPLS   Q F+NICFC P+ QGYGLTETC  G+I  + D  TG  G P+   + KLRDWAEGGY+ QDKP+PRGE+LIGG NV  GYYK        FF DE+G +WFCTGD+G +  DGCL IVDRKKDLVKLQ GEYVSLGKVE A+    +++++C YA+S +++ I F+ P QKQL  +A + GI       E +C    +   V K+I  +    K++RFEIP KV L P+PWTP++GLVTDA KLKR+E+K  +   I+R Y R+
Sbjct:    7 LSTLLLLPV-HLFVWLYSVLSFLPWYFLTGASSKKILAKRIKAKSIKGQSEGPYRSVDRFETLAYMDFPGKDTLDKLFDYAVERFGREHCLGTRAVLSEENETQPNGKVFKKLILGDYKWITYEEMEVEVNHFGSGLAALGQQP-RNTIAIFCETRAEWMITAQSCFRRNFPLVTFYATLGEDAVAFGLNECGVTHLVTSAELLETKLKSVLPQIPNLKHIIYVDNKSIST--------------AGYPETIQIHSMQSVKELGA--KPENLNREIVRPIPSDLAVIMYTSGSTGRPKGVVIVHSNLIAGMTGQCERIPGLG-PKDTYIAYLPLAHVLELTAEISCVTYGCRIGYSSPQTLSDQSTKIKKGSKGDCTVLKPTLMAAVPEIMDRINKNVMSKVQEMNCVQRTLFNLAYNYKLEQIKKGYDAPLCN-ILFKKVRALLGGNVRMMLSGGAPLSSATQRFMNICFCCPVGQGYGLTETCGAGTITEVADYSTGRVGAPLICCEFKLRDWAEGGYTKQDKPHPRGEILIGGPNVTKGYYKTDFSKNNDFFVDENGQQWFCTGDVGEVHTDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKNCSLIDNICAYANSDQNYVISFVVPNQKQLTAMANQKGI---VGTWEEICNHPIMEMEVLKEIKNVAKTIKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYLHDIERMYGRK 710          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl3a (acyl-CoA synthetase long chain family member 3a [Source:ZFIN;Acc:ZDB-GENE-050420-181])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 302/673 (44.87%), Postives = 421/673 (62.56%), Query Frame = 1
Query:  205 SSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + P+R+V +LD LAT   PG NTL  ++E +   +   D LGTREV+  + E Q +G+ F+K+ LG+Y W +F++       V +A  + G             +   W+I AQA F +N  + TLY+TLG  AI HG+N++E + I TS ELL     V      ++ I+ +D+K                     P  +++  ++ ++ +G   K E        P    +AVIMYTSGSTG+PKGV I+  N++AS+AGM + +P      + YI+YLPLAHV+EL  E++ V  G ++GYSSP TL D S+KIK+ +KGD SVL+PTLM  VP I++RI K V  KV +       LF  AY+YK ++L +G  +   D++VF++++ LLGGR + +LSGGAPLS   Q F+NIC C P+ QGYGLTETC  G+I  ++D  TG  G P+ S +I+L+DWAEGGY   DKP PRGE+L+GG NV +GYYK      E FF D+ G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +  +P+++++C YA+S ES+ I F+ P QKQL+ LAEK GI  S  D   +C +  I + V K I+   +  ++ERFEIP+K+ L  + WTP++GLVTDA KLKR+E+K  +Q+ I+R Y
Sbjct:   39 AGPYRDVTSLDGLATCLQPGLNTLDRVFETSAKRFSRQDFLGTREVLREEEELQESGKVFRKVVLGEYRWLSFEK-------VYRAASSFG-------------SGLAWIIAAQACFMNNFPLVTLYSTLGGPAIAHGLNQTEVTHIITSKELLETKLKV-----QLQHIIVVDEKPTSCVG--------------YPRGISVHNMAAVQALGV--KPENASRPRQLPAPSDIAVIMYTSGSTGVPKGVMISHSNLIASIAGMAERIPNLG-SNDTYIAYLPLAHVLELSAEMVCVAYGCRIGYSSPQTLADQSTKIKTGSKGDTSVLQPTLMAAVPEIMDRIYKNVMMKVEEMSTLQKTLFILAYNYKMEQLAKGNSTPLCDKLVFKKVRALLGGRTRVLLSGGAPLSAATQRFMNICLCCPVGQGYGLTETCGAGTISQLWDYSTGRVGAPLVSCEIQLKDWAEGGYRNTDKPCPRGEILVGGPNVTMGYYKNEAMNRENFFVDKKGQRWFCTGDIGEFQADGCLKIIDRKKDLVKLQAGEYVSLGKVEAILKNNPLIDNICAYANSDESYVIGFVVPNQKQLMALAEKRGICGSWMD---ICNNSVIEEEVLKAITDTALSGQLERFEIPRKICLSAEAWTPETGLVTDAFKLKRKELKSFYQNDIERMY 666          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl4b (acyl-CoA synthetase long chain family member 4b [Source:ZFIN;Acc:ZDB-GENE-030131-6493])

HSP 1 Score: 518.079 bits (1333), Expect = 1.409e-174
Identity = 291/673 (43.24%), Postives = 408/673 (60.62%), Query Frame = 1
Query:  211 PWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEEC-FFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            P+R V   + L      G +TL  L+  A   +     LGTR +IS + ETQP+G+ F+KL LG+Y W++++E +  +  +   +  LG  P K  + IY ET+AEW+I AQA F+ N  + TLYATLGEEA+  G+N+ +A+ + TS ELL  K+  V+   P +K +++         N               P ++ + ++ ++ D+GA  K E L+     P+   LAV+MYTSGSTG PKGV +   N++A MAG    +P      ++YI YLPLAHV+EL  E+  +T G ++GYSSP TLTD S+KI+  +KGD +VL+PTL+  VP I++RI K V  KV +       LF+ A+ YK ++L  G  +   D +VF+R+  LLGG V+ MLSGGAPLS     F+N+CFCPI  GYGLTET   G+I    D  TG  G P+   +IKLRDW EGGY+   +P           NVA+GYY    + E   F+ DE+G RWFCTGD+G +  DGCL IVDRKKDLVKLQ GEYVSL K+E A   S ++++VCVYADS++++ I F+ P QK+L +LA K  I+    + E LC +  +   V K I +I    K++RFE+P K  L  +PWTP++GLVTDA KLKR+E++  +   I+R Y 
Sbjct:   17 PYRAVDCEEALVRQDFEGVDTLDKLFRHAVAKFKQTPCLGTRSIISKENETQPDGKVFQKLVLGEYSWKSYEEVEHEVELLGSGLAALGQTP-KSNIAIYCETRAEWIITAQACFRRNYPLVTLYATLGEEAVAFGLNQCKATHLITSKELLDTKLKVVLAEVPGLKHVIYAGTGSVSAGN--------------YPQSLAIHSMQEVLDLGA--KPENLQVEYAPPSPSDLAVVMYTSGSTGQPKGVMMLHSNLIAGMAGQCQRIPGLG--SDVYIGYLPLAHVLELTAEISCLTYGCRIGYSSPQTLTDQSTKIQKGSKGDCTVLKPTLIAAVPEIMDRIYKNVMGKVCEMSMVQRTLFRMAFKYKLQQLENGANTPICDTLVFKRVCALLGGSVRLMLSGGAPLSALTHRFINVCFCPIAIGYGLTETSGAGTISEFSDFSTGRVGAPLICSEIKLRDWPEGGYT---RP-----------NVAVGYYGTAGEAESGEFWVDEAGQRWFCTGDVGEVHPDGCLQIVDRKKDLVKLQAGEYVSLAKIEAAAKNSSLIDNVCVYADSNQNYVISFVVPNQKRLTELARKMSIE---GEWEELCNNAVLEQEVLKAIKEIATTYKLQRFEVPLKARLSSQPWTPETGLVTDAFKLKRKELQRHYLHDIERMYG 653          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 269.24 bits (687), Expect = 3.802e-79
Identity = 209/691 (30.25%), Postives = 328/691 (47.47%), Query Frame = 1
Query:  196 NDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGK-YYWETFKETDERINNVAKAMINLGLVPTKDKVV-IYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSC-----PLIKTIVFMD--QKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAG-MKDVLPKFN-VEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTD--QGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            N    P R    L++       G      L +   I +   DA    EV         NG        GK Y W  +K+  +R   +   +++ GL P+ D  + I+++ + EW+I   A +  +++   LY TLG EA++  IN    S +    +   K  +++ SC     P++ TI+ MD       DR +                 V ++ L  +E +G   KD I K +  KP  + L+++ +TSG+TG PKG  +T  N+VA  A  +K     F  +  ++ IS+LPLAH+ E V + +L   G ++G+                   D+  L+PT+   VP +L R    V+D+V    Q PF   L  +A + K   +  G        D+ +F ++++ LGGRV+ M++G AP+S    +F+  C  C I + YG TE  AG +I    D   GH G P+    +KL D  E  Y   +     GEV I G NV  GY   PE+T E    D+ G  W  TGDIG     G L I+DRKK++ KL  GEY++  K+E    +S +V  V V+ DS +S  +  + P  + L   AEK  +  S   +E LCK+++I  A+  D++++  E  ++ FE  + ++L    +T ++GL+T  LK KR E+   F+  ID  Y
Sbjct:   32 NTRPKPVRPPVDLNRQTKGIAGGARKTALLKDDNLISYLHEDAKTLYEVFQRGLHVSGNGPCLGYRKAGKPYQWLKYKQVSDRAEYLGSGLLHRGLKPSPDSFIGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQ--NKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASK--------------CGVEILNLKDVEALG---KDNIKKPVPPKP--EDLSIVCFTSGTTGDPKGAMLTHENVVADAASFVKSFESAFTPLPTDVTISFLPLAHMFERVVQTVLYGAGGRVGF---------FQGDIRLLPDDMKTLKPTVFPVVPRLLNR----VYDRVQSGAQTPFKKWLLNFAIERKHAEVKEGIIRNDSIWDKFIFHKVQESLGGRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASND---EGEVCIKGKNVFRGYLNDPERTAEAL--DQDG--WLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSALVAQVFVHGDSLQSSLVAIVVPDPEVLPGYAEKLSLKGS---MEELCKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 278.1 bits (710), Expect = 6.077e-83
Identity = 208/668 (31.14%), Postives = 325/668 (48.65%), Query Frame = 1
Query:  286 WERATILWPDNDALGTR---------EVISSDFETQPNG--RQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVV-IYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCP-----LIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIV----ASMAGMKDV-LPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVN-ICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            ++R + L PD+D   T          EV         NG    ++K     Y W ++KET +R   +    ++LG  P+ ++V+ I+S+ + EW+I  QA +  ++++  LY TLG E+I + IN++E S++    + L K+  ++ S       ++KTIV MD         ME    K          + L+   +LE IG  +  E +      P  D +A+I YTSG+TG PKG  +T  N++    A +A  KD  LP     +++ IS+LPLAH+ E + E  ++  G ++G+                   D+ VL+PT+   VP +L RI   V          +L  F  +      R G        D+++F R++  +GGRV+FM++G AP+S     F+  I  C + +G+G TE  AG +     D   GH GPP+    IK+ D AE  Y   +     GEV + G NV  GY K P +T E    DE G  W  TGDIG    +G L IVDRKK + KL  GEY++  K+E    +S  V  V V+ DS +S  +C + P  + L    +K GI C+ N + +   +K +  A+  D+ ++  E  ++ FE  + V L    ++ ++GL+T   K+KR E+   F   ID  Y
