Peripheral plasma membrane protein CASK

Overview
NamePeripheral plasma membrane protein CASK
Smed IDSMED30011594
Length (bp)1839
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peripheral plasma membrane protein CASK (SMED30011594) t-SNE clustered cells

Violin plots show distribution of expression levels for Peripheral plasma membrane protein CASK (SMED30011594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peripheral plasma membrane protein CASK (SMED30011594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peripheral plasma membrane protein CASK (SMED30011594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011594SMESG000062837.1 dd_Smed_v4_5730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011594SMESG000062837.1 dd_Smed_v4_5730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011594SMESG000062837.1 dd_Smed_v4_5730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011594SMESG000062837.1 dd_Smed_v4_5730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011594SMESG000062837.1 SMESG000018759.1 Contig38629newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011594SMESG000062837.1 SMESG000018759.1 Contig38629uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30011594SMESG000062837.1 dd_Smed_v4_5730_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 360.533 bits (924), Expect = 1.938e-117
Identity = 181/452 (40.04%), Postives = 278/452 (61.50%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  106 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 518          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 362.844 bits (930), Expect = 3.520e-114
Identity = 179/440 (40.68%), Postives = 277/440 (62.95%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CEIYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                                      C  + + +K Y   +L   + +   YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------------------CTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 880          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 360.147 bits (923), Expect = 6.684e-113
Identity = 181/452 (40.04%), Postives = 278/452 (61.50%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 897          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 359.762 bits (922), Expect = 9.488e-113
Identity = 181/452 (40.04%), Postives = 278/452 (61.50%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 903          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 355.525 bits (911), Expect = 4.187e-111
Identity = 181/463 (39.09%), Postives = 278/463 (60.04%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                       IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 908          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12406131:-1 gene:WBGene00002991.1 transcript:F17E5.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 367.466 bits (942), Expect = 4.091e-119
Identity = 185/453 (40.84%), Postives = 269/453 (59.38%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQ-------------DVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   K+  EPMG+TL+ +++GRC +ARIM GG+IHR  +LHVGDEI E+N  SV   S+E +Q +L+ A G V   I+P+    PP CEI+V+A FDYEPS+D ++P  Q  + F  GDIL++ISKDD+NWWQA+ +               +    A LIPS ELQE R     +++         S  +CN                   C            +   +   L+DQL L         YEEV+ ++++ R++L+LLGAHGVGRRHIKN LI   P+ F+ P+PHT++ P  ++++GK Y+FV++EQM++DI NN YLEYG  ++ +YG KLET+R I +   I +LDVEPQAL++LR  E++PFVVFI+ P+L  + D      DG LEKL  +S++L   +    D  I N  I+DT+  + + + +L +  QW+PV W+Y
Sbjct:  206 VQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMER---------SKNTCNTH-----------------CMWFNKKKKYYTTKYLQKHSALFDQLDLVT-------YEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDP-----DGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 620          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12414037:-1 gene:WBGene00002991.1 transcript:F17E5.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 365.54 bits (937), Expect = 7.539e-115
Identity = 185/453 (40.84%), Postives = 269/453 (59.38%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQ-------------DVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   K+  EPMG+TL+ +++GRC +ARIM GG+IHR  +LHVGDEI E+N  SV   S+E +Q +L+ A G V   I+P+    PP CEI+V+A FDYEPS+D ++P  Q  + F  GDIL++ISKDD+NWWQA+ +               +    A LIPS ELQE R     +++         S  +CN                   C            +   +   L+DQL L         YEEV+ ++++ R++L+LLGAHGVGRRHIKN LI   P+ F+ P+PHT++ P  ++++GK Y+FV++EQM++DI NN YLEYG  ++ +YG KLET+R I +   I +LDVEPQAL++LR  E++PFVVFI+ P+L  + D      DG LEKL  +S++L   +    D  I N  I+DT+  + + + +L +  QW+PV W+Y
Sbjct:  547 VQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMER---------SKNTCNTH-----------------CMWFNKKKKYYTTKYLQKHSALFDQLDLVT-------YEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDP-----DGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 961          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 175.252 bits (443), Expect = 1.067e-46
Identity = 116/452 (25.66%), Postives = 218/452 (48.23%), Query Frame = 1
Query:  442 MGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPN---NWREPPNCEI-------------YVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVD-SPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVI-EIAEFS-RRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLS-----DSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAW 1725
