Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30011601
Length (bp)3023
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30011601) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30011601) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30011601) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30011601) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011601

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011601SMESG000008616.1 dd_Smed_v4_7892_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011601SMESG000008616.1 dd_Smed_v4_7892_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011601SMESG000008616.1 dd_Smed_v4_7892_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.186e-19
Identity = 40/115 (34.78%), Postives = 69/115 (60.00%), Query Frame = 2
Query: 1145 KKLCSLFNKRYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            K   SL + R     +  +G +IRSKI   ++++  +S+++D T D++H+E +S ++RYV      ++ + + F+    +E +TG EL N +I LL+ N L ++NIRGQ YD  A
Sbjct:  369 KPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYV-----RDMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAA 478          

HSP 2 Score: 30.0314 bits (66), Expect = 1.186e-19
Identity = 11/29 (37.93%), Postives = 20/29 (68.97%), Query Frame = 1
Query: 1048 DSVYEENNGNFLKILEFLGEFDPVMEKHL 1134
            +S    N GNF+++++ L ++D VM+ HL
Sbjct:  329 ESSSSANQGNFIELVKTLAQYDSVMKLHL 357          

HSP 3 Score: 26.9498 bits (58), Expect = 1.186e-19
Identity = 26/83 (31.33%), Postives = 40/83 (48.19%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVL----QSKCPSMTV---KSLSDTRL---ESHVNAVKTVRLELVKI 1784
            LNL +V    SS     F ++++++Y F + STK+        QS  P   V   + LSDTR    E  + A+  V   L+K+
Sbjct:  508 LNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKL 590          

HSP 4 Score: 21.9422 bits (45), Expect = 1.186e-19
Identity = 9/21 (42.86%), Postives = 13/21 (61.90%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF 1551
            NM+G+  G+QS I   N +A 
Sbjct:  479 NMSGMYKGLQSRIRAHNEKAL 499          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.527e-17
Identity = 30/89 (33.71%), Postives = 51/89 (57.30%), Query Frame = 2
Query: 1223 ILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            I+   +++ YYS+ VD T D++H + ++ II YV  D I +    + FI F    G     L +A++D L++  + + + RGQSYDN +
Sbjct:  238 IINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGIPK----ERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNAS 322          

HSP 2 Score: 50.447 bits (119), Expect = 2.527e-17
Identity = 63/244 (25.82%), Postives = 115/244 (47.13%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQS--KCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRK-RFFDEVENMEENLS-PVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFL 2285
            LNL       S  +   F  ++ Q+Y FFS S+ +W +L S  K  +  VK+LS TR  +  +A          I E S +     +DS++  TA+S+  ++ +F FLC++ +W ++L +++  ++ LQ  S +I +  + +    + FQ+    +  D I   AR +   L +   F      ++RKRK +     E+ +E  S     +     +++F   IS+L  + K+       F+FL
Sbjct:  352 LNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRKATVVKNLSTTRWSARSDAY---------IRENSSN-----SDSVS--TAQSLLLQV-DFHFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQE-MRVISVDEIYFYARDVCEKLEIPATF-----PQKRKRKVKARASYESADEGASLSAGDNFRISLNQIFDVLISDLTWKSKTLMDTSVDFEFL 572          

HSP 3 Score: 28.4906 bits (62), Expect = 2.527e-17
Identity = 10/23 (43.48%), Postives = 16/23 (69.57%), Query Frame = 1
Query: 1066 NNGNFLKILEFLGEFDPVMEKHL 1134
             NGN+L +LE + E DP + +H+
Sbjct:  182 TNGNYLMLLEAIAEHDPFLAEHI 204          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2U1LR28 (Zinc finger MYM-type protein 1 OS=Artemisia annua OX=35608 GN=CTI12_AA427710 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.905e-58
Identity = 87/268 (32.46%), Postives = 147/268 (54.85%), Query Frame = 3
Query: 1539 FSCILNSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAA-KITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRK--RKRFFDEVENMEENLSPV---QKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED 2324
            F     S  LNL +  +  + P+   F   I +IY  F+ STK+W +L+     +TVKSLS TR ES V +VK +R +L  I EA   V++  ND + + T+ES+A  ++  ++FL +IVIWY++L  +N+ SK LQ+ +  I + ++ +E  ++FF +   +  F   +  A+ +A  ++++  F     VR+R+  RKR FDE +N   + +P    +   T  F ++    I +LN +F+ +Q   + F FLF    + S+ D D
Sbjct:  464 FYTPCGSHSLNLALCDMAKTCPKAKNFFGTIQKIYTIFANSTKRWAILKENVKGLTVKSLSATRWESRVESVKAIRFQLSDIREALLQVSESDNDCLIQSTSESLAENELGKYEFLVAIVIWYDILSVVNVVSKQLQSKNMVIDDAMKKIEDLVSFF-KTYRETGFAKALESAKEIAIEMNIDPVF-----VRKREIIRKRHFDENQNDASSSAPQSLEESFKTNYFLRVVDQAIVSLNSRFEQYQEYEKTFGFLFTSDKLRSLEDND 725          

HSP 2 Score: 77.0258 bits (188), Expect = 7.905e-58
Identity = 41/100 (41.00%), Postives = 68/100 (68.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            +TL+   I++ I+  ++++ YYS+I+D T DI+H+E MS+IIRYVDV + + I I +SF+GF  +  +TG  L + +   L+   L + ++RGQ YDNG+
Sbjct:  345 ITLLARAIKTPIINKIKQAKYYSVILDCTPDISHEEQMSLIIRYVDV-STSSIIIEESFLGFLNVNDTTGQGLFDVLQSELKLLDLDINDVRGQGYDNGS 443          

HSP 3 Score: 43.1282 bits (100), Expect = 7.905e-58
Identity = 29/81 (35.80%), Postives = 39/81 (48.15%), Query Frame = 3
Query:  738 RFFKSLFSRIIDNGKRIQRSWLVYSK---KFTVFAAKYLVR-----------LLSY*HISQILKRYERRVEHFECFTKGWN 938
            RF  SLF+R++ NG+   RSWLVYSK   K   F  K L +              + H++  LK +E  VEH     + WN
Sbjct:  163 RFVASLFTRVLPNGETCDRSWLVYSKELDKIFCFCCKLLRKGNPRGLLVSEGFCDWQHVNIRLKEHETSVEHIRNMLE-WN 242          

HSP 4 Score: 38.891 bits (89), Expect = 7.905e-58
Identity = 23/67 (34.33%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  952 QKSLQREVKHWGKVLGRLFL*H**CQNKTCH----SDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            Q+ L++E   W  VL R+         KT      ++ + E+NNGNFL I++ + EFDP +++H+ R
Sbjct:  259 QELLEKETNRWKHVLVRIIAAVKYFGKKTLSFRGSNEKLGEKNNGNFLGIVDMMAEFDPYIKEHVER 325          