Sbjct:   70 YQRRSPLVPDDDTFFTYFYEDARTGYEVFQRGLRISNNGPCLGYRKPN-HPYEWISYKETSDRAEYLGSGFLHLGAKPSSEQVIGIFSQNRPEWIIAEQACYTYSLVVVPLYDTLGRESIDYIINQAEISMVVC--DKLEKVKGLLESIEEGAIRIVKTIVVMDPF----DGVMEQRARK--------CGIDLILFRELEVIGKTNHREPIP-----PQPDDIAIICYTSGTTGNPKGAMLTHKNMISDFSAFLAITKDTFLPN---TDDVLISFLPLAHMFERLVEASILCNGGRVGFYQ---------GDIRLLMDDMKVLQPTVFPVVPRLLNRIHDKVLSGAKSHFKRWLLEFAVSRKIAELRCGVVRKDSIWDKLIFHRVQASMGGRVRFMVTGAAPISASILTFLRAILGCQVYEGFGQTECTAGCTFTMPSDSTAGHVGPPMPCNHIKVVDVAEMNYFAANG---EGEVCVYGTNVFKGYLKDPTRTAEAL--DEDG--WLHTGDIGKWLPNGTLKIVDRKKHIFKLSQGEYIAPEKIETVYVRSEPVAQVFVHGDSLQSCLVCIVVPDMEVLPSWVQKRGIKCNPNSVFI---NKDVRAAILHDMVRLGKEAGLKSFEQVRAVHLHSDLFSIENGLLTPTFKVKRAEVCKFFHSEIDSLY 695          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 230.72 bits (587), Expect = 7.928e-70
Identity = 127/272 (46.69%), Postives = 183/272 (67.28%), Query Frame = 1
Query:  790 KLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEG 1602
            KLP  + +M +S +E++G   K +  +   ++P    LAV+MYTSGSTG+PKGV+I   N+VA++ GM   +      ++ YI YLPLAHV+EL  E++ ++ G ++GYSS  TLTD S++IK  ++GD+++LRPTLM  VP I+ERI K V  KV         +FK AY+YK ++L RG+ +   +R+VF ++  LLGG V+ +LSG APLS   Q F+N+CF CP+ QGYGLTETCA G+I  + D  TGH G P++  +I+LR+W EG
Sbjct:   27 KLPRGIEVMGMSDVEELG--DKPQHRQRARDRPGPRDLAVVMYTSGSTGIPKGVRIAHSNLVAAITGMYLRINDI-CGDDTYIGYLPLAHVLELGAEMVCLSRGCRIGYSSAQTLTDQSTRIKKGSQGDVTILRPTLMAAVPEIMERIYKGVMGKVQCMSLLQRIIFKLAYNYKLEQLERGFDTPLCNRLVFNKLCALLGGNVRLLLSGAAPLSPRTQRFMNVCFCCPVGQGYGLTETCAAGTIAELQDYSTGHVGAPLSCCEIQLRNWEEG 295          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 219.164 bits (557), Expect = 1.189e-63
Identity = 157/476 (32.98%), Postives = 241/476 (50.63%), Query Frame = 1
Query:  829 LEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEE--EIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKV--TDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKS 2235
            L+D G   K   L      P  + LA++ +TSG+TG PKG  +T  NIV+ M+G   V     + E  +I ISYLPLAH+ E + +  L   G  +G+                   D+  LRPT+   VP IL R+    +DKV  + + PF  +L ++    K   L RG    +   D +VFR ++  +GGRV+ +++G AP+S    NF+ +   C + +GYG TE  AG ++    D + GH G P+    IKL D  +  Y        +GEV + G NV  GY K  EKT E    D  G  W  TGDIG    +G L I+DRKK + KL  GEY++  K+E   S+   V  V V+ DS ++  +  + P  + L     K GI  + ++   LC++K++  A+ +D+ ++  E  ++ FE  + V L  + ++ ++GL+T   K KR E++  F+ VI   Y   K+
Sbjct:    2 LQDCGRMHKRTTLP-----PKPEDLAIVCFTSGTTGNPKGAMLTHRNIVSDMSGFLKVTESLFLPETSDIAISYLPLAHMFERLVQATLFCHGASIGF---------FQGDVRLLLDDMQALRPTVFPVVPRILNRM----YDKVLGSTRTPFRRKLLEFGARRKMAELQRGVVRRNSLWDWLVFRPMQLSVGGRVRMIMTGAAPISPGVLNFLRVVMGCQMYEGYGQTECTAGCTLTLPGDWKAGHVGAPMPCNYIKLHDVKDMEYYTSQG---KGEVCVKGPNVFKGYLKDAEKTAEAV--DRDG--WLHTGDIGQWMPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYSRCEPVAQVYVHGDSLQACLVAVVVPDPEILCCWIRKKGIVGTYSE---LCRNKEVRQAILEDMQRLGKESDLQPFEQVKDVHLHNEMFSIENGLLTPTFKAKRTELRTHFRSVISSMYQNVKA 449          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 134.035 bits (336), Expect = 1.032e-32
Identity = 162/705 (22.98%), Postives = 291/705 (41.28%), Query Frame = 1
Query:  223 VKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHE-LLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIV--ASMAG-MKDVLPKFNVEEEIYISYLPLAHVMELVCELLL-VTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLG--------RGYPS------VFMDRIVFRRIKKLLG-GRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKS-PVVESVCVYADSSESFSICFI-------------SPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQI-----CIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + A   L+ TP     T+  L+ER   L+ D+ AL ++E           G  +K LT  +YY         +    AK+ + LGL      V I     AEW I    +  +      +Y T   EA  +  +   A++I   ++  L KI  V +  P +K IV                + K ++K K P+   + + ++    G E  D  L  +      +    ++YTSG+TG PKGV ++  N+   A++ G +  +    +  +E+ ISYLPL+H+   + ++ L +  G    ++ P  L  +      +       +RPT  + VP + E++ + +       G F  ++  WA     K +G        +G P+         + +VF+++++ LG  R     +G AP++ +   F      P+ + YG++E+    +I +    + G  G  +   +  L    E G          GEV   G +V +GY    EKT E   +D     W  +GD+G + + G L I  R K+L+   GGE V    +E AI +  PVV +  V  D  +  S+                     +++   ++ G   +        KD  +  A+   I ++        ++++++E+  + F  P       G +   +KLKR  +   +Q++I+R Y
Sbjct:   70 INASGPLSDTP----ETINQLFERTVKLYGDHKALASKE-----------GNTWKILTYKEYY--------AQCRQAAKSFLKLGL-QRYHGVGILGFNSAEWFISDIGAILAGGFAVGIYTTNSAEACQYVADNCLANIIVVENDKQLQKILEVQSQLPHLKAIV----------------QYKGELKEKKPN---VYSWAEFMRAGEEVPDAQLDAIIASQRANQCCSLIYTSGTTGSPKGVMLSHDNLTWTATVTGELTQLRSADDNYQEVVISYLPLSHIAAQLVDIWLPMRFGGVTYFAQPDALKGSLVVTMKE-------VRPTGFMGVPRVWEKMMEKMKATAAKSGIFKRKIAGWA-----KSVGLQTHLANMKGNPAEAPMGYTLANMLVFKKVREALGLDRCTKCYTGAAPITRDTLEFFLSLDIPVFELYGMSESSGPHTISSPTAFQIGSCGTLLRGCRTLLHSKDEEG---------SGEVCFWGRHVFMGYLNMEEKTREAIDDDG----WLHSGDLGRVDEQGLLYITGRIKELIITAGGENVPPIPIEDAIKEELPVVSNAMVIGDRRKFLSVLLTLKCESNGDSGEPDDALTDEVVHWCQRVGSTATRASQIAGGKDPVVERAIRDGIERVNKRAPSNAQRVQKWELLLRDFSIP------GGELGPTMKLKRPVVTKIYQELIERLY 700          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005646.1 (pep scaffold:Pmarinus_7.0:GL484188:1842:9754:1 gene:ENSPMAG00000005099.1 transcript:ENSPMAT00000005646.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.894e-9
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  316 NDALGTREVISSDFETQPNG-----RQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVV-IYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINES 630
             DA    EV         NG     R+ KK     Y W ++KE  ER       +I+ G  P  D+ + ++++ + EW+I  QA +  ++++  LY TLG+EAI   IN +
Sbjct:   87 EDAKTMYEVFHRGMRVSKNGPCLGYRKPKK----PYQWMSYKEVAERSEWFGSGLIHKGCRPATDQFIGVFAQNRPEWIITEQACYMYSMVVVPLYDTLGQEAIRFIINRA 193          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 321.242 bits (822), Expect = 3.980e-99
Identity = 218/696 (31.32%), Postives = 361/696 (51.87%), Query Frame = 1
Query:  205 SSPWRNVKALDK-LATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQP-----NGRQ------FKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKD-KVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNA-----MEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKW-AYDYKRKRLGRGYPSV-FMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGI---DCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            ++P RN +  +K L   P   C+T+            +++A+G R+V     E++      +G++      +    L  Y++ +F +  + ++ + + ++ +GL P  D K+ +Y+ T  +WM +   +    I + T Y TLGE+ ++H + ++ +  I+T + LLP +   + +   +K I+  D    +DR           +  ++IK   P ++   +   +  +G ES +EI     + P KD L  IMYTSGSTG PKGV +   N+VA + G    + KF    +  I +LPLAH+ ELV ELL    G  +GY++  TLT +S +       +    +PT+MV V  + E + K + +++ D  PF  +   W AY+ K        P    +  +VF++I+   GG+++++L+GG+P+S +AQ F+    CP++ GYGLTETCA  +I++  +   G  G     + +KL D  E GY  ++    +GEV I G NV   YYK  E+T +    D     WF TGDIG    +G L I+DRKK+LVK   GEY++L K+E     +  V ++CVYAD S++  +  I P    L +LA+K GI     SS ++E   +D K+I AV  D+ +   ++ +   E+   +      WTP +G VT A KLKR++I    +D +D  Y+