            +G T+R ++N + ++ R++ GG++ +      GDE++E+N  S+ G  +  +  IL++  G +   + P    +  +P +                +++A+FDY+P +D  VP  ++A+ F  GDIL +++  D+NWWQA    +D+  S A LIPS+  ++   V    D+V  E++              + K+      +P I  GV                             +F  YEEV+ E+ + + RR ++L GA GVG   +++ L++S     + PVP+TS+ P   + NG  YHFVS ++   D  +  ++E+G+     YG   + V  +I+     V+ ++ ++L  +R+ +  P+++FI+ P L +L      + T  + D  L+ +   S+ +E  Y    D  IVN   E + + + Q L ++++   W+P  W
Sbjct:  246 LGATVR-NENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQ--VVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAI--GVYS---------------------------DFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 175.252 bits (443), Expect = 1.067e-46
Identity = 116/452 (25.66%), Postives = 218/452 (48.23%), Query Frame = 1
Query:  442 MGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPN---NWREPPNCEI-------------YVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVD-SPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVI-EIAEFS-RRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLS-----DSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAW 1725
            +G T+R ++N + ++ R++ GG++ +      GDE++E+N  S+ G  +  +  IL++  G +   + P    +  +P +                +++A+FDY+P +D  VP  ++A+ F  GDIL +++  D+NWWQA    +D+  S A LIPS+  ++   V    D+V  E++              + K+      +P I  GV                             +F  YEEV+ E+ + + RR ++L GA GVG   +++ L++S     + PVP+TS+ P   + NG  YHFVS ++   D  +  ++E+G+     YG   + V  +I+     V+ ++ ++L  +R+ +  P+++FI+ P L +L      + T  + D  L+ +   S+ +E  Y    D  IVN   E + + + Q L ++++   W+P  W
Sbjct:  246 LGATVR-NENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQ--VVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAI--GVYS---------------------------DFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 175.252 bits (443), Expect = 3.073e-46
Identity = 116/452 (25.66%), Postives = 218/452 (48.23%), Query Frame = 1
Query:  442 MGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPN---NWREPPNCEI-------------YVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVD-SPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVI-EIAEFS-RRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLS-----DSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAW 1725
            +G T+R ++N + ++ R++ GG++ +      GDE++E+N  S+ G  +  +  IL++  G +   + P    +  +P +                +++A+FDY+P +D  VP  ++A+ F  GDIL +++  D+NWWQA    +D+  S A LIPS+  ++   V    D+V  E++              + K+      +P I  GV                             +F  YEEV+ E+ + + RR ++L GA GVG   +++ L++S     + PVP+TS+ P   + NG  YHFVS ++   D  +  ++E+G+     YG   + V  +I+     V+ ++ ++L  +R+ +  P+++FI+ P L +L      + T  + D  L+ +   S+ +E  Y    D  IVN   E + + + Q L ++++   W+P  W
Sbjct:  408 LGATVR-NENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQ--VVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAI--GVYS---------------------------DFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 827          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0112873)

HSP 1 Score: 370.548 bits (950), Expect = 3.247e-122
Identity = 189/454 (41.63%), Postives = 277/454 (61.01%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE----------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIA----EFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CE          I+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK   E+ +      C+ F                          + +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:   57 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQVN------CSIF-----------------------GRKKKQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 469          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0301327)

HSP 1 Score: 384.03 bits (985), Expect = 4.032e-122
Identity = 193/452 (42.70%), Postives = 283/452 (62.61%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVT---GEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLA-----ESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEI----AEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CEI+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK     GE  +  SA +                     C+G A + +     + +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:  496 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQGEPGAGCSAHADG-------------------CDGSAVNCSIFGRKKKQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 916          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0301328)

HSP 1 Score: 374.4 bits (960), Expect = 6.939e-122
Identity = 193/462 (41.77%), Postives = 283/462 (61.26%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE----------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVT---GEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLA-----ESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIA----EFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CE          I+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK     GE  +  SA +                     C+G A + +     + +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:  179 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQGEPGAGCSAHADG-------------------CDGSAVNCSIFGRKKKQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 609          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0084161)