HSP 5 Score: 24.6386 bits (52), Expect = 7.905e-58
Identity = 12/24 (50.00%), Postives = 13/24 (54.17%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM G   GVQ  +L  N RAF  P
Sbjct:  444 NMKGKHQGVQRKLLDLNSRAFYTP 467          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2U1PUU2 (Zinc finger MYM-type protein 1 OS=Artemisia annua OX=35608 GN=CTI12_AA110390 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.164e-53
Identity = 79/255 (30.98%), Postives = 146/255 (57.25%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIA-AKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENME-ENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED 2324
            LNL +  + +S  +   F      IY  FS+STK+W VL      +T+KSL  TR ESH+ +VK ++ ++ KI +A   ++K ++D +   TAES+   ++++F+F+ S+VIWY++L++INL SK LQ+    +   L++LE  +++F++   +   D  ++EA+ +A  + +E +F ++   R   RK+ FDE+ N E E  S   +  T  F  +    ++ LN +F+  +     F F+F+   ++ + D++
Sbjct:  472 LNLVLCDMANSCQKAKTFFGTCQAIYTVFSSSTKRWSVLLEYIDELTLKSLCATRWESHIESVKAIKTQVSKIKKALLKLSKVSDDGLVCRTAESLVNGELSSFEFVLSLVIWYDILYKINLVSKKLQSSDMLLDVALKNLEGLVSYFEK-YRETGLDDAISEAKLIAETIDIEPEFTIK---RVPCRKKQFDEIPNTEREQQSAKDQFRTDYFLILVDMALTQLNSRFEQMKNFESIFGFMFDASKLAYLDDDN 722          

HSP 2 Score: 72.0182 bits (175), Expect = 2.164e-53
Identity = 35/93 (37.63%), Postives = 64/93 (68.82%), Query Frame = 2
Query: 1211 IRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            +++ I+  ++++ YYS+I+D T D++ QE M++IIR VDV +   I + + F+ F ++E +TG+ L N + D+L+   L ++ +RGQ YDNG+
Sbjct:  351 VKNAIIKKIKEAKYYSVILDCTPDVSRQEQMTLIIRCVDV-SCTPIKVEEFFLEFLVVEDTTGLGLFNVLQDVLKSLDLDIKYVRGQGYDNGS 442          

HSP 3 Score: 43.5134 bits (101), Expect = 2.164e-53
Identity = 23/83 (27.71%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  922 SPKDGTENNEQKSLQREVKHWGKVLGRLFL*H**CQNKTC----------HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            S     + + Q+ ++R+ +HW +VL R+           C           ++ +Y ++NGNFL I++ + EFDP+M++H  R
Sbjct:  248 STNQTIDKDLQELIKRDTEHWKEVLIRII------AVVKCLAEYDVPFRGTNEKLYTKSNGNFLGIIQMIAEFDPIMKEHFRR 324          

HSP 4 Score: 33.113 bits (74), Expect = 2.164e-53
Identity = 28/88 (31.82%), Postives = 37/88 (42.05%), Query Frame = 3
Query:  720 PISSKIRFFKS-LFSRIIDNGKRIQRSWLVYSK---KFTVFAAKYLVRLLS-----------Y*HISQILKRYERRVEHFECFTKGWN 938
            P     R F S  + R + NG  I R WLVYSK   K   F  K     +S           + H+S  LK++E   EH   F + W+
Sbjct:  155 PKDKAGRHFSSEFYVRKLRNGDSIDRKWLVYSKELDKVFCFCCKLFKTAISKSQLSNVGTNDWKHLSVALKKHENSSEHMVNF-RTWS 241          

HSP 5 Score: 25.409 bits (54), Expect = 2.164e-53
Identity = 12/24 (50.00%), Postives = 14/24 (58.33%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM G   GVQ  +L  N RAF +P
Sbjct:  443 NMKGKHQGVQKRLLDINPRAFYMP 466          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A5N4AZJ9 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_04874 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.949e-51
Identity = 83/247 (33.60%), Postives = 146/247 (59.11%), Query Frame = 3
Query: 1617 FLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAK-KTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRK---RFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED*SLNCER 2345
            F +++ +IY FFS ST +W VL++   S+T+K LS+TR ES ++A+  +R  + +IY+A  ++++ +  D +    A  +A +I +F FLCS+V+WY+VL  IN+ +K LQ++   +S+ +  LE+T T F+   + + F   +T+A+ LA+ L +E    +E   R RKRK   +F  E E+   NL P  ++    + K+    +S L+D+F   ++  + F+FL++V  I  ++  D S  C R
Sbjct: 1293 FFSLVTKIYNFFSASTHRWAVLKNHISSLTLKPLSETRWESRIDAIAPLRYHIDEIYDALVEISENEKTDKMVAHEASCLANQIRDFTFLCSVVVWYDVLLHINVVNKSLQSIDMGLSKAVDLLEKTETHFKSLRSDLKFQGYLTDAKELASKLEMETS-KIEGTARARKRKVKRQFGYEAEDESANLDPETRYKVDFYFKIIDTTVSALSDRFHQIKSHSDIFEFLYDVSKIKDMAPSDLSDKCSR 1538          

HSP 2 Score: 80.1073 bits (196), Expect = 1.949e-51
Identity = 81/272 (29.78%), Postives = 130/272 (47.79%), Query Frame = 2
Query:  770 R*W*KNSKIMVSLFKKVYCFCRKIFGQATIILTY--FTNFKKV*------AKS*TF*VLHQR-MELKIM----------NKKACKGK*NIGARCWEDYFFNIDDVKTKHAIPI------VFMK------KIMETF*KF*NF*VSLTRLWRNIC*ELKKLCSLFNKRYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINE-IYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R W   SKI  S    VYCFC KIF    I  T   + N+K +       AKS       Q+ +EL I           N K+ K + +   +C    + +I     +H++P+      +F        K++E F KF +    L    R       K      KR     + L+ + I++KIL  ++ + YYS+I+D T DI+  E M++I+R+V +D+ ++ + I + F+GF  +  +TG+ L   I+  L +  + +EN+RGQ YDNGA
Sbjct:  982 RKWLIYSKINNS----VYCFCCKIFSNVKIHFTENGYNNWKHMSEALSSHAKSPPHLQSQQKWVELAIKTRIGQNHRRRNAKSSKFRNSSLEKCNRTAYIDIIQFLAQHSLPLRGESDKLFHHNNGNFLKLVELFGKFDSV---LQEHIRRTTSGNNKRHHYLGKRIQNEIIQLLHDQIQNKILNALKSAKYYSIILDCTPDISGVEQMTIIVRFVALDSSSKSVKIAEHFLGFVPVLETTGLGLTEVILQKLHEMGIPLENMRGQGYDNGA 1246          