Sbjct:   18 TAPRRNYQCREKPLVRPPNTKCSTVYEFVLECFQKNKNSNAMGWRDVKEIHEESKSVMKKVDGKETSVEKKWMYYELSHYHYNSFDQLTDIMHEIGRGLVKIGLKPNDDDKLHLYAATSHKWMKMFLGAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIFTDNSLLPSLIKPVQAAQDVKYIIHFDSISSEDRRQSGKIYQSAHDAINRIKEVRP-DIKTFSFDDILKLGKESCNEID---VHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSVRNCQGDLQE---FKPTIMVGVAAVWETVRKGILNQI-DNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGNLVFKKIRTATGGQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGDLTGCVTVKLVDVEELGYFAKNN---QGEVWITGANVTPEYYKNEEETSQALTSD----GWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSNEYVANICVYADQSKTKPVGIIVPNHAPLTKLAKKLGIMEQKDSSINIENYLEDAKLIKAVYSDLLKTGKDQGLVGIELLAGIVFFDGEWTPQNGFVTSAQKLKRKDILNAVKDKVDAVYS 698          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA4 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; role in stationary phase survival; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms cytoplasmic foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000004860])

HSP 1 Score: 288.115 bits (736), Expect = 8.742e-87
Identity = 204/691 (29.52%), Postives = 349/691 (50.51%), Query Frame = 1
Query:  205 SSPWRNVKALDKLATTPV-PGCNTLVSLWERATILWPDNDALGTREVIS-----------SDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPT-KDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNA-----MEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYP-SVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            ++P RN++  D+    P+    +TL              D +  R++I             D + +P  + +    L  Y   T++E    ++++ + +I +G+ P  ++K  I++ T  +WM          I + T Y TLGE  ++H + E+++  I+T ++LL K+A  + +   +K ++  +     D+          ++   KIK   P ++ + +  ++ +IG ++KDE+  +    P  +  A IMYTSGSTG PKGV +T  NIVA + G+   +  +    +  I++LPLAH+ EL  E         LGY++  TLT TS++       +    +PT+MV V  + E + K +  K+ +   +   LF   Y  K     R  P S  +  ++F+RI++  GG ++F+L+GG+ +S +AQ F++   CP++ GYGLTE  A   ++       G  G  + ++  KL D  + GY  ++    +GE+L  G  +   YYK PE+T   F +D     WF TGDI   +  G + I+DRKK+LVK   GEY++L K+E     +P V+++CVYAD ++   +  + P    L +LA + GI     D+E    +KK+ DAV KD+      + +   E+   +    + WTP++GLVT A KLKRR+I    +  ++R Y
Sbjct:   18 TAPRRNIRVKDQPLIRPINSSASTLYEFALECFTKGGKRDGMAWRDIIDIHETKKTIVKRVDGKDKPIEKTWLYYELTPYITMTYEEMICVMHDIGRGLIKIGVKPNGENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDSVAIFTDNQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKAAKDAVDKIKEVRP-DIKIYSFDEIIEIGKKAKDEVELHF---PKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIGWIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGDLME---FKPTVMVGVAAVWETVRKGILAKINELPGWSQTLFWTVYALKE----RNIPCSGLLSGLIFKRIREATGGNLRFILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGTITAKLVDVEDLGYFAKNN---QGELLFKGAPICSEYYKNPEETAAAFTDD----GWFRTGDIAEWTPKGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSNPYVQNICVYADENKVKPVGIVVPNLGHLSKLAIELGIMVPGEDVESYIHEKKLQDAVCKDMLSTAKSQGLNGIELLCGIVFFEEEWTPENGLVTSAQKLKRRDILAAVKPDVERVY 690          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA3 (Long chain fatty acyl-CoA synthetase; activates imported fatty acids with a preference for C16:0-C18:0 chain lengths; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery [Source:SGD;Acc:S000001271])

HSP 1 Score: 285.804 bits (730), Expect = 4.937e-86
Identity = 194/615 (31.54%), Postives = 323/615 (52.52%), Query Frame = 1
Query:  397 LGKYYWETFKETDERINNVAKAMINLGLVPT-KDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNA-----MEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSV-FMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            +  Y   T++E    ++++ + +  +G+ P  + K  I++ T  +WM +        I + T Y TLGE  ++H + E+E++ I+T ++LL K+   + S   IK ++  +     DR          ++  +KI+   P ++ + +  ++  IG +SKDE+     + P    LA IMYTSGS   PKGV +T  NIV+ +AG+   +  +    +  +S+LPLAH+ ELV E         LGY S  TLT+TS++       +    +PT+M+ V  + E + KA+ +K++D  P   ++F  AY  K K +    P   F+ R+VF+++++  GG ++++++GG+ +S +AQ F +I  CP++ GYGLTET A   ++       G  G  + S+  KL D  + GY  ++    +GE+L+ G  V   YYK P +T   F  D     WF TGDI   +  G L I+DR+K+LVK   GEY++L K+E     +  V+++CVYAD S    +  + P    L + A K  I     D+E    DK + +AV K++      + +   E+   +    + WTP++G VT A KLKRREI    +  ++R Y
Sbjct:   94 MSPYKMMTYQELIWVMHDMGRGLAKIGIKPNGEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTDNQLLAKMIVPLQSAKDIKFLIHNEPIDPNDRRQNGKLYKAAKDAINKIREVRP-DIKIYSFEEVVKIGKKSKDEVK---LHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFGWIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGDLVE---FKPTIMIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSV----PCTGFLSRMVFKKVRQATGGHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGSVTAKLVDVKDLGYYAKNN---QGELLLKGAPVCSEYYKNPIETAVSFTYDG----WFRTGDIVEWTPKGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSNSYVKNICVYADESRVKPVGIVVPNPGPLSKFAVKLRIMKKGEDIENYIHDKALRNAVFKEMIATAKSQGLVGIELLCGIVFFDEEWTPENGFVTSAQKLKRREILAAVKSEVERVY 690          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA2 (Medium chain fatty acyl-CoA synthetase; activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome; comparative analysis suggests that a mitochondrially targeted form may result from translation starting at a non-canonical codon upstream of the annotated start codon [Source:SGD;Acc:S000000817])

HSP 1 Score: 192.971 bits (489), Expect = 2.655e-52
Identity = 178/664 (26.81%), Postives = 306/664 (46.08%), Query Frame = 1
Query:  307 WPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDK---------VVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDV--LPKFNVEEEIY-ISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRL-GRGYPS------VFMDRIVFRRIKKLLG-GRVQFMLSGGAPLSEEAQNFVNICF-CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVE-LAISKSPVVESVCVYADSSESF--SICFISPKQKQLIQLAEKCGIDCSSND--LEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            WP  D LG+R +   D  T      F+        +E++    +R +N+   +  L LV TK K         V I S    EW++   A    ++  T LY TLG     + +N +EA ++  +   +  +  ++     + T+V MD+ +  D   M  E L     + L   +T  +L ++E +G  +K   +      PT DSL  I +TSG+TGLPKGV+++  NI + +A       +P     +++Y + +LPLAH+ E +     + +G  +G+              +    D+ +L+P  +  VP IL R    + + + D+      +     D K  R   RG P       +   R++  +I+  LG     F+++G AP+S++   F+       I QGYGLTET AG  +   ++   G  G    S + +L+   E GY   DK   +GE+ I G  V   Y+K P +T +    D+ G  WF TGD+  I   G +S++DR K+  KL  GEY++  K+E + +S  P +  + V+ D  ++F   I  +     Q I  A+   +   + +  +E L ++KK+       I++ C +  ++ FE    + +  +P T +  +VT   K+KR +    F+D +D+ Y
Sbjct:  106 WPQRDCLGSRPI---DKATGTWEETFR--------FESYSTVSKRCHNIGSGI--LSLVNTKRKRPLEANDFVVAILSHNNPEWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYHVLKMVPDMKFVNTLVCMDE-LTHDELRMLNESLLPVKCNSLNEKITFFSLEQVEQVGCFNKIPAIP-----PTPDSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMVIAYDLAIGFGIGF--------LHKPDPTVLVEDLKILKPYAVALVPRILTRFEAGIKNAL-DKSTVQRNVANTILDSKSARFTARGGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLRSALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYH-ADKDL-KGELQIRGPQVFERYFKNPNETSKAV--DQDG--WFSTGDVAFIDGKGRISVIDRVKNFFKLAHGEYIAPEKIENIYLSSCPYITQIFVFGDPLKTFLVGIVGVDVDAAQPILAAKHPEVKTWTKEVLVENLNRNKKLRKEFLNKINK-CTD-GLQGFEKLHNIKVGLEPLTLEDDVVTPTFKIKRAKASKFFKDTLDQLY 733          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 50.8322 bits (120), Expect = 5.441e-7