HSP 1 Score: 379.793 bits (974), Expect = 9.565e-121
Identity = 189/444 (42.57%), Postives = 278/444 (62.61%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIA----EFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CEI+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK   E+ +      C+ F  ++                        +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:  496 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQVN------CSIFGRKK-----------------------KQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 898          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0112872)

HSP 1 Score: 370.548 bits (950), Expect = 1.404e-120
Identity = 189/454 (41.63%), Postives = 278/454 (61.23%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE----------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIA----EFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CE          I+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK   E+ +      C+ F  ++                        +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:  179 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQVN------CSIFGRKK-----------------------KQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 591          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caskb (calcium/calmodulin-dependent serine protein kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-4473])

HSP 1 Score: 342.428 bits (877), Expect = 5.227e-111
Identity = 177/475 (37.26%), Postives = 275/475 (57.89%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNC-----------------------------------EIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +C                                   +IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                                      C  + + +K Y   +L   + +   YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I +  ++ +LDVEPQAL++LR  EF+P+VVFI+ P    ++ +  E  D  L++L ++SE L+  Y  + D  I+N  I+DT++ + +A+  + S +QW+PV+W+Y
Sbjct:   54 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSLSCDKESPDLSRQSPANGHSSVTSSILDLPSTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------------------CTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLIAKHPDKFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTRLETIRKIHELNMVAILDVEPQALKVLRTAEFSPYVVFIAAP---TITPAMTE--DESLQRLQKESEALQHSYAHYFDQTIINNEIDDTIRLLEEAVELVCSTAQWVPVSWVY 484          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 348.206 bits (892), Expect = 1.614e-108
Identity = 179/475 (37.68%), Postives = 276/475 (58.11%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LH+GDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P +D ++P  +  + F VGDI++II+KDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I +  +I +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y  + D  I+N  I++T++ + +A++ + S +QW+PV+W+Y
Sbjct:  466 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHIGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPSTSRQSPANGHSSINSSILDLPSTIQPKGRQIYVRAQFEYDPVKDDLIPCKEAGIRFRVGDIIQIINKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMNE--DESLQRLQKESEILQKTYAHYFDQTIINNEIDETIRLLEEAIDMVCSTAQWVPVSWVY 901          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 347.436 bits (890), Expect = 4.811e-108
Identity = 179/475 (37.68%), Postives = 276/475 (58.11%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LH+GDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P +D ++P  +  + F VGDI++II+KDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I +  +I +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y  + D  I+N  I++T++ + +A++ + S +QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHIGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPSTSRQSPANGHSSINSSILDLPSTIQPKGRQIYVRAQFEYDPVKDDLIPCKEAGIRFRVGDIIQIINKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMNE--DESLQRLQKESEILQKTYAHYFDQTIINNEIDETIRLLEEAIDMVCSTAQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 321.627 bits (823), Expect = 3.988e-103
Identity = 167/440 (37.95%), Postives = 259/440 (58.86%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN SEP+G+TL+ ++  RC +ARI+ GG+IHR GSLH GDEI E+N +SV   S++ +Q+ILK  +G V L I+ N    P  CE+Y++A FDY+P++D ++P  +  L F  GDI+ II+K D NWWQ + +D      A LIPS ELQE R  +         K +  + +SC+PF  ++K + K             HS              ++DQL +         YEEV+ +  F+R++L+L+GAHGVGR  IKN+L+  +P  F+ P PHT++    ++ NGK+Y+F+S+++M   I  N  LEYG     ++G K+ET+ +I +   I VLDVEPQ L++LR  EFAP V+FI+P +    S++ + I         ++S+ L   +R F D  +VN  ++++VK +  A+    S+ QW+P++W+Y
Sbjct:   74 VAFEKNPSEPLGVTLKLNEKQRCTVARILHGGMIHRQGSLHEGDEIAEINGKSVSNQSVDQLQKILKDTNGVVTLKIISNQQSRPMACEMYMRAQFDYDPAKDELIPCKEAGLKFQTGDIIHIINKKDPNWWQGK-VDSSSTDFAGLIPSPELQEWRVASK-------SKATREAGQSCSPFGKKKKCKDKYL---------AKHS-------------SIFDQLDVI-------SYEEVVRLPAFNRKTLVLIGAHGVGRSLIKNSLLSKYPEKFAYPAPHTTRPQKKDEENGKEYYFISNDEMTKGIVGNELLEYGSYQGHMFGTKIETIHKIHEQGKIAVLDVEPQTLKVLRTAEFAPLVIFIAPTNTGNQSEAVQNI--------QKESDSLLAAHRHFFDEILVNNDVDESVKGVEDAIERASSSPQWVPISWVY 468          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 302.368 bits (773), Expect = 8.747e-96
Identity = 162/430 (37.67%), Postives = 250/430 (58.14%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSN 1701