HSP 3 Score: 27.7202 bits (60), Expect = 1.949e-51
Identity = 13/24 (54.17%), Postives = 16/24 (66.67%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM G   GVQ+ IL+ N RAF +P
Sbjct: 1247 NMKGKNLGVQNRILQMNPRAFFVP 1270          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A4D9BFW2 (TTF-type domain-containing protein OS=Salvia splendens OX=180675 GN=Saspl_027220 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.838e-51
Identity = 85/255 (33.33%), Postives = 139/255 (54.51%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAK-KTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENM-EENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED 2324
            LNL +  +  S  +   F  VI +IY   S STK+W +L    P +TVKSLS TR ES +N+V+ +R +  +I  A  +V +  TND  +   AE++   + NF+FLC +VIW+++LF IN+ S+ LQ+    +   +  +E  I++F++  ++  F   +  A  +A  + VE  F  +   R+ KRK+ FDE  +  EE L+ ++      F  M    I++L  +F+  +T    F FL N +N+ S+ D D
Sbjct:  468 LNLTLCDMAQSCGKTISFFGVIQRIYTLLSGSTKRWKILTDNVPKLTVKSLSTTRWESRINSVQAIRYQTPQIRAALLEVVRSSTNDPKSVSDAENLVTALENFEFLCGMVIWHDILFSINMVSQKLQSKIVCMDATIHQIEGVISYFKRYRDEG-FSRSIKIAIEIAEEMDVEPIFPTK---RKGKRKKHFDEQNDQNEETLAAIEPFRINYFLTMIDMAIASLTSRFEQMKTFENLFGFLLNSENLKSLDDND 718          

HSP 2 Score: 74.7146 bits (182), Expect = 6.838e-51
Identity = 38/100 (38.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            ++LI + IR  +L  ++ + Y+S+I+D T D +H+E M++I+R V++ + N   + + F+GF  +E +TG+ L   ++DLLE  +L V+++RGQ YDNG+
Sbjct:  340 ISLIADSIRRYMLSIIKAAKYFSVILDCTPDASHEEQMTLIVRCVNMSS-NIPRVEEFFLGFLSVEETTGLGLFTYLMDLLEHFELNVDDVRGQGYDNGS 438          

HSP 3 Score: 44.2838 bits (103), Expect = 6.838e-51
Identity = 24/78 (30.77%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  931 DGTENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTC---HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            +  +++ Q+ + +E + W +VL R+     FL     +N       ++ +Y++NNGNFL  +E + EFD VM++H+ R
Sbjct:  247 ETIDDDLQREVAKEKERWRQVLTRIVSAVKFL----AKNNLALRGTNEKIYQDNNGNFLGTIEMIAEFDVVMQEHIRR 320          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A4D8XS24 (Solute carrier family 35, member E1 OS=Salvia splendens OX=180675 GN=SLC35E1 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.197e-50
Identity = 85/255 (33.33%), Postives = 140/255 (54.90%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKT-NDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENM-EENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED 2324
            LNL +  +  S  +   F  VI +IY  FS STK+W +L    P +TVKSLS TR ES +N+V+ +R +  +I  A  +V + + ND  +   AE++   + NF+FLC +VIW+++LF IN+ S+ LQ+    +   +  +E  I++F++  ++  F   +  A  +A  + VE  F  +   R+ KRK+ FDE  +  EE L+ ++      F  M    I++L  +F+  +T    F FL N +N+ S+ D D
Sbjct:  929 LNLTLCDMAQSCGKAISFFGVIQRIYTLFSGSTKRWKILTDNVPKLTVKSLSTTRWESRINSVQAIRYQTPQIRAALLEVVRSSANDPKSVSDAENLVTALENFEFLCGMVIWHDILFSINMVSQKLQSKIVCMDAAIHQIEGVISYFKRYRDEG-FSRSIKIATEIAEEMDVEPIFPTK---RKGKRKKHFDEQNDQNEETLAAIESFRINYFLTMIDMAIASLTSRFEQMKTFENLFGFLLNSENLKSLDDND 1179          

HSP 2 Score: 71.633 bits (174), Expect = 1.197e-50
Identity = 37/100 (37.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            ++LI + IR  +L  ++ + Y+S+I+D T D +H+E M++I+R V++ + N   + + F+GF  +E +TG+ L   ++ LLE  +L V ++RGQ YDNG+
Sbjct:  801 ISLIADSIRRYMLSIIKAAKYFSVILDCTPDASHEEQMTLIVRCVNMSS-NIPRVEEFFLGFLSVEETTGLGLFTYLMGLLEHFELNVADVRGQGYDNGS 899          

HSP 3 Score: 43.5134 bits (101), Expect = 1.197e-50
Identity = 24/75 (32.00%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  940 ENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTC---HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            +++ Q+ + +E + W +VL R+     FL     +N       ++ +Y++NNGNFL  +E + EFD VM++H+ R
Sbjct:  711 DDDLQREVAKEKERWRQVLTRIVSAVKFL----AKNNLALRGTNEKIYQDNNGNFLGTIEMIAEFDVVMQEHIRR 781          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000025204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7364240:7371214:-1 gene:ENSAMXG00000024490.2 transcript:ENSAMXT00000025204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.570e-36
Identity = 60/191 (31.41%), Postives = 100/191 (52.36%), Query Frame = 3
Query: 1518 ISHFKEKFSCI-LNSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNIS-ECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVE 2084
            I     K  CI  +S  LNL V     SS   + F  V+ ++Y  FS+S ++W VL+     +T+K LS TR E+ +++VK VR +L +I EA   ++      I K  +E++++      FL   +IWY VL+++N  SK LQ  S N+S   L++    +  + ++  +    S  T+A+ +A  L +E
Sbjct:  342 ILQLNNKALCIPCSSHKLNLVVADAAKSSVLSTSFFGVLQRLYNLFSSSVQRWAVLRKHVKQLTLKPLSATRWEARIDSVKVVRYQLPEILEA---LSALQTFGIEKGDSETMSSS-----FLLCTIIWYNVLYQVNHVSKLLQ--SPNVSMGTLRAETEGVREYLEDFRENRLASCQTDAKDIAENLDME 522          

HSP 2 Score: 70.4774 bits (171), Expect = 1.570e-36
Identity = 38/100 (38.00%), Postives = 62/100 (62.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            + LIGN    K+L  +     YS+I+D T DI+H+E +S+++R V+ D    + I + F GF  +E ++G  L   ++D L+K+ L + + RGQSYDNG+
Sbjct:  236 IALIGN----KVLEEIITQRDYSVIMDCTPDISHKEQLSVVLRLVNCDP--SVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGS 329          