Identity = 68/264 (25.76%), Postives = 109/264 (41.29%), Query Frame = 1
Query: 1465 CPIVQGYGLTETCAGGSIMNMY--DLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRG---EVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKV-FLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKSK 2238
             P+++ Y +TE     +  N+     + G  G P     + L D         D   P G   EV I G NV LGY   P+  +E F + E+   +F TGD G    +G L +  R K+L+  +GGE +S  +++  +   P ++    +    + +          Q++Q A             VL K +K+    T +     ++K +  F+IP KV F+D  P T          K++RR I   F        +R KSK
Sbjct:  328 APVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQGVTVVILDD--------NDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKREN---YFRTGDQGYFDPEGFLVLTGRIKELIN-RGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYG---------QVVQAA------------IVLKKGEKM----TYEELVNFLKKHLASFKIPTKVYFVDKLPKTATG-------KIQRRVIAETFAKS-----SRNKSK 542          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO29879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D4])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 332/726 (45.73%), Postives = 472/726 (65.01%), Query Frame = 1
Query:   58 SLSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDL--SSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELF-KWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            SL   +FL  L +   ++  ++F  + +   +S  +I    +  +   L   +P+R+V+  D L TT   G  T+  L+ R+  L+     LGTRE +S + ETQPNGR FKK   G+Y W T+ E D R  N+   +I LG  P +  +V+++ETQA+WM+ A + F     + T+YATLG+EA+ HGINE+E + + T   LLPK+A+V      ++ I++M        NA      K  +    PS++ L ++ ++E++G+   +   + +   P  +  AVIMYTSGSTGLPKGV I+  N++A+ A M   +     E+++Y+ YLPLAHV+ELV E  L+  G  +GYSSPLTL+D SSKIK  +KGD++VLRPTLM  VP I++RI + V +KV D GP  L+LF  +AY+YK +++ RGY +  ++R +F +++KLLGGRV+ MLSGGAPLS + Q F+N+CFC P+ QGYGLTETC GG+I + +D  TG  GPPI S ++KL  W EGGY+ +DKP+ RGE++IGG NV LGYYK P+KT+E F  D +G RWF TGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE A+++   VE+VCV+ADS ++F +C + P+ KQL QLA+   +   ++D   +C +K I +AV KDI  +    K+E+FEIPQ++ L  + WTP+S LVT ALKLKR+ I   +QD +   YN
Sbjct:    4 SLVENVFLFTLNVAGWLWGVMSFVPWYYMSGRS-GQIRRQKIQARPTSLVPGAPYRDVEHFDALVTTLYKGITTMDQLFRRSVQLYAFRKCLGTRETLSIEEETQPNGRVFKKEIRGEYNWLTYAEVDSRARNLGNGLITLGQQP-RQNIVVFAETQADWMVSALSCFGFGFPVVTIYATLGDEAVAHGINETEVNFVITDSVLLPKLAAVSGQLTQLQHIIYMG-------NA------KKSVLMNFPSSIKLHSMVEVEELGSRQGNAQSRYV---PHPEDTAVIMYTSGSTGLPKGVIISHANLLAATAAMGARVEPSITEKDVYVGYLPLAHVLELVAENALLAHGACIGYSSPLTLSDQSSKIKKGSKGDLTVLRPTLMAAVPVIMDRIRQNVMEKVKD-GPRLLQLFFTFAYNYKLQQIKRGYDAPLLNRFIFAKLRKLLGGRVRQMLSGGAPLSSDTQYFMNVCFCCPVGQGYGLTETCGGGTICHTWDRTTGRVGPPIASCEVKLVSWEEGGYTIRDKPFARGEIVIGGSNVTLGYYKNPQKTQEDFEVDRNGQRWFHTGDIGEFHDDGCLKIIDRKKDLVKLQSGEYVSLGKVEAALAQCQYVENVCVFADSLKTFCVCLVVPRPKQLKQLADS--LQVPTDDWSAVCSNKAIREAVLKDIRIVGNSAKLEKFEIPQRMSLVLEQWTPESELVTAALKLKRKNITSFYQDTLRTLYN 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO45461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR3])

HSP 1 Score: 285.034 bits (728), Expect = 3.245e-85
Identity = 194/622 (31.19%), Postives = 320/622 (51.45%), Query Frame = 1
Query:  397 LGKYYWETFKETDERINNVAKAMINLGLVPTKDKVV-IYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLS--NKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEE-EIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICF--CPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKSK 2238
            +G Y W ++ E  ER ++   A+++LG  P++   V I ++   EW++   A    +++   +Y T G +A +  IN ++   I  +H  +P I   I   P +K I+ + + +       E E    K+     S + L++ S  E+IG        KN+   N P  + +  I YTSG+TG PKG   T  N++A ++G   V+ ++N    +++ SYLPLAH  E    + ++  G ++G+             +         L+PT    VP I+ ++   V  +V+ +  F   +F+     K+  + +     +   D++VF++++ L GGRV+ + SG APLS +   F       C I++GYG TE  A  S+    D++ G  GPP+T   IKL D  E  YS +D    +GEV I G NV   Y+K PEKT E    DE G  W  TGDIGM  ++G L I+DRKKD+ KL  GEYV+ GK+E    +SP V    V+ +S ++F +  + P  + L + A +  I     DL+ LC+ +++  AV +D+ ++C E ++  FE  + V L P+ ++ ++ L+T   K+KR +I   F DVI+  Y+  ++K
Sbjct:   87 IGMYRWLSYNEVRERAHSFGSALVHLGCHPSQRTFVGIQAKNCVEWVLTDLACQMFSMVSVPIYDTHGPDACLFIINHADVETIVCNHTKVPFILKNIKRIPHLKCIIQIGELV------KEEERKDAKV-----SGIELLSFSIAEEIGR-------KNIKVVNPPKPNDIFTICYTSGTTGTPKGAVQTHSNVIADVSG---VIRQYNTCGIDVHFSYLPLAHAYERTGVICMLQSGCRIGFYRGDPQLLFEDIQE---------LKPTFFASVPRIMNKVYDKVMAQVS-ESKFKSWMFQKGLHAKKADMNKNVFRSNTIWDKVVFKKVQMLFGGRVRAITSGAAPLSPKVMTFFRCAMGDCRIMEGYGQTECTACASLQLPQDMQAGIVGPPLTCNYIKLVDVPEKSYSTKDL---KGEVCIKGPNVIPRYHKNPEKTAETL--DEDG--WLHTGDIGMWLENGALKIIDRKKDIFKLAQGEYVAPGKLENIAQRSPFVAQAFVHGESLKTFVVAILVPDGEVLKKWAAQKNI---QGDLKTLCEKEEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFSVENDLMTATFKIKRPQIIKAFHDVIESLYHEVETK 667          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO46335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC0])

HSP 1 Score: 264.233 bits (674), Expect = 7.087e-78
Identity = 183/615 (29.76%), Postives = 304/615 (49.43%), Query Frame = 1
Query:  400 GKYYWETFKETDERINNVAKAMINLGL--VPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVE---EEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            G Y W T+ E   R +NV   +  LG   V     + +Y+  + EW+++ QA      +IT LY TLG +A    IN+++ S++      +P +      CP +K I+    KI  D  + E +E +        + + +++ S +E +G     E  K L   P  D LAV+ YTSG+TG PKG  IT  N VA +AG+  ++ K  +    ++++ISYLPLAH+ E + +L++   G K+G+             +         L+PT+ + VP +L R+   V  +++        +F  A  +K+  + R     +   D +VF +I+                               +++GYG TET A  +I  + D   GH GPP+   +IKL D  +  Y  +D    +GE+   G NV  GY   PEKT E    DE G  W  +GD+G  +++G L ++DRKK + KL  GEY++  K+E    + P+V  V VY DS +S  +  + P++  L +  EK  +     D+E LC ++K+  A+ +++S +  ++K+  F+  + ++L P P+T D+GL+T  LK KR  I+  F+D  ++ Y+
Sbjct:  104 GPYEWLTYNEVLNRASNVGSGLQELGSNDVEGDTFIGVYASNKIEWVLIEQACAMHAKVITPLYDTLGPDACAFIINQAKMSMVVCDAAKIPLLLQRADQCPTLKFII----KINPDVTSEEKQEGER-------NGIKIISFSDVEAMGKAHPYE--KKL---PKPDDLAVVCYTSGTTGNPKGAMITHSNAVAMLAGLCVMIKKCGIRVDNDDVHISYLPLAHMYERLAQLMIFMYGGKVGFFGGNIRKIMEDLQE---------LKPTVFISVPRVLNRVYDKVMKEISSSSIKKF-VFNTALSFKKAEVERNIVRKNSIWDYLVFNKIQ-------------------------------VLEGYGQTETTAAATIQLVGDHTFGHVGPPMPCTKIKLVDVPDMNYFAKDG---KGEICFYGPNVFKGYLHDPEKTREAI--DEDG--WLHSGDVGEWTENGTLKLIDRKKHIFKLAQGEYIAPEKIEAVYMQCPLVHQVFVYGDSRKSCIVGVVVPEETALKKWTEKNEV---QGDMEALCNNEKVRKAILEEMSAMGKKEKLFSFQQVKDIYLHPDPFTVDNGLLTPTLKFKRPVIQAHFKDTFEKLYD 651          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO45504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR2])

HSP 1 Score: 247.669 bits (631), Expect = 4.743e-72
Identity = 177/610 (29.02%), Postives = 306/610 (50.16%), Query Frame = 1