            +   KN SEP+G+TL+ ++  RC +ARI+ GG+IHR GSLH GDEI E+N +SV   S++ +Q+ILK  +G V L I+ N    P  CE+Y++A FDY+P++D ++P  +  L F  GDI+ II+K D NWWQ + +D      A LIPS ELQE R  +         K +  + +SC+PF  ++K + K             HS              ++DQL +         YEEV+ +  F+R++L+L+GAHGVGR  IKN+L+  +P  F+ P PHT++    ++ NGK+Y+F+S+++M   I  N  LEYG     ++G K+ET+ +I +   I VLDVEPQ L++LR  EFAP V+FI+P +    S++ + I         ++S+ L   +R F D  +VN  ++++VK +  A+    S+
Sbjct:   74 VAFEKNPSEPLGVTLKLNEKQRCTVARILHGGMIHRQGSLHEGDEIAEINGKSVSNQSVDQLQKILKDTNGVVTLKIISNQQSRPMACEMYMRAQFDYDPAKDELIPCKEAGLKFQTGDIIHIINKKDPNWWQGK-VDSSSTDFAGLIPSPELQEWRVASK-------SKATREAGQSCSPFGKKKKCKDKYL---------AKHS-------------SIFDQLDVI-------SYEEVVRLPAFNRKTLVLIGAHGVGRSLIKNSLLSKYPEKFAYPAPHTTRPQKKDEENGKEYYFISNDEMTKGIVGNELLEYGSYQGHMFGTKIETIHKIHEQGKIAVLDVEPQTLKVLRTAEFAPLVIFIAPTNTGNQSEAVQNI--------QKESDSLLAAHRHFFDEILVNNDVDESVKGVEDAIERASSS 458          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 369.007 bits (946), Expect = 1.572e-116
Identity = 183/440 (41.59%), Postives = 277/440 (62.95%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CEIYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++ S  E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ +  A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPSISE--DESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 885          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 360.918 bits (925), Expect = 3.667e-113
Identity = 183/452 (40.49%), Postives = 277/452 (61.28%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++ S  E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ +  A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPSISE--DESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 903          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 352.058 bits (902), Expect = 1.079e-109
Identity = 183/475 (38.53%), Postives = 277/475 (58.32%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++ S  E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ +  A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPSISE--DESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 352.058 bits (902), Expect = 1.208e-109
Identity = 183/475 (38.53%), Postives = 277/475 (58.32%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++ S  E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ +  A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPSISE--DESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 349.362 bits (895), Expect = 9.797e-109
Identity = 181/466 (38.84%), Postives = 276/466 (59.23%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE--------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                          IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                                      C  + + +K Y   +L   + +   YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++ S  E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ +  A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSVRPIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------------------CTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPSISE--DESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 912          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 359.377 bits (921), Expect = 4.397e-113
Identity = 181/452 (40.04%), Postives = 278/452 (61.50%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  459 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 871          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 359.762 bits (922), Expect = 5.725e-113
Identity = 181/452 (40.04%), Postives = 278/452 (61.50%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 897          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 355.525 bits (911), Expect = 2.786e-111
Identity = 181/463 (39.09%), Postives = 278/463 (60.04%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                       IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 908          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 351.288 bits (900), Expect = 1.703e-109
Identity = 181/475 (38.11%), Postives = 278/475 (58.53%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Mpp1 (membrane protein, palmitoylated [Source:MGI Symbol;Acc:MGI:105941])

HSP 1 Score: 315.079 bits (806), Expect = 1.204e-100
Identity = 162/440 (36.82%), Postives = 259/440 (58.86%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            I   K   EPMG+TL+ ++   C +ARI+ GG+IHR GSLHVGDEI+E+N  +V   S++ +Q+ +K   G + L ++ N     P  +++++A FDY+P +D+++P  +  L F  GDI++II+KDD+NWWQ + ++      A LIPS ELQE R V S+      E      A SC+PF  ++K + K             HS              ++DQL +         YEEV+ +  F R++L+L+GA GVGR HIKN L+   P  F+ P P+T++ P  ++ +GK+YHF+S E+M  +I+ N +LE+G     ++G K ETV QI +   I +LD+EPQ L+ +R  E +PF+VFI+P      +++        L++L +DSE +   Y  + D+ +VN S+++T+K + +A ++  S+ QW+PV+W+Y
Sbjct:   72 IQFEKITEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIANQQSRLPALQMFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQIINKDDSNWWQGR-VEGSSKESAGLIPSPELQEWR-VASVAHSAPSE------APSCSPFGKKKKCKDKYL---------AKHS-------------SIFDQLDVV-------SYEEVVRLPAFKRKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVFIAPTDQGTQTEA--------LQQLQKDSEAIRSQYAHYFDLSLVNNSVDETLKKLQEAFDQACSSPQWVPVSWVY 466          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|Q24210|CSKP_DROME (Peripheral plasma membrane protein CASK OS=Drosophila melanogaster OX=7227 GN=CASK PE=1 SV=4)