HSP 3 Score: 46.595 bits (109), Expect = 1.570e-36
Identity = 24/82 (29.27%), Postives = 40/82 (48.78%), Query Frame = 1
Query:  928 KDGTENNEQKSLQREVKHWGKVLGRLFL*H**CQNKTCH-----------SDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            K   +  +Q  +Q E++HW  V+ R+           CH           +  +Y+ +NGNFL  +E + +FDPVM +H+ R
Sbjct:  142 KTTIDQRQQTLMQIEIEHWKAVIRRVI-------AIICHLAERNQALRGTTSVLYDPHNGNFLAQVELMAKFDPVMNEHIRR 216          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 3.668e-36
Identity = 64/262 (24.43%), Postives = 130/262 (49.62%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNI---SECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKH-TT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED*SLNC 2339
            +NL +     SS     +   + +++ FFS +T++W +L  K   +T+KS SD R ES + +V  VR ++ ++ EA  +  +   + + +  A+ +A ++ +F FL   V+W EVL   +  +K LQ+ S  +   +  +++ + ++T ++Q+     F   +  A+ L   L++E +   +   R R  KR F   E  +E  S  QK      F+ +    +++L ++F++     + F  L + + +  IS +D   +C
Sbjct:  439 MNLVISDAAKSSTDAISYFGYLQRLFCFFSAATQRWDILL-KHVKLTLKSWSDVRWESRLQSVVAVRSQVKEVREALLEARQAVTEPVARSEAQGLAEEVGSFRFLICTVVWAEVLSVTSQVNKVLQSSSMQLDIAARLIKTAKESLTKYRQSG----FSEAIESAKELCEALNIEPELKQK---RLRSTKRQFG-YEAPDEPFSDAQKRLEVEFFNHVVDSALTSLQERFETMSQVRDTFGVLLDFQKVHGISKQDLHNHC 691          

HSP 2 Score: 72.7886 bits (177), Expect = 3.668e-36
Identity = 32/89 (35.96%), Postives = 62/89 (69.66%), Query Frame = 2
Query: 1223 ILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            I+  ++++ YY++I+D T DI+H+E MS+++R V++  + E +I + F+G+  +  +TG+ L+N +++ L    +  E+ RGQ+YDNGA
Sbjct:  323 IVAKIKQAKYYAIILDCTPDISHKEQMSLVVRIVEL--VPEPHIREYFLGYMNVVETTGLNLSNVVLEKLRALGIPFEDCRGQAYDNGA 409          

HSP 3 Score: 42.3578 bits (98), Expect = 3.668e-36
Identity = 26/73 (35.62%), Postives = 36/73 (49.32%), Query Frame = 1
Query:  934 GTENNEQKSLQREVKHWGKVLGRLFL*H**CQNKTC----HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
              +  E   ++ E K W  VL RLF        +       S S+Y ++NGNFLK +E L +FD V E H+ R
Sbjct:  220 AIDQQELSLMEAERKRWHDVLKRLFSITLSLATRNLPFRGSSQSLYVQDNGNFLKEVELLAQFDSVTEGHVAR 292          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000055782.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001476.1:1798:4262:-1 gene:ENSAMXG00000042376.1 transcript:ENSAMXT00000055782.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 1.065e-31
Identity = 76/289 (26.30%), Postives = 125/289 (43.25%), Query Frame = 3
Query: 1482 MVQHDRHKKWRSISHFKEKFSCILNSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEA----SQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQT---LSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLA-NILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEHFKFLFNVKNISSISDED 2324
            M+ H +  + R +   ++      +S  LNL V     SS     F  ++  +Y  FS+S  +W +LQ     +TVK+LS TR E  + +VK +R +  ++ EA    ++  A+K  D  T  +A+++  ++ ++ F+  +VIWY VLF IN  SK LQ     S  I      + +T                  EAR L  N     + FL E            DEV+     L+P Q+    VF  +    + +++++F         F FL+   N+     ED
Sbjct:  358 MMGHKQGVQKRVLEINQKALCVPCSSHSLNLVVADAAKSSVLSVTFFGILQWLYNLFSSSVHRWSILQRHV-KLTVKNLSTTRWECRIESVKALRHQYPEMIEALSVLTEHAAEK-KDGETLYSAQNLCKELMSWQFILCVVIWYNVLFHINHVSKLLQKPELFSPRIPGSWNFIAKT------------------EARELQRNYRRTTRKFLYEGK----------DEVQ-----LTPEQRFNQDVFLPLIDTALISISERFTQVDVFFSLFGFLYYANNMKKAIQED 611          

HSP 2 Score: 74.7146 bits (182), Expect = 1.065e-31
Identity = 33/100 (33.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            ++L+G   +  I+  V+ + Y+S+I+D T D +H E MS+++R V+ ++ +   I++ F+GF  ++ ++G  L N + + L+  KL + + RGQSY+NG+
Sbjct:  257 ISLVGQKTKDAIVQKVKDAKYFSVIMDCTPDTSHNEQMSLVLRIVNCESCSGASISEHFVGFFSVQDTSGRGLCNTLTEELKHMKLNIADCRGQSYNNGS 356          

HSP 3 Score: 28.1054 bits (61), Expect = 1.065e-31
Identity = 13/33 (39.39%), Postives = 22/33 (66.67%), Query Frame = 1
Query: 1042 HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            HS+ ++E +NGNFL  +E + +   +M +HL R
Sbjct:  208 HSEKLFEPHNGNFLGQIELMAQ---LMSEHLRR 237          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 9.374e-31
Identity = 39/100 (39.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query: 1190 MTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            + LIGN +  +I+   Q++ YYS+I+D T DI+H+E +S+++R V+ D    + I + F GF  +E ++G  L   ++D L+K+ L + + RGQSYDNG+
Sbjct:  286 IALIGNKVLEEIVRRAQRAKYYSVIMDCTPDISHKEQLSVVLRLVNCDP--SVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGS 383          

HSP 2 Score: 46.595 bits (109), Expect = 9.374e-31
Identity = 24/82 (29.27%), Postives = 40/82 (48.78%), Query Frame = 1
Query:  928 KDGTENNEQKSLQREVKHWGKVLGRLFL*H**CQNKTCH-----------SDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            K   +  +Q  +Q E++HW  V+ R+           CH           +  +Y+ +NGNFL  +E + +FDPVM +H+ R
Sbjct:  192 KTTIDQRQQALMQIEIEHWKAVIRRVIA-------IICHLAERNQALRGTTSELYDPHNGNFLAQVELMAKFDPVMNEHIRR 266          