Query:  406 YYWETFKETDERINNVAKAMINLGLVPTKDKVV-IYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVE---EEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVN-ICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            Y W T+ +  ER +N    +  LG  P+++  V ++S    EW++   A    +++   +Y + G EA  + IN+++ S I    + +  +       P +K+I+ +         A E+   K  I       + +++  ++E IG  +  E    +  +P +D+   I +TSG+TG PKGV +T  NI++ M+    ++ +   E   ++ ++SYLP  H+ E   ++L++  G K+G              +     D   LRPT+   VP    R+  A++DKV     + L      + + R+ + +       DR+VF++I+ L+GG V+ +  G APLS    +F+  +  C + +GYG TET A  ++  + D  TGH G P+    +KL D  E  Y   +    +GE+ I G NV  GY    E+TEE F  D SG  WF +GDIG  ++DG L I+DRKK + KL  GEY++  K++ A  +S  V  V V+ +S +SF +  + P  + LI  A+   I+    D++ LC+++ +  A+  D+     E K+   E  + ++L P+ +T + GL+T  LK KR  +   F++ ++  Y
Sbjct:   49 YKWATYSQIHERASNFGSGLCELGCDPSQETFVGLWSTNCTEWLLADLACQMFSMVTVPIYDSHGSEACTYIINKAKLSTIVCHKKKVNFLLEHAHLLPTLKSIIVIS-------GAGEVRRDKSDILG-----IRIISFDEVEKIGINNPHE---KVPARP-EDTF-TISWTSGTTGFPKGVILTHDNIISDMSAYLFLIKQDGEELTPQDTHLSYLPPEHMYERCTQVLMMMAGAKIG---------LYHGKREFLMDDFKALRPTVFAAVP----RLLNAIYDKVVPLRRYSLFAGNTFFFHARRIIRK---DTIWDRLVFKKIQDLIGGNVRIITCGSAPLSARVTSFIRCVMGCYLNEGYGSTETTAMVTMQRLKDFNTGHVGAPVPCATVKLVDVPEMDYYASNN---QGEICIRGRNVFKGYLHDAERTEEAF--DSSG--WFYSGDIGEWTQDGTLRIIDRKKHIFKLSQGEYIAPAKIQNAYLRSMFVAQVFVHGNSLKSFIVAVVVPDAEVLIPWAKTHDIE---GDIKQLCQNQTVRKAIHGDMIAKGKEAKLNSLEQVKGIYLHPELFTVEEGLLTPTLKTKRPALAQFFEEKLNVLY 615          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO46361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG4])

HSP 1 Score: 215.698 bits (548), Expect = 3.295e-61
Identity = 143/454 (31.50%), Postives = 239/454 (52.64%), Query Frame = 1
Query:  886 PTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAG----MKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVN-ICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQG--GEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            P  D L  + YTSG+TG PKG  +T  N+++ ++     +K V+ ++   +++++S+LPL+H+ E V ++++   G K+G+ +             K   D   LRPT+   VP +L RI   V +++ ++      +F+ A + K++ L R         D ++F +I+ LLGGRV F++SG APLS +   F+  +  C + +GYG TET A  ++  + D   GH GPP     +KL D  E  Y   +K   +GE+ + G NV  GY   P  T E   +D    RW  TGDIG  +  G   +  R++    +QG  GEY++  K+E    +SP V  + V+ DS  SF +  + P  + L   AEK GI     DL+ LC++K +   + + + ++  E ++   E  + + L  + ++ D+GL+T  LK+KR ++   F+D+ID  Y
Sbjct:  108 PKSDDLYTVCYTSGTTGTPKGAMLTHDNVISDLSAFLYVLKQVIIRYFGVDDVHLSFLPLSHMYERVNQIVIFMNGGKIGFFN---------GDIKKLLDDFKTLRPTVFGAVPRLLNRIHDKVTNEI-NKSWIKRWIFQIALNAKKRDLARKIVRRDTIWDYLIFNKIQALLGGRVWFIISGSAPLSPKVATFIRCVMGCQVQEGYGQTETVASVTLQLLDDFTAGHVGPPTPVNVVKLVDVPEMDYWANNK---QGEICVKGRNVFKGYLHNPAMTAEVLDKD----RWLYTGDIGEWTTVGTRRLYTRERGAC-IQGNEGEYIAPQKIENIYLRSPFVAQIYVHGDSIRSFLVAVVVPDAEVLEAWAEKKGI---RGDLKRLCQNKTVHQRIFESMVKVGEESQLNSLEKVRGIHLCSEAFSIDNGLLTPTLKIKRPQMSTFFRDIIDNLY 540          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl4a (acyl-CoA synthetase long chain family member 4 [Source:NCBI gene;Acc:101166395])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 313/674 (46.44%), Postives = 438/674 (64.99%), Query Frame = 1
Query:  208 SPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
             P+R+V   D LA    PG +TL  L+  A   +  +  LGTRE++S + ETQ NG+ FKKL LG+Y W ++ E +  +N     +  LG  P K  + I+ ET+AEWMI AQA F+ N  + T YATLGEEAI +G+NE+  + + TS ELL  K+ +V+   P +K ++++D+K +   NA              P  +++ ++  + ++G     E +K     P    LAV+MYTSGSTG PKGV I   N++A M G  + +P     ++ YI+YLPLAHV+E+  E+  VT G ++GYSSP TL+D S++IK  +KGD SVL+PTLM  VP I++RI K V  KV +       LF   Y YK +++ +GY +   +R++F ++KKLLGG V+ MLSGGAPLS + Q F+N+CFC P+ QGYGLTETC  G+I  + D+ TG  G P+   +I+LRDWAEGGY+ +D P PRGE+LIGG NV  GY++  E  ++ FF+DE G RWFCTGDIG +  DGCL IVDRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S ++F I F+ P QK+L  LA++ GI+ +    E LC   ++   V K I+ + ++ K++RFEIP KV L P+PWTP++GLVTDA KLKR+E+K  + D I+R Y 
Sbjct:   23 GPYRSVDHFDSLAAEDFPGKDTLDKLFRHAVERFGPDPCLGTREILSEENETQSNGKVFKKLILGEYTWLSYNEVESIVNEFGSGLAALGQQP-KSTIAIFCETRAEWMITAQACFRRNFPLVTFYATLGEEAIAYGLNETGITHLITSMELLDSKLKNVLPQIPSLKHVIYVDEKKY---NA-----------EGFPEGISIRSMEAVRELG--KLPENMKKPIETPEPSDLAVVMYTSGSTGRPKGVMIVHSNLIAGMTGQCERIPDLG-PKDTYIAYLPLAHVLEMTAEISCVTYGCRIGYSSPQTLSDQSTRIKKGSKGDCSVLKPTLMAAVPEIMDRINKNVMSKVQEMSYIQRTLFTLGYKYKLEQVKKGYDAPVCNRLLFGKVKKLLGGNVRMMLSGGAPLSSDTQRFMNVCFCCPVGQGYGLTETCGAGTITEVADISTGRVGAPLVCCEIRLRDWAEGGYTTKDTPNPRGEILIGGPNVTTGYFRH-EGNDDDFFQDEKGQRWFCTGDIGEVHPDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKTCPLVDNICAYANSEQNFVISFVVPNQKKLTDLAKEKGIEGT---FEELCVHPEMEKEVLKRITDVALKIKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYSDHIERMYG 674          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl4a (acyl-CoA synthetase long chain family member 4 [Source:NCBI gene;Acc:101166395])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 313/674 (46.44%), Postives = 438/674 (64.99%), Query Frame = 1
Query:  208 SPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
             P+R+V   D LA    PG +TL  L+  A   +  +  LGTRE++S + ETQ NG+ FKKL LG+Y W ++ E +  +N     +  LG  P K  + I+ ET+AEWMI AQA F+ N  + T YATLGEEAI +G+NE+  + + TS ELL  K+ +V+   P +K ++++D+K +   NA              P  +++ ++  + ++G     E +K     P    LAV+MYTSGSTG PKGV I   N++A M G  + +P     ++ YI+YLPLAHV+E+  E+  VT G ++GYSSP TL+D S++IK  +KGD SVL+PTLM  VP I++RI K V  KV +       LF   Y YK +++ +GY +   +R++F ++KKLLGG V+ MLSGGAPLS + Q F+N+CFC P+ QGYGLTETC  G+I  + D+ TG  G P+   +I+LRDWAEGGY+ +D P PRGE+LIGG NV  GY++  E  ++ FF+DE G RWFCTGDIG +  DGCL IVDRKKDLVKLQ GEYVSLGKVE A+   P+V+++C YA+S ++F I F+ P QK+L  LA++ GI+ +    E LC   ++   V K I+ + ++ K++RFEIP KV L P+PWTP++GLVTDA KLKR+E+K  + D I+R Y 
Sbjct:   23 GPYRSVDHFDSLAAEDFPGKDTLDKLFRHAVERFGPDPCLGTREILSEENETQSNGKVFKKLILGEYTWLSYNEVESIVNEFGSGLAALGQQP-KSTIAIFCETRAEWMITAQACFRRNFPLVTFYATLGEEAIAYGLNETGITHLITSMELLDSKLKNVLPQIPSLKHVIYVDEKKY---NA-----------EGFPEGISIRSMEAVRELG--KLPENMKKPIETPEPSDLAVVMYTSGSTGRPKGVMIVHSNLIAGMTGQCERIPDLG-PKDTYIAYLPLAHVLEMTAEISCVTYGCRIGYSSPQTLSDQSTRIKKGSKGDCSVLKPTLMAAVPEIMDRINKNVMSKVQEMSYIQRTLFTLGYKYKLEQVKKGYDAPVCNRLLFGKVKKLLGGNVRMMLSGGAPLSSDTQRFMNVCFCCPVGQGYGLTETCGAGTITEVADISTGRVGAPLVCCEIRLRDWAEGGYTTKDTPNPRGEILIGGPNVTTGYFRH-EGNDDDFFQDEKGQRWFCTGDIGEVHPDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKTCPLVDNICAYANSEQNFVISFVVPNQKKLTDLAKEKGIEGT---FEELCVHPEMEKEVLKRITDVALKIKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYSDHIERMYG 674          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl3b (long-chain-fatty-acid--CoA ligase 3 [Source:NCBI gene;Acc:101172360])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 319/722 (44.18%), Postives = 449/722 (62.19%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDLSS----PWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + L + +  V +Y  ITF  + FF     N  +  A  IK   +S     P+R + + +KL     PG NTL  ++E A   +P  D LGTREV+S + E QPNG+ FKK+ LG Y W +++E           +  L   P  + + I+ ET+AEW++ AQA F  N  + TLYATLG +AI HG+NE+E + I TS +LL  ++ +++   P ++ I+ +DQK                    +P ++ +  +  ++++G  SK E +      P    +AVIMYTSGSTG+PKGV I+  N++A + GM + +P  N E + YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D S+KIK  +KGD SVL+PTLM  VP I++RI K V  KV +   F   LF  AY+YK +++ +GY +   D +VF+R++ LLGG  + +LSGGAPLS   Q F+N+C C P+ QGYGLTETC  G+I  ++D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NVA+GYYK   K +  FF D +G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +   P+++++C YA+S +S+ I F+ P  KQL+ +AE+ GI       E +C + ++   V   I++  I  K+ERFEIP+K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y