HSP 1 Score: 379.793 bits (974), Expect = 9.588e-120
Identity = 189/444 (42.57%), Postives = 278/444 (62.61%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIA----EFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+  ++GRC++ARIM GG+IHR  +LHVGDEI E+N + V   S+  +QR+L+ A GSV   IVP+    PP CEI+V+A FDY P +D ++P +Q  ++F VGDIL+IISKDD++WWQA+ LD  V   A LIPS ELQE R     +DK   E+ +      C+ F  ++                        +CR+ + ++      +     L+   YEEV+++      F R++L+LLGAHGVGRRHIKN LI  +P  ++ P+PHT++     + NG+ Y+FVSH++M++DI  N YLEYG  +D +YG KL+T+R+I     + +LDVEPQAL++LR  EF P+VVFI+ P L  ++D     +DG LE+L ++SE+L  LY  F D+ IVN  I +T+  +  A++ +H+  QW+PV+W+Y
Sbjct:  496 VQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDT-VGGSAGLIPSPELQEWRIACQTVDKTKQEQVN------CSIFGRKK-----------------------KQCRDKYLAKH-----NAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIAD-----YDGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 898          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|P54936|LIN2_CAEEL (Protein lin-2 OS=Caenorhabditis elegans OX=6239 GN=lin-2 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 9.590e-114
Identity = 185/453 (40.84%), Postives = 269/453 (59.38%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQ-------------DVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   K+  EPMG+TL+ +++GRC +ARIM GG+IHR  +LHVGDEI E+N  SV   S+E +Q +L+ A G V   I+P+    PP CEI+V+A FDYEPS+D ++P  Q  + F  GDIL++ISKDD+NWWQA+ +               +    A LIPS ELQE R     +++         S  +CN                   C            +   +   L+DQL L         YEEV+ ++++ R++L+LLGAHGVGRRHIKN LI   P+ F+ P+PHT++ P  ++++GK Y+FV++EQM++DI NN YLEYG  ++ +YG KLET+R I +   I +LDVEPQAL++LR  E++PFVVFI+ P+L  + D      DG LEKL  +S++L   +    D  I N  I+DT+  + + + +L +  QW+PV W+Y
Sbjct:  547 VQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMER---------SKNTCNTH-----------------CMWFNKKKKYYTTKYLQKHSALFDQLDLVT-------YEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDP-----DGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 961          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|O14936|CSKP_HUMAN (Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK PE=1 SV=3)

HSP 1 Score: 351.288 bits (900), Expect = 1.238e-108
Identity = 181/475 (38.11%), Postives = 278/475 (58.53%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|O70589|CSKP_MOUSE (Peripheral plasma membrane protein CASK OS=Mus musculus OX=10090 GN=Cask PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 1.576e-108
Identity = 181/475 (38.11%), Postives = 278/475 (58.53%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                                   IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EFAPFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|Q62915|CSKP_RAT (Peripheral plasma membrane protein CASK OS=Rattus norvegicus OX=10116 GN=Cask PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.254e-107
Identity = 178/463 (38.44%), Postives = 276/463 (59.61%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +CE                       IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                                      C  + + +K Y   +L   + +   YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG KLET+R+I +  +I +LDVEPQAL++LR  EF PFVVFI+ P    ++    E  D  L++L ++S++L+  Y  + D+ I+N  I++T++ + +A+  + +  QW+PV+W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------------------CTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPERFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFPPFVVFIAAP---TITPGLNE--DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 909          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A267G0P4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005720g1 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.128e-135
Identity = 208/440 (47.27%), Postives = 280/440 (63.64%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN +EPMG+TL+   +G+ ++ARIM GG+IHR G+LHVGDEI E+N E V+G S+E +QR+LK A GSV L IVP+    P  CEIYVKAMF+Y P ED + P  Q  + F VGDIL++ISKDD+NWWQA+  +    +PA LIPS ELQE R   S +++    KK   +      F  R                G   S A SK             +   L  LE   YEEV+ +A F R++L+LLGAHGVGRRHIKN LIQ+ P  ++ P+PHT++ P  N++NG++Y FVS E+M+ DI NN YLEYG  +D +YG KL+T+R I +   I +LDVEPQALR+LR  EFAPFV FI+ P L  +SD    + DG LE+L ++SELLE  Y  + D++IVN  IE+T+  + Q ++++ +  QWIPV W+Y
Sbjct:   73 VQFQKNTNEPMGITLKMSDDGKIIVARIMHGGMIHRQGTLHVGDEIREINGEPVLGQSVEALQRLLKEARGSVTLKIVPSYRNHPMQCEIYVKAMFNYSPDEDDLNPCPQAGIRFRVGDILQVISKDDHNWWQAREWNAPPGTPASLIPSPELQEWRTACSAIERA---KKDTVNCTGLFSFARR----------------GKHRSGAASK-----------QAVGATLDQLEMVTYEEVVHLANFRRKTLVLLGAHGVGRRHIKNTLIQASPDRYAYPIPHTTRPPNKNEVNGRNYFFVSREEMMRDITNNEYLEYGTHEDAMYGTKLDTIRDIHRQGKIAILDVEPQALRVLRTAEFAPFVAFIAAPELSAMSD-VHGLNDGSLERLAKESELLERQYGHYFDLKIVNNDIEETIGQLRQWIDQVQTKPQWIPVNWVY 481          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A564YFJ6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5869 PE=3 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 5.991e-131
Identity = 205/440 (46.59%), Postives = 285/440 (64.77%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   K   EPMG+TL+ ++  +C++ARIM GG+IHR G+LHVGDE+ E+N+E V G S+E++QR L+ A GSV L IVP+    P  CEIYV+AMF+Y P  D ++P +Q  + F+VGDIL+IISKDD+NWWQA+    D  SPA LIPS ELQE RA    ++   G   +N    SC  + +R+K+            N      A  + R+ F    +YDQL LF        YEEV+ +  F RR+L+LLGAHGVGRRHIKN LIQS P  ++ P+PHT++AP  +++ GK+Y+FV+ E+M+ DI NN YLEYG  +  +YG KL+T+RQI    +I +LDVEPQAL++LR  EFAP V+FI+ P L+ +        DG LE+L  +S+LLE  +  F DM+I+N  +E+T+K +   + E+    QWIPV W+Y