HSP 3 Score: 46.2098 bits (108), Expect = 9.374e-31
Identity = 26/72 (36.11%), Postives = 42/72 (58.33%), Query Frame = 3
Query: 1545 CI-LNSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVK 1757
            CI  +S  LNL V     SS   + F  V+ ++Y  FS+S ++W VL+     +T+K LS TR E+ +++V+
Sbjct:  405 CIPCSSHTLNLVVADAAKSSVLSTSFFGVLQRLYNLFSSSVQRWAVLRKHVKQLTLKPLSATRWEARIDSVE 476          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 2.178e-28
Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query: 1196 LIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINE--IYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            L G  + S IL   + + YYS+I D T DI+H E   +++RYV  D  +     I + FI F      TG E++  II+ L+ N + ++  RGQ YDNGA
Sbjct:  267 LCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYVHQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGA 366          

HSP 2 Score: 60.8474 bits (146), Expect = 2.178e-28
Identity = 51/182 (28.02%), Postives = 88/182 (48.35%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDV-AKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQM--IFDSIVTEARRLANILSVEKDFLVE 2102
            LNL  V+   S P+++ F   ++++Y  FS S ++W +L+ K    ++  LSDTR  + + AV+ V   L  I EA + V A  +  S  K  A  +      FD +  + +W ++L  I+  +  LQ  + +IS  L      I   Q+    +   +DS++ EA  +A+ + V   F  E
Sbjct:  396 LNLVGVHAAESCPEVATFFGSVNRLYNLFSASPERWAILKEKT-GCSLHRLSDTRWSARIAAVRVVAAHLPSILEALECVLATCSLTSEAKSEANGLINYFKTFDAIVLLTVWVKILQCIDNRNVILQ--AGDIS--LDVEAANIKALQEEMQALRNRWDSLLAEATLVAHAMDVPDHFRSE 572          

HSP 3 Score: 36.1946 bits (82), Expect = 2.178e-28
Identity = 28/74 (37.84%), Postives = 38/74 (51.35%), Query Frame = 1
Query:  934 GTENNEQKSLQREVKHWGKVLGRLF--L*H**CQN-----KTCHSDSVYEENNGNFLKILEFLGEFDPVMEKHL 1134
            G + + QK LQ E +   K+L RL     H   +N     KT + D V+   NGNFL  LE L  +DP + +HL
Sbjct:  170 GVDGHLQKQLQTEAEKHTKILERLLDVTLHLASRNLAFRGKTSNLDDVH---NGNFLGTLELLAHYDPFIHEHL 240          

HSP 4 Score: 23.8682 bits (50), Expect = 2.178e-28
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 1
Query: 1486 CNMTGIRNGVQSHILKKN 1539
             NM+G   GVQ+ ILK N
Sbjct:  366 ANMSGKVKGVQAQILKAN 383          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 79.337 bits (194), Expect = 1.263e-39
Identity = 43/98 (43.88%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 1196 LIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            L+ + I S I+ +++K+ Y+S+I+D TLDI+H E +S+IIR V +  + +  I + F+GF   E STG  LA+ I++ LE+  +  E+ RGQSYDNGA
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL--MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGA 441          

HSP 2 Score: 76.2554 bits (186), Expect = 1.263e-39
Identity = 46/179 (25.70%), Postives = 95/179 (53.07%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNIS---ECLQSLERTITFFQQN------------CNQMIFDSIVTEAR 2057
            LNL V      S     +  V+ ++Y  FS S ++W +L+S+  S+T+KS ++TR ES + +++ +R +   + EA  +V  KT D + K  A+S++ ++ ++ F    V+W+++L  I   SK +Q+ + ++      L+  E+++  ++ N            C +M  ++I+ + R
Sbjct:  471 LNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQV-SITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKR 648          

HSP 3 Score: 41.5874 bits (96), Expect = 1.263e-39
Identity = 15/33 (45.45%), Postives = 25/33 (75.76%), Query Frame = 1
Query: 1042 HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            H+++++  +NGNFLK +E +  FDP+M+ HL R
Sbjct:  291 HTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 4 Score: 28.1054 bits (61), Expect = 1.263e-39
Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1486 CNMTGIRNGVQSHILKKNFRAF*IP 1560
             NM G   GVQ+ +L+KN RA  +P
Sbjct:  441 ANMKGKNKGVQARLLEKNPRALFLP 465          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 79.337 bits (194), Expect = 1.263e-39
Identity = 43/98 (43.88%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 1196 LIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            L+ + I S I+ +++K+ Y+S+I+D TLDI+H E +S+IIR V +  + +  I + F+GF   E STG  LA+ I++ LE+  +  E+ RGQSYDNGA
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL--MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGA 441          

HSP 2 Score: 76.2554 bits (186), Expect = 1.263e-39
Identity = 46/179 (25.70%), Postives = 95/179 (53.07%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNIS---ECLQSLERTITFFQQN------------CNQMIFDSIVTEAR 2057
            LNL V      S     +  V+ ++Y  FS S ++W +L+S+  S+T+KS ++TR ES + +++ +R +   + EA  +V  KT D + K  A+S++ ++ ++ F    V+W+++L  I   SK +Q+ + ++      L+  E+++  ++ N            C +M  ++I+ + R
Sbjct:  471 LNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQV-SITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKR 648          

HSP 3 Score: 41.5874 bits (96), Expect = 1.263e-39
Identity = 15/33 (45.45%), Postives = 25/33 (75.76%), Query Frame = 1
Query: 1042 HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            H+++++  +NGNFLK +E +  FDP+M+ HL R
Sbjct:  291 HTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 4 Score: 28.1054 bits (61), Expect = 1.263e-39
Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1486 CNMTGIRNGVQSHILKKNFRAF*IP 1560
             NM G   GVQ+ +L+KN RA  +P
Sbjct:  441 ANMKGKNKGVQARLLEKNPRALFLP 465          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 79.337 bits (194), Expect = 1.263e-39
Identity = 43/98 (43.88%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 1196 LIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            L+ + I S I+ +++K+ Y+S+I+D TLDI+H E +S+IIR V +  + +  I + F+GF   E STG  LA+ I++ LE+  +  E+ RGQSYDNGA
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL--MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGA 441          

HSP 2 Score: 76.2554 bits (186), Expect = 1.263e-39
Identity = 46/179 (25.70%), Postives = 95/179 (53.07%), Query Frame = 3
Query: 1566 LNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNIS---ECLQSLERTITFFQQN------------CNQMIFDSIVTEAR 2057
            LNL V      S     +  V+ ++Y  FS S ++W +L+S+  S+T+KS ++TR ES + +++ +R +   + EA  +V  KT D + K  A+S++ ++ ++ F    V+W+++L  I   SK +Q+ + ++      L+  E+++  ++ N            C +M  ++I+ + R
Sbjct:  471 LNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQV-SITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANGFVNAQMAAKEMCKEMNVEAILKQKR 648          