Sbjct:   10 VLLQVFRSVVWVYSVITFLPWYFFSGTGSN--LERARRIKAYSVSGHPAGPYRAINSQEKLVALMEPGVNTLDKMFEYAARRFPMRDCLGTREVLSEEDELQPNGKVFKKVILGNYNWLSYEEAYLAAKCFGSGLAALNQRPHCN-IAIFCETRAEWLVAAQACFMYNFPLVTLYATLGLKAIAHGLNETEVTHIITSKDLLQSRLKAILCDVPRLQYIIVVDQKPTS--------------WPDIPKSIKVYNMDAVKEMG--SKPENISADRRHPQPSDIAVIMYTSGSTGIPKGVMISHSNLIAGITGMAERIPNLN-ETDTYIGYLPLAHVLELSAELVSISHGCRIGYSSPHTLADQSTKIKKGSKGDASVLKPTLMASVPEIMDRIYKNVMTKVEEMSRFQKTLFALAYNYKMEQISKGYSTPLCDSLVFKRVRSLLGGNTRVLLSGGAPLSAATQRFMNVCMCCPVGQGYGLTETCGAGTISEVWDYNTGRVGAPLVCSEITLKDWEEGGYYSTDKPNPRGEILIGGPNVAMGYYKYEGKNQGDFFVDANGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNICAYANSDQSYVISFVVPNHKQLMAVAEQMGI---KGTWEEICNNPQMEKEVLCIITEAAISGKLERFEIPKKIRLSAEPWTPETGLVTDAFKLKRKELKTHYQEDIERMY 708          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl3a (acyl-CoA synthetase long chain family member 3 [Source:NCBI gene;Acc:101157383])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 308/674 (45.70%), Postives = 430/674 (63.80%), Query Frame = 1
Query:  208 SPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
             P+R V A   L     PG +TL  ++  A   +P  D LGTREVI  + E Q NG+ FKK+ LG Y W +++E       +   +  LG  P K  + I+ ET+AEW+I AQA F  N  + TLY+TLG  AI HG+NE++ S I TS ELL  ++ +++   P ++ I+ +D                       P+N+++  ++ ++ +GA  ++   +    +P    +AVIMYTSGSTG+PKGV I+  N++AS+ G+ + +P  + E++ YI YLPLAHV+EL  E + +  G ++GYSSP TL D S+KIK  +KGD S+L+PTLM  VP I++RI K V  KV +       LF  AY+YK  +L +G  +   DR+VFR+++ LLGGR + +LSGGAPLS   Q F+N+C C P+ QGYGLTETC  G+I  ++D  TG  G P+   +IKL+DW EGGY   DKP+PRGE+LIGG NV +GYYK   K +E FF DE+G RWFCTGDIG +  DGCL I+DRKKDLVKLQ GEYVSLGKVE A+   P+V+++CVYA S E++ I F+ P Q+QL+ LA + GI  S    E LC  + I + V K I++  +  ++ERFEIP+K+ L   PWTP++GLVTDA KLKR+E+K  +++ I+R Y 
Sbjct:   65 GPYRAVCASKSLVAVMRPGVDTLDKIFAYAATQFPHRDCLGTREVICEEDERQSNGKVFKKVVLGGYRWLSYQEAINAATQLGGGLAQLGQRP-KTNIAIFCETRAEWLIAAQACFAYNFPLVTLYSTLGGPAIAHGLNETQVSHIITSKELLETRLKAILPEVPRLQHIIVVDNT--------------PTTWPGYPANISIHNMAAVQRLGAMPENTACER--KQPLPSDIAVIMYTSGSTGVPKGVMISHSNVIASITGIAEKIPNLS-EDDTYIGYLPLAHVLELCAEHVCIAHGCRIGYSSPQTLADQSTKIKKGSKGDASILQPTLMAAVPEIMDRIYKNVMGKVEEMNSIQRTLFILAYNYKLDQLAKGRSTPLCDRLVFRKVRALLGGRTRVLLSGGAPLSAATQRFMNVCLCCPVGQGYGLTETCGAGTICELWDYSTGRVGGPLVCCEIKLKDWTEGGYRSTDKPHPRGEILIGGPNVTMGYYKSNAKQQEDFFVDENGQRWFCTGDIGEVHGDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLVDNICVYASSDETYVIGFMVPNQRQLLALAGQYGIRGSR---EELCNSRAIEELVLKAITEAALTAQLERFEIPRKIRLSSDPWTPETGLVTDAFKLKRKELKTHYKEDIERMYG 717          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl3b (long-chain-fatty-acid--CoA ligase 3 [Source:NCBI gene;Acc:101172360])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 312/726 (42.98%), Postives = 448/726 (61.71%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDLSS----PWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELL-PKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQ----GNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFC-PIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFY 2220
            + L + +  V +Y  ITF  + FF     N  +  A  IK   +S     P+R + + +KL     PG NTL  ++E A   +P  D LGTREV+S + E QPNG+ FKK+ LG Y W +++E           +  L   P  + + I+ ET+AEW++ AQA F  N  + TLYATLG +AI HG+NE+E + I TS +LL  ++ +++   P ++ I+ +DQK     +              +P ++ +  +  ++++G++ ++   ++    P    +AVIMYTSGSTG+PKGV I+       ++ S + +  V    N+  + YI YLPLAHV+EL  EL+ ++ G ++GYSSP TL D S+KIK  +KGD SVL+PTLM  VP I++RI K V  KV +   F   LF  AY+YK +++ +GY +   D +VF+R++ LLGG  + +LSGGAPLS   Q F+N+C C P+ QGYGLTETC  G+I  ++D  TG  G P+   +I L+DW EGGY   DKP PRGE+LIGG NVA+GYYK   K +  FF D +G RWFCTGDIG    DGCL I+DRKKDLVKLQ GEYVSLGKVE  +   P+++++C YA+S +S+ I F+ P  KQL+ +AE+ GI       E +C + ++   V   I++  I  K+ERFEIP+K+ L  +PWTP++GLVTDA KLKR+E+K  +Q+ I+R Y
Sbjct:   10 VLLQVFRSVVWVYSVITFLPWYFFSGTGSN--LERARRIKAYSVSGHPAGPYRAINSQEKLVALMEPGVNTLDKMFEYAARRFPMRDCLGTREVLSEEDELQPNGKVFKKVILGNYNWLSYEEAYLAAKCFGSGLAALNQRPHCN-IAIFCETRAEWLVAAQACFMYNFPLVTLYATLGLKAIAHGLNETEVTHIITSKDLLQSRLKAILCDVPRLQYIIVVDQKPTSWPD--------------IPKSIKVYNMDAVKEMGSKPENTDRRH----PQPSDIAVIMYTSGSTGIPKGVMISHMCSFHFVLISQSSLTTVFIP-NIHTDTYIGYLPLAHVLELSAELVSISHGCRIGYSSPHTLADQSTKIKKGSKGDASVLKPTLMASVPEIMDRIYKNVMTKVEEMSRFQKTLFALAYNYKMEQISKGYSTPLCDSLVFKRVRSLLGGNTRVLLSGGAPLSAATQRFMNVCMCCPVGQGYGLTETCGAGTISEVWDYNTGRVGAPLVCSEITLKDWEEGGYYSTDKPNPRGEILIGGPNVAMGYYKYEGKNQGDFFVDANGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNICAYANSDQSYVISFVVPNHKQLMAVAEQMGI---KGTWEEICNNPQMEKEVLCIITEAAISGKLERFEIPKKIRLSAEPWTPETGLVTDAFKLKRKELKTHYQEDIERMY 710          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000081754.1 (SMESG000081754.1)

HSP 1 Score: 1463.36 bits (3787), Expect = 0.000e+0
Identity = 735/735 (100.00%), Postives = 735/735 (100.00%), Query Frame = 1
Query:   52 MSSLSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKSKKMNGDL 2256
            MSSLSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPLTLTDTSSKIKSKTKGDISVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKSKKMNGDL
Sbjct:    1 MSSLSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPLTLTDTSSKIKSKTKGDISVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNREKSKKMNGDL 735          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000060741.1 (SMESG000060741.1)

HSP 1 Score: 424.091 bits (1089), Expect = 4.103e-143
Identity = 199/315 (63.17%), Postives = 248/315 (78.73%), Query Frame = 1
Query: 1285 LFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 2229
            +F+WAY+YK  R+ RGYPSVFMD++VF +IKKLLGG+V++MLSGGAPLSEEAQNF+NICFCPI+QGYGLTETC  G++M   D R    G P+ +LQI++R+W EG YSP D+P PRGE+LIGG  V LGY+KQP+KT+E FF D+ G RWFCTGDIG+   DG LSI+DRKKDLVKLQGGEY+SL KVELAISK P VE+ CVYA+SSE F ICFISPK KQL+Q+AEK  I+    D++ +CK K++  A+ K++ + C+EK +ER EIP KV +D   WTPD+GLVTDALKLKR+ I+ +F   I   YNR 
Sbjct:    1 MFRWAYEYKMNRMDRGYPSVFMDKLVFAKIKKLLGGKVRYMLSGGAPLSEEAQNFINICFCPIIQGYGLTETCGAGTLMVDGDRRVNQVGIPLNALQIQIREWKEGNYSPLDQPKPRGEILIGGECVTLGYFKQPDKTKEDFFVDKDGMRWFCTGDIGVFHSDGSLSIIDRKKDLVKLQGGEYISLAKVELAISKCPFVETACVYAESSEDFVICFISPKHKQLLQIAEKMNIE--EKDIQKICKIKEVNSALLKELQKACLEKGLERVEIPHKVHIDYLQWTPDTGLVTDALKLKRKNIQERFIVEIKDMYNRH 313          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000060730.1 (SMESG000060730.1)

HSP 1 Score: 299.671 bits (766), Expect = 1.287e-94
Identity = 151/338 (44.67%), Postives = 220/338 (65.09%), Query Frame = 1
Query:   73 IFLNILKLWVLIYEFITFPFYIFFKDK-------SENEI--VVSAVPIKDNDLSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISSDFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGA---ESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAGMKDVLPKFNVEEEIYISYLP 1050
            I +N LKLW  +YEF T+PFY  F+ K       S N     V A PI+++D   PWRN+ + + L  T +PGCNTL  L  RA  LWP+  ALGTR+++ S+ E QPN + FKKLT  KYYWET+ + D RI N  + ++ L + P+  +++I++ET++EWMI AQ  F+ NI I TLY+TLG+EAIVHGI ESEA+++ TS EL+PK+  +I  C  +K I+FM+  IF+     + ++L    ++ +P  +TL  +  +E++G+      +E L +   KPT+DSLA+IMYTSGST  PKGV +T GN++ +MAG  + LP  + +++ YI YLP