Sbjct:  517 VQFQKTTDEPMGITLKLNEEDKCIVARIMHGGMIHRQGTLHVGDELREINSEPVYGKSVEYLQRKLREARGSVTLKIVPSYRTNPIQCEIYVRAMFNYNPDADELIPCTQAGIRFHVGDILQIISKDDHNWWQARLWGSDPQSPAGLIPSPELQEWRAANHAVEFSHGH--NNQQVVSCGSWFMRKKRG-----------NQSTSRSASDRTRHSF----IYDQLDLFT-------YEEVVRLPSFRRRTLVLLGAHGVGRRHIKNCLIQSAPDKYAYPIPHTTRAPRKDEVYGKNYYFVTQEEMMRDITNNEYLEYGTHEQAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVIFIAAPDLNSIFADLHCPNDGSLERLARESQLLEQHFEHFFDMKIINNDMEETIKKLQTGIEEIQVRPQWIPVTWVY 932          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A158QEK5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7549 PE=3 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 7.934e-131
Identity = 205/440 (46.59%), Postives = 285/440 (64.77%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   K   EPMG+TL+ ++  +C++ARIM GG+IHR G+LHVGDE+ E+N+E V G S+E++QR L+ A GSV L IVP+    P  CEIYV+AMF+Y P  D ++P +Q  + F+VGDIL+IISKDD+NWWQA+    D  SPA LIPS ELQE RA    ++   G   +N    SC  + +R+K+            N      A  + R+ F    +YDQL LF        YEEV+ +  F RR+L+LLGAHGVGRRHIKN LIQS P  ++ P+PHT++AP  +++ GK+Y+FV+ E+M+ DI NN YLEYG  +  +YG KL+T+RQI    +I +LDVEPQAL++LR  EFAP V+FI+ P L+ +        DG LE+L  +S+LLE  +  F DM+I+N  +E+T+K +   + E+    QWIPV W+Y
Sbjct:  523 VQFQKTTDEPMGITLKLNEEDKCIVARIMHGGMIHRQGTLHVGDELREINSEPVYGKSVEYLQRKLREARGSVTLKIVPSYRTNPIQCEIYVRAMFNYNPDADELIPCTQAGIRFHVGDILQIISKDDHNWWQARLWGSDPQSPAGLIPSPELQEWRAANHAVEFSHGH--NNQQVVSCGSWFMRKKRG-----------NHSTSRSASDRTRHSF----IYDQLDLFT-------YEEVVRLPSFRRRTLVLLGAHGVGRRHIKNCLIQSAPDKYAYPIPHTTRAPRKDEVYGKNYYFVTQEEMMRDITNNEYLEYGTHEQAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVIFIAAPDLNSIFADLHCPNDGSLERLARESQLLEQHFEHFFDMKIINNDMEETIKKLQTGIEEIQVRPQWIPVTWVY 938          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A267FPT3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029367g1 PE=3 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 4.175e-130
Identity = 208/440 (47.27%), Postives = 280/440 (63.64%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN +EPMG+TL+   +G+ ++ARIM GG+IHR G+LHVGDEI E+N E V+G S+E +QR+LK A GSV L IVP+    P  CEIYVKAMF+Y P ED + P  Q  + F VGDIL++ISKDD+NWWQA+  +    +PA LIPS ELQE R   S +++    KK   +      F  R                G   S A SK             +   L  LE   YEEV+ +A F R++L+LLGAHGVGRRHIKN LIQ+ P  ++ P+PHT++ P  N++NG++Y FVS E+M+ DI NN YLEYG  +D +YG KL+T+R I +   I +LDVEPQALR+LR  EFAPFV FI+ P L  +SD    + DG LE+L ++SELLE  Y  + D++IVN  IE+T+  + Q ++++ +  QWIPV W+Y
Sbjct:  496 VQFQKNTNEPMGITLKMSDDGKIIVARIMHGGMIHRQGTLHVGDEIREINGEPVLGQSVEALQRLLKEARGSVTLKIVPSYRNHPMQCEIYVKAMFNYSPDEDDLNPCPQAGIRFRVGDILQVISKDDHNWWQAREWNAPPGTPASLIPSPELQEWRTACSAIERA---KKDTVNCTGLFSFARR----------------GKHRSGAASK-----------QAVGATLDQLEMVTYEEVVHLANFRRKTLVLLGAHGVGRRHIKNTLIQASPDRYAYPIPHTTRPPNKNEVNGRNYFFVSREEMMRDITNNEYLEYGTHEDAMYGTKLDTIRDIHRQGKIAILDVEPQALRVLRTAEFAPFVAFIAAPELSAMSD-VHGLNDGSLERLAKESELLERQYGHYFDLKIVNNDIEETIGQLRQWIDQVQTKPQWIPVNWVY 904          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A0R3WJ93 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS730 PE=3 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 5.708e-130
Identity = 211/468 (45.09%), Postives = 293/468 (62.61%), Query Frame = 1
Query:  346 SRINRMEMSQDFSDSVSSQAVTIT------INKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            S  N  E  +D +D  +     IT        K   EPMG+TL+ ++  +C++ARIM GG+IHR G+LHVGDE+ E+NAE V+G S+E++QR L+ A GSV L IVP+    P  CEIYV+AMF+Y P  D ++P +Q  + F+VGDIL+IISKDD+NWWQA+    D  SPA LIPS E QE RA     +   G    N    +C  + +++K+            +G   S +E   R  +    +YDQL L+        YEEV+ +  F RR+L+LLGAHGVGRRHIKN LIQS P  ++ P+PHT++AP  +++ GK+Y+FV+ E+M+ DI NN YLEYG  +  +YG KL+T+RQI    +I +LDVEPQAL++LR  EFAP V+FI+ P L+ +        DG LE+L  +S+LLE  +  F DM+IVN  +E+T+K +   + E  +  QWIPV WIY
Sbjct:  466 STTNSDEGGKDDADCPADSGHHITRVRLVQFQKTTDEPMGITLKLNEEDKCIVARIMHGGMIHRQGTLHVGDELREINAEPVLGKSVEYLQRRLREARGSVTLKIVPSYRTNPIQCEIYVRAMFNYNPEADELIPCTQAGIRFHVGDILQIISKDDHNWWQARLWGSDPQSPAGLIPSPEFQEWRAANRAAEYSHGH--GNQQVVNCGSWFMKKKRGN----------HGSGRSSSE---RTRYSV--MYDQLDLYT-------YEEVVRLPTFRRRTLVLLGAHGVGRRHIKNCLIQSAPDKYAYPIPHTTRAPRKDEVYGKNYYFVTQEEMMRDITNNEYLEYGTHEQAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVIFIAAPDLNTIFSDLNCPNDGSLERLARESQLLEQHFEHFFDMKIVNNDMEETIKKLHCGIEEFQTRPQWIPVTWIY 909          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caskb (calcium/calmodulin-dependent serine protein kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-4473])

HSP 1 Score: 367.466 bits (942), Expect = 2.007e-116
Identity = 179/440 (40.68%), Postives = 278/440 (63.18%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+   +  +C+I+V+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I +  ++ +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE L+  Y  + DM I+N  I+DT++ + +A++ + + +QW+PV+W+Y
Sbjct:  454 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSLSCDIFVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLIAKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTRLETIRKIHEQGMVSILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMNE--DESLQRLQKESEALQKSYAHYFDMTIINNEIDDTIRLLEEAIDLVSTTAQWVPVSWVY 854          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 363.229 bits (931), Expect = 1.763e-114