HSP 3 Score: 41.5874 bits (96), Expect = 1.263e-39
Identity = 15/33 (45.45%), Postives = 25/33 (75.76%), Query Frame = 1
Query: 1042 HSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            H+++++  +NGNFLK +E +  FDP+M+ HL R
Sbjct:  291 HTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 4 Score: 28.1054 bits (61), Expect = 1.263e-39
Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query: 1486 CNMTGIRNGVQSHILKKNFRAF*IP 1560
             NM G   GVQ+ +L+KN RA  +P
Sbjct:  441 ANMKGKNKGVQARLLEKNPRALFLP 465          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 120.553 bits (301), Expect = 1.045e-44
Identity = 74/246 (30.08%), Postives = 136/246 (55.28%), Query Frame = 3
Query: 1554 NSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEH-FKFLF 2288
            N+  LNL +    + S     F + +  +Y FFS S  +W VL+    S+T+K +S+TR E+ + A++ +R EL +IY++  ++A++++    +  AE +A K+ ++ F+ SI+IWYE+L +++  SK +Q +S NIS C +S++  + FF+   N   F++ +  +  L   L  E DF  E  VR R  ++ F    + +   +P +      F+ +    IS+L  +F++  +G E  F FL+
Sbjct:  426 NAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETL-SGFERCFGFLY 670          

HSP 2 Score: 43.5134 bits (101), Expect = 1.045e-44
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  940 ENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTCHSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            + N Q+    E K W +++ R+     FL    C      S  +YE+NNGNFLK +E +G+FD  M  H+ R
Sbjct:  234 DKNMQRYYDAEKKRWCQIVKRMISVVQFL-AGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKR 304          

HSP 3 Score: 42.743 bits (99), Expect = 1.045e-44
Identity = 28/106 (26.42%), Postives = 51/106 (48.11%), Query Frame = 2
Query: 1172 RYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R+    + ++   I+  IL +++++ Y+S+I+D T D  H E ++M+IRYV        YI    +  + +E                   L + ++RGQ YDNG+
Sbjct:  322 RFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV--------YIKNYEVELNYLE-------------------LNISDMRGQGYDNGS 400          

HSP 4 Score: 33.8834 bits (76), Expect = 1.045e-44
Identity = 22/71 (30.99%), Postives = 33/71 (46.48%), Query Frame = 3
Query:  741 FFKSLFSRIIDNGKRIQRSWLVYSKKFTV-------FAAKYLVRLLS-----Y*HISQILKRYERRVEHFE 917
            F K  F R + NG++  R WL+YS K             K  ++L++     + HIS  L R+E+   H E
Sbjct:  145 FSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIE 215          

HSP 5 Score: 21.1718 bits (43), Expect = 1.045e-44
Identity = 10/24 (41.67%), Postives = 13/24 (54.17%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM+G   G+Q  IL    RA  +P
Sbjct:  401 NMSGKHRGLQKRILDNYPRALFMP 424          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.260e-44
Identity = 74/246 (30.08%), Postives = 136/246 (55.28%), Query Frame = 3
Query: 1554 NSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEH-FKFLF 2288
            N+  LNL +    + S     F + +  +Y FFS S  +W VL+    S+T+K +S+TR E+ + A++ +R EL +IY++  ++A++++    +  AE +A K+ ++ F+ SI+IWYE+L +++  SK +Q +S NIS C +S++  + FF+   N   F++ +  +  L   L  E DF  E  VR R  ++ F    + +   +P +      F+ +    IS+L  +F++  +G E  F FL+
Sbjct:  426 NAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETL-SGFERCFGFLY 670          

HSP 2 Score: 43.1282 bits (100), Expect = 1.260e-44
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  940 ENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTCHSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            + N Q+    E K W +++ R+     FL    C      S  +YE+NNGNFLK +E +G+FD  M  H+ R
Sbjct:  234 DKNMQRYYDAEKKRWCQIVKRMISVVQFL-AGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKR 304          

HSP 3 Score: 42.743 bits (99), Expect = 1.260e-44
Identity = 28/106 (26.42%), Postives = 51/106 (48.11%), Query Frame = 2
Query: 1172 RYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R+    + ++   I+  IL +++++ Y+S+I+D T D  H E ++M+IRYV        YI    +  + +E                   L + ++RGQ YDNG+
Sbjct:  322 RFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV--------YIKNYEVELNYLE-------------------LNISDMRGQGYDNGS 400          

HSP 4 Score: 33.4982 bits (75), Expect = 1.260e-44
Identity = 22/71 (30.99%), Postives = 33/71 (46.48%), Query Frame = 3
Query:  741 FFKSLFSRIIDNGKRIQRSWLVYSKKFTV-------FAAKYLVRLLS-----Y*HISQILKRYERRVEHFE 917
            F K  F R + NG++  R WL+YS K             K  ++L++     + HIS  L R+E+   H E
Sbjct:  145 FSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIE 215          

HSP 5 Score: 21.1718 bits (43), Expect = 1.260e-44
Identity = 10/24 (41.67%), Postives = 13/24 (54.17%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM+G   G+Q  IL    RA  +P
Sbjct:  401 NMSGKHRGLQKRILDNYPRALFMP 424          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000036749.1 (SMESG000036749.1)

HSP 1 Score: 108.997 bits (271), Expect = 5.456e-44
Identity = 71/246 (28.86%), Postives = 133/246 (54.07%), Query Frame = 3
Query: 1554 NSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEH-FKFLF 2288
            N+  LNL +    + S     F + +  I  FFS S  +W VL+    S+T+K +S+TR E+ + A++ +R EL +IY++  ++A++++    +  AE +A K+ ++ F+ SI+IW+E+L +++  SK +Q +S NIS C +S++  + +F+   N   F++ +  +  L   L  E DF  E  VR R  ++ F    + +   +P +         +    IS+L  +F++  +G E  F FL+
Sbjct:  380 NAHTLNLAINDAANVSFSTVDFFSNVSAISNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVQHEAECLAMKLKSYKFISSIIIWFEILEKVDFISKMMQKVSWNISSCAESIKEVLKYFKSIRNDESFENYLQISNELCVALETEPDFPAEISVRSRHHRKQFSYERDEDIQFTPKEHFQISFSYVILDTAISSLTTRFETL-SGFERCFGFLY 624          

HSP 2 Score: 63.1586 bits (152), Expect = 5.456e-44
Identity = 34/106 (32.08%), Postives = 63/106 (59.43%), Query Frame = 2
Query: 1172 RYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R+    + ++   I+  IL +++++ Y+S+I+D T D  H E ++M+IRYV +    E+ + ++FIGF   +  TG    + +I  L   +L + ++RGQ YDNG+
Sbjct:  250 RFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNY-EVEVRENFIGFYQAKKCTGESFYDFLIQKLNYIELNISDMRGQGYDNGS 354          

HSP 3 Score: 46.2098 bits (108), Expect = 5.456e-44
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  928 KDGTENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTCHSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            K   + N Q+    E K W +++ R+     FL    C      S  +YE+NNGNFLK +E +G+FD +M  H+ R
Sbjct:  158 KTTIDKNMQRYYDAEKKRWCQIIKRMISMVQFL-AGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDIMADHIKR 232          