Sbjct:    7 ITVNALKLWTYVYEFFTWPFYYIFQSKCTLSSINSNNNCDGRVLAKPIQNDDPQEPWRNINSFNGLVNTMIPGCNTLDDLMIRAANLWPNKSALGTRKLVKSEMEPQPNKKLFKKLTFEKYYWETYSDIDTRITNFGRGLLKLKMKPSVSRILIFAETRSEWMIAAQTCFRYNIPIITLYSTLGDEAIVHGIIESEATVVITSEELMPKLCKIIEKCHSVKHIIFMNNYIFEGFGGNKAQDLITTFENVVPDGITLHEMGSVENMGSLKDYGDEESLDSYLYKPTRDSLAMIMYTSGSTDKPKGVMMTHGNLMTAMAGQFEGLPPIHRDDK-YIGYLP 343          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000024739.1 (SMESG000024739.1)

HSP 1 Score: 211.075 bits (536), Expect = 3.424e-58
Identity = 178/622 (28.62%), Postives = 293/622 (47.11%), Query Frame = 1
Query:  394 TLGKYYWETFKETDERINNVAKAMINL-----GLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYT-SHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAG---MKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFV-NICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            +   Y+W T+ E DE        +I L     GL     KV I+ +   EW+ V Q   + ++++  LY T GE++  + IN  +  +I+  +++ +  + +  +S P +K IV ++  I KD+  ++   LK             +   K  DI A  K+  +      P     + I++TSG+TG+PKG  IT  ++++S+       DV+ KF  ++EI++S+LPL HV E +   L+     K+ + S                 ++ +++PT++  VP IL RI   V   +  Q P    +F      K K + RG    +   D I+FR+I+ +LGG V+ ++ G AP+S +  NF  ++    +++GYG TET    ++    D   GH G P+    IKL D  E           RGEV + G      Y+   E + +    D  G  W  TGDIG+ ++ G L IVDR K + KL  GEY++  ++E   S SP+V  + V  DS + F +  + P       L     +D     +E +C D    + + +D+S +  + K+  FEI ++  L     +P++GL+T  LKLKR E    F   I   Y 
Sbjct:  102 SAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGL---NTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLND-IGKDK--VQEASLKG------------VQFFKFSDILATGKNNPIP--LQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVI-KFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFS---------GEIRLLAEEMKIIKPTILFAVPRILNRIYDKVM-PIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDC--RGEVCVKGRMCISEYFGDREMSSKLI--DSDG--WLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIP------DLDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKILYQ 680          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 158.688 bits (400), Expect = 1.250e-40
Identity = 173/627 (27.59%), Postives = 293/627 (46.73%), Query Frame = 1
Query:  436 ERINNVAKAMINLGLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYTSHE-LLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSN-KPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASM-AGMKDVLPKFNVEEEIYISYLPLAHVMELVCELL-LVTMGIKLGYSSPXXXXXXXXXXXXXXXXXXXVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDY-KRKRLGR--GYP---SVFMDR-IVFRRIKKLLG-GRVQFMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYD-LRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAI-SKSPVVESVCVYADSSESFSICFISPK-------QKQLIQLA-------EKCGIDCSSNDLEVLCKD---KKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYN 2223
            E I   A   I LGL   K  V I       W I       +  II  +Y T   +     +N+    +I   ++  L KI S++   P +K I+    K   D +A    ELK K    + +    M L++     A+S DE+ + LS  +P  D  A+++YTSG+TG PKGV ++  N++ ++   M+ V  K    +   ISYLPL+H+   + +++  V++G+ + ++ P  L  +  K   +       +RPT+ + VP + E+I + + +  +  G     +  WA +   R  L +  G P   S F+ + +VF +IK+ LG  R  ++ S  APL++++ ++      PI Q YGL+E C G   M + D +R G  G  +  +++K+ +  E         +  GE+ I G +V LGYY   EKT+E    D  G  W  +GD+G +  +  L I  R K+L+   GGE ++   +E  I  + P + SV +  D  + F  C ++ K       Q+   QL        +  GI+  + +  + CKD   KK ID   K ++  C    + R    QK  L P+ ++   G +   +K+KR  I   + +++   Y+
Sbjct:    6 ELIQKAASNFIKLGL-DVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAII----KYTGDVSA----ELKTKYSISIYTWTEFMNLNQ-----ADSADELDRRLSEIQP--DDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV--KIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKE-------VRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSE-CTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE---------HNIGEICIRGRHVFLGYYNNMEKTKESI--DSDG--WLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGD-RQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNS-C---SVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 588          
The following BLAST results are available for this feature:
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSL30.000e+045.57acyl-CoA synthetase long chain family member 3 [So... [more]
ACSL30.000e+045.57acyl-CoA synthetase long chain family member 3 [So... [more]
ACSL40.000e+045.15acyl-CoA synthetase long chain family member 4 [So... [more]
ACSL40.000e+045.15acyl-CoA synthetase long chain family member 4 [So... [more]
ACSL40.000e+045.15acyl-CoA synthetase long chain family member 4 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-170.000e+044.31Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-170.000e+044.31Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-170.000e+044.31Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-40.000e+043.47Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-56.367e-7931.40Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsl1.900e-17541.45gene:FBgn0263120 transcript:FBtr0088701[more]
Acsl1.900e-17541.45gene:FBgn0263120 transcript:FBtr0100428[more]
Acsl1.900e-17541.45gene:FBgn0263120 transcript:FBtr0100431[more]
Acsl1.900e-17541.45gene:FBgn0263120 transcript:FBtr0100429[more]
Acsl2.779e-17541.45gene:FBgn0263120 transcript:FBtr0088700[more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl3b0.000e+045.28acyl-CoA synthetase long chain family member 3b [S... [more]
acsl3b0.000e+045.28acyl-CoA synthetase long chain family member 3b [S... [more]
acsl3b0.000e+045.28acyl-CoA synthetase long chain family member 3b [S... [more]
acsl3a0.000e+044.37acyl-CoA synthetase long chain family member 3a [S... [more]
acsl3a0.000e+044.37acyl-CoA synthetase long chain family member 3a [S... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl30.000e+046.22acyl-CoA synthetase long chain family member 3 [So... [more]
acsl30.000e+046.14acyl-CoA synthetase long chain family member 3 [So... [more]
acsl30.000e+043.67acyl-CoA synthetase long chain family member 3 [So... [more]
acsl32.276e-17944.01acyl-CoA synthetase long chain family member 3 [So... [more]
acsl31.482e-17747.59acyl-CoA synthetase long chain family member 3 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsl40.000e+045.57acyl-CoA synthetase long-chain family member 4 [So... [more]
Acsl40.000e+045.57acyl-CoA synthetase long-chain family member 4 [So... [more]
Acsl30.000e+045.29acyl-CoA synthetase long-chain family member 3 [So... [more]
Acsl30.000e+045.29acyl-CoA synthetase long-chain family member 3 [So... [more]
Acsl40.000e+046.72acyl-CoA synthetase long-chain family member 4 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QUJ7|ACSL4_MOUSE0.000e+045.57Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculu... [more]
sp|O95573|ACSL3_HUMAN0.000e+045.57Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapien... [more]
sp|O35547|ACSL4_RAT0.000e+045.21Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norv... [more]
sp|Q63151|ACSL3_RAT0.000e+045.57Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norv... [more]
sp|O60488|ACSL4_HUMAN0.000e+045.15Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapien... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SHM80.000e+046.66AMP-binding domain-containing protein OS=Hymenolep... [more]