Identity = 178/440 (40.45%), Postives = 277/440 (62.95%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LHVGDEI E+N+ SV   ++E +Q++L+   GS+   IVP+   +  +CEIYV+A F+Y+P++D ++P  +  + F VGDI++II+KDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                                      C  + + +K Y   +L   + +   YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P   + NGK+Y+FVSH+QM+ DIANN YLEYG  +D +YG +LET+R+I +  +I +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y  + D+ I+N  I++T++ + +A++ + +  QW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------------------CTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMNE--DESLQRLQKESEILQKTYAHYFDLTIINNEIDETIRHLEEAIDLVCTTGQWVPVSWVY 880          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 330.872 bits (847), Expect = 1.149e-106
Identity = 169/440 (38.41%), Postives = 266/440 (60.45%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN SEPMG+TL+ ++  +C +ARI+ GG+IHR GSLH GDEI E+N +SV   S++ +Q+ILK   G V L ++PN       CE Y++A FDY+P++D ++P  +  L F  GDI++II+K D NWWQ + +D      A L+PS ELQE RA +         KK+  +++SC+PF  ++K + K             HS              ++DQL +         YEEV+++  F+R++L+L+GA GVGR HIK++L+  +P  F+ P PHT++ P  ++ +G++Y+FVS+++M   I  N +LEYG     ++G K+ET+ +I +   I +LDVEPQ L+LLR  +FAP VVFI P +    S++        L+ + ++SE +   YR F D+ +VN  ++++VK + +AL    S+ QW+PV+W+Y
Sbjct:   87 VAFEKNPSEPMGVTLKLNEKQKCTVARILHGGMIHRQGSLHEGDEIAEINGKSVANQSVDQLQKILKDTTGIVTLKVIPNQRNRLMVCETYMRAQFDYDPAKDDLIPCKEAGLKFQTGDIIQIINKGDPNWWQGR-VDSSAKDFAGLLPSPELQEWRAASK-------SKKTGEASQSCSPFGKKKKCKDKYL---------AKHS-------------SIFDQLDVI-------SYEEVVQLPAFNRKTLVLIGAPGVGRSHIKSSLLTKYPEKFAYPAPHTTRPPKKDEESGQEYYFVSNDEMTKCIVGNEFLEYGSFQGNMFGTKIETILKIHEQGKIALLDVEPQTLKLLRTADFAPLVVFIGPTNTGNQSEA--------LQAIQKESEAIHSTYRHFFDLTLVNNDVDESVKGVEEALERASSSPQWVPVSWVY 481          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 329.717 bits (844), Expect = 2.742e-105
Identity = 169/440 (38.41%), Postives = 266/440 (60.45%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN SEPMG+TL+ ++  +C +ARI+ GG+IHR GSLH GDEI E+N +SV   S++ +Q+ILK   G V L ++PN       CE Y++A FDY+P++D ++P  +  L F  GDI++II+K D NWWQ + +D      A L+PS ELQE RA +         KK+  +++SC+PF  ++K + K             HS              ++DQL +         YEEV+++  F+R++L+L+GA GVGR HIK++L+  +P  F+ P PHT++ P  ++ +G++Y+FVS+++M   I  N +LEYG     ++G K+ET+ +I +   I +LDVEPQ L+LLR  +FAP VVFI P +    S++        L+ + ++SE +   YR F D+ +VN  ++++VK + +AL    S+ QW+PV+W+Y
Sbjct:  157 VAFEKNPSEPMGVTLKLNEKQKCTVARILHGGMIHRQGSLHEGDEIAEINGKSVANQSVDQLQKILKDTTGIVTLKVIPNQRNRLMVCETYMRAQFDYDPAKDDLIPCKEAGLKFQTGDIIQIINKGDPNWWQGR-VDSSAKDFAGLLPSPELQEWRAASK-------SKKTGEASQSCSPFGKKKKCKDKYL---------AKHS-------------SIFDQLDVI-------SYEEVVQLPAFNRKTLVLIGAPGVGRSHIKSSLLTKYPEKFAYPAPHTTRPPKKDEESGQEYYFVSNDEMTKCIVGNEFLEYGSFQGNMFGTKIETILKIHEQGKIALLDVEPQTLKLLRTADFAPLVVFIGPTNTGNQSEA--------LQAIQKESEAIHSTYRHFFDLTLVNNDVDESVKGVEEALERASSSPQWVPVSWVY 551          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 292.352 bits (747), Expect = 6.745e-88
Identity = 147/364 (40.38%), Postives = 219/364 (60.16%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALR 1467
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LHVGDEI E+N+ SV   ++E +Q++L+   GS+   IVP+   +  +CE            IYV+A F+Y+P++D ++P  +  + F VGDI++II+KDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P   + NGK+Y+FVSH+QM+ DIANN YLEYG  +D +YG +LET+R+I +  +I +LDVEPQ ++
Sbjct:  500 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEDLPLTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQVIK 829          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 1.663e-80
Identity = 156/454 (34.36%), Postives = 239/454 (52.64%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRA--VTSILD--KVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVL----------SDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            + I K   +P+G+T R + +   VIARI+ GG+I + G LHVGD I EVN   V  D    +QR L+ A GSV L I+P+  R  P  +++VK  FDY P +D ++P  +  L F  GDIL+I+S++D +WWQA  +       A LIPS  L+E R   V    D   V+GE+                             C GV     + K          +D+  + +       YEEV ++  F R++L+L+GA GVGRR +KN L+ + P  +   VP TS+ P  ++  G+ Y+FVS   M +DI    YLE G+ +  LYG K+E++  +++   + +LDV PQAL++LR  EF PFVVF++ P L+ L            ++K + D  L+K  ++S  ++  Y  F D++IVN +++     +  AL  L    QW+P++W+Y
Sbjct:   49 VGIRKVEGQPLGVTFRVESS-ELVIARILRGGMIDQQGLLHVGDVIREVNGRDVTNDPAG-LQRFLREATGSVVLKILPSYTRSSPPAQVFVKCYFDYNPEDDQLIPCKEAGLRFNRGDILQIVSQEDPDWWQALKVKDG--GSAGLIPSQTLEEKRKAYVRHEWDYTGVSGERG---------------------------FC-GVLGGKKKKKMMYMSTKNAEFDRHEILI-------YEEVAKMPPFQRKTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFVSRADMEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPTLETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMDVAFAKLRAALEGLGKGPQWVPISWVY 463          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008487.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 2.388e-74
Identity = 153/451 (33.92%), Postives = 239/451 (52.99%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPN-CEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSD----------STKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            + I K   EP+G+T R + N   VIARI+ GG+I + G LHVGD I EVN   V  D       +L+ A GSV L I+P+ +  P N   ++VK  FDY P++D ++P  +  L F  GD+L+I+S+DD +WWQA    QD  S A L+PS  L+E R       K    ++ N ++ S                    +C GV     + K          +D+  + +       YEE+ ++  F R++L+L+GA GVGRR +KN L+ S P  +   +P TS+ P  ++ +G+ YHFV+   M  DI +  YLE G+ +  LYG K+E+   +++   + +LDV PQAL+LLR  EF P+VVFI+ P +++L            + K + D  L+K  ++S  ++  Y  + D+ IVN ++++    +   L  L    QW+P+ W+Y