HSP 4 Score: 21.1718 bits (43), Expect = 5.456e-44
Identity = 10/24 (41.67%), Postives = 13/24 (54.17%), Query Frame = 1
Query: 1489 NMTGIRNGVQSHILKKNFRAF*IP 1560
            NM+G   G+Q  IL    RA  +P
Sbjct:  355 NMSGKHRGLQKRILDNYPRALFMP 378          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000047334.1 (SMESG000047334.1)

HSP 1 Score: 118.627 bits (296), Expect = 3.943e-43
Identity = 77/268 (28.73%), Postives = 144/268 (53.73%), Query Frame = 3
Query: 1488 QHDRHKKWRSISHFKEKFSCILNSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*VFDKMFRCFISNLNDQFKSFQTGIEH-FKFLF 2288
            +H R +K R + ++        N+  LNL +    + S     F + +  IY  FS S  +W VL+    S+T+K +S+T+ E+ + A++ +R EL +IY++  ++A++++    +  AE +A K+ ++ F+ SI+IWYE+L +++  SK +Q +S NIS C +S++  + FF+   N   F++ +  +  L   L  E DF  E +VR R  ++ F    + +   +P +      F  +    IS+L  +F++  +G E  F FL+
Sbjct:  534 KHRRLQK-RILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAIYNIFSASPFRWQVLKKNVKSLTLKQVSETQWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLAMKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEIIVRSRHHRKQFSYERDEDIQFTPKEHFQISFFYVILDTAISSLTTRFETL-SGFERCFGFLY 799          

HSP 2 Score: 45.0542 bits (105), Expect = 3.943e-43
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  928 KDGTENNEQKSLQREVKHWGKVLGRL-----FL*H**CQNKTCHSDSVYEENNGNFLKILEFLGEFDPVMEKHLLR 1140
            K   + N Q+    E K W +++ R+     FL    C      S  +YE+NNGNFLK +E +G+FD +M  H+ R
Sbjct:  359 KTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFL-AGQCLAFRGSSGILYEKNNGNFLKAIEMIGKFDDIMADHIKR 433          

HSP 3 Score: 42.743 bits (99), Expect = 3.943e-43
Identity = 29/106 (27.36%), Postives = 53/106 (50.00%), Query Frame = 2
Query: 1172 RYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R+    + ++   I+  IL +++++ Y+S+I+D T D  H E ++M+IRYV +                    +  +EL     + LE N   + ++RGQ YDNG+
Sbjct:  451 RFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHI-------------------KNYEVEL-----NYLELN---ISDMRGQGYDNGS 529          

HSP 4 Score: 30.0314 bits (66), Expect = 3.943e-43
Identity = 23/74 (31.08%), Postives = 36/74 (48.65%), Query Frame = 3
Query:  741 FFKSLFSRIIDNGKRIQRSWLVYSKKF-TVFA------AKYLVRLLS-----Y*HISQILKRYERRVEHFECFT 926
            F K  F R + NG++  R  L+YS K   +F        K  ++L++     + HIS  L R+E+   H E +T
Sbjct:  274 FSKVYFYRKLPNGEKFNRELLIYSPKNDAIFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENYT 347          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000026738.1 (SMESG000026738.1)

HSP 1 Score: 119.013 bits (297), Expect = 3.952e-38
Identity = 65/195 (33.33%), Postives = 114/195 (58.46%), Query Frame = 3
Query: 1554 NSFPLNLEVVYLVHSSPQISLFLNVIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLELVKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEINLSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANILSVEKDFLVEALVRQRKRKRFF 2138
            N+  LNL +    + S     F + +  IY FFS S  +W VL+    S+T+K +S+TR E+ + A++ +R EL +IY++  ++A++++    +  AE +A K+ ++ F+ SI+IWYE+L +++  SK +Q +S NIS C +S++  + FF+   N   F++ +  +  L   L  E DFL E  VR R  ++ F
Sbjct:  431 NAHTLNLAINDAANVSFSTVDFFSNVSAIYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLAMKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLPISNELCVALETEPDFLAEISVRSRHHRKQF 625          