A0A504YR830.000e+045.69Long-chain-fatty-acid--CoA ligase OS=Fasciola giga... [more]
A0A158REW40.000e+045.78AMP-binding domain-containing protein OS=Hydatigen... [more]
A0A068XW800.000e+045.21Long chain fatty acid coenzyme A ligase 4 OS=Echin... [more]
A0A068X2B80.000e+045.21Long chain fatty acid coenzyme A ligase 4 OS=Echin... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSL30.000e+044.88long-chain-fatty-acid--CoA ligase 3 [Source:NCBI g... [more]
acsl4a0.000e+044.43acyl-CoA synthetase long chain family member 4 [So... [more]
acsl3a0.000e+044.87acyl-CoA synthetase long chain family member 3a [S... [more]
acsl4b1.409e-17443.24acyl-CoA synthetase long chain family member 4b [S... [more]
acsl53.802e-7930.25acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSL16.077e-8331.14acyl-CoA synthetase long chain family member 1 [So... [more]
acsl3b7.928e-7046.69acyl-CoA synthetase long chain family member 3b [S... [more]
ACSL11.189e-6332.98acyl-CoA synthetase long chain family member 1 [So... [more]
acsbg21.032e-3222.98acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ENSPMAT00000005646.12.894e-930.63pep scaffold:Pmarinus_7.0:GL484188:1842:9754:1 gen... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FAA13.980e-9931.32Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA48.742e-8729.52Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA34.937e-8631.54Long chain fatty acyl-CoA synthetase; activates im... [more]
FAA22.655e-5226.81Medium chain fatty acyl-CoA synthetase; activates ... [more]
PCS605.441e-725.76Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298790.000e+045.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454613.245e-8531.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463357.087e-7829.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455044.743e-7229.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463613.295e-6131.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl4a0.000e+046.44acyl-CoA synthetase long chain family member 4 [So... [more]
acsl4a0.000e+046.44acyl-CoA synthetase long chain family member 4 [So... [more]
acsl3b0.000e+044.18long-chain-fatty-acid--CoA ligase 3 [Source:NCBI g... [more]
acsl3a0.000e+045.70acyl-CoA synthetase long chain family member 3 [So... [more]
acsl3b0.000e+042.98long-chain-fatty-acid--CoA ligase 3 [Source:NCBI g... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081754.10.000e+0100.00SMESG000081754.1[more]
SMESG000060741.14.103e-14363.17SMESG000060741.1[more]
SMESG000060730.11.287e-9444.67SMESG000060730.1[more]
SMESG000024739.13.424e-5828.62SMESG000024739.1[more]
SMESG000027204.11.250e-4027.59SMESG000027204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011604 ID=SMED30011604|Name=Long-chain-fatty-acid--CoA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=2395bp
TGTCGTGCGACTCATTGTTTATAATTTTAAACAAATTATTTTTTATTCGC
TATGTCTTCTCTATCTACTTTTATTTTTCTAAACATTCTTAAGTTATGGG
TGTTGATTTACGAATTCATAACATTTCCTTTCTATATATTTTTTAAAGAT
AAATCTGAAAATGAAATCGTGGTTAGTGCAGTTCCAATAAAAGATAATGA
TTTATCTAGTCCTTGGCGCAATGTTAAAGCTTTGGATAAGCTTGCAACGA
CTCCTGTTCCAGGTTGTAATACTTTAGTTTCATTATGGGAAAGAGCTACT
ATTCTCTGGCCCGACAATGATGCCCTTGGAACACGCGAAGTTATATCTTC
GGATTTCGAAACGCAACCAAATGGGAGGCAATTTAAAAAACTAACGCTTG
GAAAGTATTATTGGGAAACCTTTAAAGAAACTGATGAACGAATAAATAAT
GTTGCAAAAGCAATGATTAATTTAGGCTTAGTTCCTACCAAGGATAAAGT
TGTAATATATTCTGAAACACAAGCTGAGTGGATGATTGTTGCCCAAGCTT
CTTTCAAAAGTAATATCATAATAACTACACTTTATGCAACCCTTGGAGAA
GAAGCCATTGTTCATGGGATTAATGAATCTGAAGCTTCACTAATTTACAC
GAGTCATGAATTGCTACCTAAAATAGCATCAGTAATAACTAGCTGTCCAT
TGATAAAAACCATCGTTTTCATGGATCAAAAAATATTCAAAGATCGCAAT
GCCATGGAAATGGAAGAATTGAAACATAAAATCAAAAGCAAATTGCCTTC
CAACGTAACTTTAATGACTTTGTCAAAATTAGAGGATATTGGAGCTGAAA
GCAAAGATGAAATTTTGAAAAATCTTTCTAATAAACCCACTAAAGATAGT
TTGGCCGTTATAATGTACACAAGTGGATCAACTGGCTTACCAAAGGGTGT
TAAAATTACTCAAGGAAATATCGTTGCATCAATGGCTGGCATGAAGGATG
TTCTTCCTAAATTCAATGTAGAAGAGGAAATTTATATAAGTTATTTACCA
TTGGCTCATGTGATGGAATTGGTTTGCGAATTATTGCTTGTTACAATGGG
AATTAAATTGGGATATTCGAGTCCATTGACTCTCACTGATACATCATCGA
AAATAAAATCTAAAACAAAAGGAGACATATCAGTATTAAGACCAACTTTA
ATGGTTTGCGTTCCAACTATTCTTGAGCGAATTACTAAAGCAGTATGGGA
TAAAGTTACAGACCAAGGTCCATTCTTCTTGGAGTTATTTAAATGGGCTT
ATGATTACAAAAGAAAACGCCTTGGTAGAGGATATCCAAGTGTATTCATG
GATAGAATTGTATTTAGACGAATAAAAAAATTACTTGGCGGTCGAGTTCA
GTTTATGCTGAGTGGAGGCGCACCTTTAAGTGAAGAGGCTCAAAACTTTG
TCAATATTTGTTTCTGCCCGATAGTTCAAGGATATGGTTTAACGGAAACT
TGTGCTGGTGGTTCAATCATGAATATGTATGATTTAAGAACTGGTCATGG
TGGACCACCGATTACTAGCTTGCAAATAAAATTGAGAGACTGGGCGGAAG
GTGGTTATTCCCCCCAAGATAAACCATATCCCAGAGGAGAAGTTTTGATT
GGTGGAGGAAATGTTGCTTTAGGTTATTATAAGCAGCCCGAGAAAACCGA
AGAATGTTTTTTTGAAGATGAAAGCGGAACTCGGTGGTTTTGTACAGGAG
ACATTGGAATGATTTCTAAAGATGGGTGCTTATCAATTGTTGATAGGAAG
AAGGATCTTGTGAAACTTCAGGGTGGCGAATATGTTTCCCTGGGAAAAGT
CGAATTAGCCATATCAAAATCTCCTGTTGTTGAATCTGTATGTGTATATG
CCGACAGCTCAGAATCATTTTCGATTTGTTTTATTTCCCCCAAGCAAAAG
CAACTTATTCAACTTGCAGAAAAATGTGGTATCGATTGTTCAAGTAATGA
TTTGGAAGTCTTGTGTAAAGATAAAAAGATTATTGATGCTGTTACAAAAG
ATATCAGTCAAATTTGCATTGAAAAGAAAATTGAAAGATTTGAAATTCCT
CAGAAAGTATTTTTGGACCCAAAACCATGGACCCCTGATAGTGGTCTGGT
GACAGATGCATTGAAATTAAAGCGCAGAGAAATAAAATATAAATTTCAAG
ATGTTATAGATAGATTCTATAATAGAGAGAAATCGAAGAAAATGAACGGT
GATTTATAAATGTAAAAAATCATCTTTTTAGTGTTTTTTGTTTCATATGA
GAATGTAGAGTATCTCTAGTGAACATTGTTTTTTTCTGTTAATATTTTGT
TCAACATATATATTTCTCTTGGATTGATATACAGTCATTTCATAT
back to top

protein sequence of SMED30011604-orf-1

>SMED30011604-orf-1 ID=SMED30011604-orf-1|Name=SMED30011604-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=736bp
MSSLSTFIFLNILKLWVLIYEFITFPFYIFFKDKSENEIVVSAVPIKDND
LSSPWRNVKALDKLATTPVPGCNTLVSLWERATILWPDNDALGTREVISS
DFETQPNGRQFKKLTLGKYYWETFKETDERINNVAKAMINLGLVPTKDKV
VIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYT
SHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPS
NVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGV
KITQGNIVASMAGMKDVLPKFNVEEEIYISYLPLAHVMELVCELLLVTMG
IKLGYSSPLTLTDTSSKIKSKTKGDISVLRPTLMVCVPTILERITKAVWD
KVTDQGPFFLELFKWAYDYKRKRLGRGYPSVFMDRIVFRRIKKLLGGRVQ
FMLSGGAPLSEEAQNFVNICFCPIVQGYGLTETCAGGSIMNMYDLRTGHG
GPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTE
ECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKV
ELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSND
LEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLV
TDALKLKRREIKYKFQDVIDRFYNREKSKKMNGDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004467long-chain fatty acid-CoA ligase activity
GO:0016874ligase activity
GO:0102391decanoate--CoA ligase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0001676long-chain fatty acid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 116..590
e-value: 3.0E-96
score: 322.6
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 427..587
e-value: 4.5E-31
score: 109.8
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 98..407
e-value: 1.2E-43
score: 151.4
NoneNo IPR availablePANTHERPTHR43272:SF5ACYL-COA SYNTHETASE LONG-CHAIN, ISOFORM Jcoord: 19..717
NoneNo IPR availablePANTHERPTHR43272FAMILY NOT NAMEDcoord: 19..717
NoneNo IPR availableCDDcd17639LC_FACS_euk1coord: 117..711
e-value: 0.0
score: 656.21
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 55..726
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 287..298