HSP 2 Score: 60.077 bits (144), Expect = 3.952e-38
Identity = 33/106 (31.13%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 1172 RYAE*TMTLIGNYIRSKILVNVQKSNYYSLIVDFTLDINHQE*MSMIIRYVDVDAINEIYINKSFIGFSLIEGSTGIELANAIIDLLEKNKLLVENIRGQSYDNGA 1489
            R+    + ++   I+  IL +++++ Y+S+I+D T D  H E ++M+IRYV +    E+ + ++FIGF   +  TG    + +I  L   +L + ++R Q YDNG+
Sbjct:  301 RFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNY-EVEVRENFIGFYQAKKCTGESFYDFLIQKLNYLELNISDMRVQGYDNGS 405          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.11.186e-1934.78pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043220.12.527e-1733.71pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U1LR287.905e-5832.46Zinc finger MYM-type protein 1 OS=Artemisia annua ... [more]
A0A2U1PUU22.164e-5330.98Zinc finger MYM-type protein 1 OS=Artemisia annua ... [more]
A0A5N4AZJ91.949e-5133.60Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A4D9BFW26.838e-5133.33TTF-type domain-containing protein OS=Salvia splen... [more]
A0A4D8XS241.197e-5033.33Solute carrier family 35, member E1 OS=Salvia sple... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025204.21.570e-3631.41pep primary_assembly:Astyanax_mexicanus-2.0:12:736... [more]
ENSAMXT00000036272.13.668e-3624.43pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000055782.11.065e-3126.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044961.19.374e-3139.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033195.12.178e-2838.00pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000028133.11.263e-3943.88zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.11.263e-3943.88zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.11.263e-3943.88zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061124.11.045e-4430.08SMESG000061124.1[more]
SMESG000061124.11.260e-4430.08SMESG000061124.1[more]
SMESG000036749.15.456e-4428.86SMESG000036749.1[more]
SMESG000047334.13.943e-4328.73SMESG000047334.1[more]
SMESG000026738.13.952e-3833.33SMESG000026738.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011601 ID=SMED30011601|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3023bp
CTACTGCCTGTGTTTTTTCTAAACCATATTTTGCAAGGTTTTGGCAGTTT
TATTTATTGAATGTGTTTTTTTCTAATTGTCATATCTACCATAATGTAAT
GGTTGTCTATACGCAGTTACTCAATACTGATTATTAGTGTTTACATTACT
AATAAACCGCAGACGCCAACAGCACCGAGCTCCAAATGAGCTTTATGTCT
TAGTTATTGGATTTTACTAAATTTTAGTGGTTGACAAATGAAAATTCAGT
TACATAATATTTTCTACAAAATTTGGCTATGAAACAAATTTATTTAAGGT
ATTCACTAATTTTCGGCACAGTCTTTTTCAAGCAACTAATGAATAAAAGA
AAGCTTTCTGGCTGGGAATATAAACAAAAACGACAGCAAAAAGGGAGCAA
ACGAAGAAACATCAAAATTCATTGGAAAATTATTTGTTTAAACCTGATTG
TCAGCAATCGGCAAACGAAAATCAAATGGACATTGTTCAAAACATTGAAT
GGAATTCTGAAAGTTTAATCGAAACTACTAATTCGGTTGTAGCAGAATCT
GAAAGCGTTGTTCAATTAAATTACTCTGTCGATCGTATTAAAATTAGTTT
AACAATTGAACTAGCAACTGAATTAGTTGCAACAGTGTTTTGTTTTGATG
ATGATATTAGTAATTTGCCAGAAGAAGCAATTAACAAAAATTTCATTCAG
TAAATTGTGTTAAAAGGACCCAATAAGTTCAAAGATAAGGTTCTTCAAAT
CATTATTTTCACGAATTATAGATAATGGTAAAAGAATTCAAAGATCATGG
TTAGTTTATTCAAAAAAGTTTACTGTTTTTGCCGCAAAATATTTGGTCAG
GCTACTATCATATTGACATATTTCACAAATTTTAAAAAGGTATGAGCGAA
GAGTTGAACATTTTGAGTGCTTCACCAAAGGATGGAACTGAAAATAATGA
ACAAAAAAGCCTGCAAAGGGAAGTGAAACATTGGGGCAAGGTGCTGGGAA
GATTATTTCTTTAACATTGATGATGTCAAAACAAAACATGCCATTCCGAT
AGTGTTTATGAAGAAAATAATGGAAACTTTCTAAAAATTTTAGAATTTTT
AGGTGAGTTTGACCCGGTTATGGAGAAACATTTGTTAAGAACTAAAAAAA
TTATGTTCACTATTTAATAAAAGATATGCAGAATGAACAATGACTTTAAT
TGGCAATTACATCAGAAGTAAAATTTTAGTAAATGTGCAGAAATCTAATT
ACTATTCATTAATTGTTGATTTTACACTAGACATCAACCACCAGGAATAA
ATGTCAATGATTATTCGATATGTTGATGTGGATGCTATCAATGAAATTTA
TATTAATAAAAGTTTTATTGGATTTTCTCTGATTGAAGGTTCAACAGGAA
TTGAACTGGCAAATGCGATCATTGATTTACTGGAAAAAAATAAATTATTA
GTTGAAAACATCAGAGGCCAAAGTTATGATAATGGTGCAACATGACAGGC
ATAAGAAATGGCGTTCAATCTCACATTTTAAAGAAAAATTTTCGTGCATT
TTAAATTCCTTTCCTTTAAATTTAGAGGTAGTTTATTTAGTGCATAGTTC
ACCCCAAATTTCTCTATTTTTAAACGTCATTGATCAGATTTATAAATTCT
TCTCTACTTCAACAAAAAAATGGGGAGTTTTACAATCTAAATGTCCATCA
ATGACAGTCAAATCGTTAAGTGATACACGCTTGGAAAGCCATGTTAATGC
TGTCAAAACTGTGAGATTGGAATTAGTAAAAATTTACGAAGCATCACAAG
ATGTTGCCAAAAAAACTAATGATTCAATCACAAAGTTGACAGCGGAATCC
ATTGCAGCAAAAATCACAAATTTTGATTTTTTATGTTCAATTGTAATTTG
GTATGAAGTGTTATTTGAAATTAATCTTTCCAGCAAACATCTTCAAACCC
TTTCAACGAATATTTCTGAATGCTTGCAGTCGCTTGAACGAACAATCACG
TTTTTCCAACAGAACTGTAACCAAATGATTTTTGATTCAATCGTCACAGA
AGCACGAAGACTTGCAAACATTTTAAGTGTCGAAAAGGATTTTCTTGTAG
AAGCTTTAGTACGGCAAAGAAAAAGGAAAAGATTTTTTGATGAAGTGGAA
AATATGGAAGAAAATTTAAGCCCTGTGCAGAAGCACACAACATAAGTTTT
TGATAAAATGTTTAGGTGTTTTATAAGTAATTTGAACGATCAATTTAAAT
CATTTCAAACTGGAATTGAACATTTCAAATTTTTATTCAACGTAAAAAAT
ATTTCTTCTATATCGGATGAAGATTAATCTTTAAACTGTGAGAGGCGTTT
GGTCATGTACATTCTATGTGGCATGTTCTAGCATCATATAAGAACTTTTT
GTGAAAAAAACAAGTCAAAAGAAAAGAATTTGATTTGGTGTTTTTTTGTG
TTATAAGAACTTTGTGGGGAGGAGTTACGTCTCACATAGACAGTTTTTGT
TAACGTGGATATCTGTTCCTTCAGTGAAAGACCAGAAACCAATGAGATGG
AAGTCGGTGCATTTCGAATAGGTGGCCTTGCGAACAGTTTATCGGCGATT
TTCGCCAAATGAAAAGAATAATCTGAACAACAACAAGAAGTAAGGATTGG
GCGTGATGTGGAAGCACTGTTAAAACATAGTTAAATATAAGAGCCGTGCT
TTTTGATTGACCAGCGTGAGCGTTCTCGAGTTACCGTACGAGTAGGGATA
AAAATGATGATGGCGCTTAAACAGCATATGGAGGGGTTTCGTTAATTTCC
TGATTGCTCGAAAGCCGAATTTGTGTAAGTTACCAAACTTAACCAAAATA
TGAAATAAGAACCAAAATGAATCTGTTACTAATCGAATCTAATCTTTTAT
GCACAAATCAATTCAGAATCCAATTCAAAATGTCGTCAAAAAATTCAACC
AAAATTTAGAATTTATGATCTGATCTTAACTACGTTGCAATGGTGTCAGG
CGTCATTTGTTGCAGTAGTATGG
back to top

protein sequence of SMED30011601-orf-1

>SMED30011601-orf-1 ID=SMED30011601-orf-1|Name=SMED30011601-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MIMVQHDRHKKWRSISHFKEKFSCILNSFPLNLEVVYLVHSSPQISLFLN
VIDQIYKFFSTSTKKWGVLQSKCPSMTVKSLSDTRLESHVNAVKTVRLEL
VKIYEASQDVAKKTNDSITKLTAESIAAKITNFDFLCSIVIWYEVLFEIN
LSSKHLQTLSTNISECLQSLERTITFFQQNCNQMIFDSIVTEARRLANIL
SVEKDFLVEALVRQRKRKRFFDEVENMEENLSPVQKHTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371