Sbjct:  135 VGIRKMEGEPLGVTFRVESN-ELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSNDP------VLREATGSVVLKILPS-YTLPQNPAPLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKA-QDGGS-AGLVPSQTLEEKR-------KAYVRQEMNFTSASGG-----------------ALC-GVLGGKKKKKLMYMSTKNAEFDRHEILI-------YEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIES-HGVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 542          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008482.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.121 bits (614), Expect = 3.358e-72
Identity = 154/465 (33.12%), Postives = 241/465 (51.83%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPN--------------CE-IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSD----------STKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            + I K   EP+G+T R + N   VIARI+ GG+I + G LHVGD I EVN   V  D        L+ A GSV L I+P+ +  P N              C+ ++VK  FDY P++D ++P  +  L F  GD+L+I+S+DD +WWQA    QD  S A L+PS  L+E R       K    ++ N ++ S                    +C GV     + K          +D+  + +       YEE+ ++  F R++L+L+GA GVGRR +KN L+ S P  +   +P TS+ P  ++ +G+ YHFV+   M  DI +  YLE G+ +  LYG K+E++  +++   + +LDV PQAL+LLR  EF P+VVFI+ P +++L            + K + D  L+K  ++S  ++  Y  + D+ IVN ++++    +   L  L    QW+P+ W+Y
Sbjct:  135 VGIRKMEGEPLGVTFRVESN-ELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSNDPY------LREATGSVVLKILPS-YTLPQNPAPVRTDRYPLHHVCQQLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKA-QDGGS-AGLVPSQTLEEKR-------KAYVRQEMNFTSASGG-----------------ALC-GVLGGKKKKKLMYMSTKNAEFDRHEILI-------YEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIESI-GVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 556          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 207.608 bits (527), Expect = 1.456e-59
Identity = 131/458 (28.60%), Postives = 231/458 (50.44%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRK-DKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVP--NNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDL-EFSPYEEVIEIAEF---SRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDS------------TKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWI 1728
            I + KN  EP+G T+R+ ++ G  V+ARIM GG   R G ++VGDE+ EVN   V     E V +IL  +  ++   IVP   +  +  + +IY++  FDY P  D  +P  +  L F  G++L+++S+DD+ WWQA+  +Q  +  A LIPS    E R                A+ +  +P ++++  + +         +G+  S   S+ ++   S+ +Y+       D  E S YEEV++         R ++L+G  GVG   +K  LI S P L+S  VP T++   +++ + K+Y+FVS     +D+ NN ++EYG+    LYG  ++ +R ++    + +LDV P A++ +R  EF PFV+F+ PP L+ L  +             +   D   +++   +  +E  +    D  +VN  +    + +  A + L   + W+P++W+
Sbjct:  140 IRLVKN-KEPLGATIRRHEETGAIVVARIMRGGAADRSGLINVGDELKEVNGVRVDNKEPEEVIQILAQSQSAITFKIVPAFKDESQSKDTKIYLRTFFDYNPRGDVAIPCKEAGLPFLRGEVLQVVSQDDSMWWQAKRTEQS-NMRAGLIPSKHYMERRL---------------AARQPASPPIVQKSSKSR--------LSGLRRSFRLSR-QSRKTSKLMYESKRSAEYDASEVSTYEEVLQYQHQPGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVSRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKSSGDKNPARNFTDEDFQEMLGTAARMEAQFGYLFDKTVVNDELAAAYRELRAAADSLERETMWVPLSWV 571          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 104.76 bits (260), Expect = 7.468e-26
Identity = 43/122 (35.25%), Postives = 81/122 (66.39%), Query Frame = 1
Query: 1153 RRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPP 1518
            +R ++L+G    GR  ++  L++S    F+A  PHT++    N+++G+DYHFVS +   +DI  + ++E+G+ +  LYG  +++VRQ+I    I VL++  Q+L+LL+N +  P+++F++PP
Sbjct:   41 KRPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFVSRQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPP 162          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 76.2554 bits (186), Expect = 1.478e-16
Identity = 37/127 (29.13%), Postives = 70/127 (55.12%), Query Frame = 1
Query: 1156 RSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRN-GEFAPFVVFISPPHLDVL 1533
            R +++ G  G G+  +   L   +P  F   V  T++ P A ++NGKDY+FVS ++  S I NN ++E+ +     YG  + +V+Q+ +     +LD++ Q ++ ++   E     +FI+PP ++ L
Sbjct:    3 RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDL 129          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO39364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA1])

HSP 1 Score: 283.878 bits (725), Expect = 6.588e-85
Identity = 163/482 (33.82%), Postives = 247/482 (51.24%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHG------------------------------------------SLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +  +KN +EPMG+TL+ +  GRCV+ARIM GG+IHR G                                          +LH GDEI E+N  +V   S+E +Q +L+ A G+V   IVP++     N +++V+A+FDY+P  D ++P  +  + F+  +IL++++K D  WWQA+  D + +  A LIPS ELQE R        +  EK    +  SC  F  ++K                       + R   +   ++D+L L         YEEV+++ +F R++L+LLGAHGVGRRHIKN LI  F   F+ P+PHT++ P A + +GK Y+FVS E M+SDI +N YLEYG  +  +YG KL+T+  II+   + +LDVEPQ       GE                           L++L ++S+ L   Y    D+ IVN  I++T+  + +AL  L +  QW+P++WIY
Sbjct:  495 VQFHKNPNEPMGITLKLNDEGRCVVARIMYGGMIHRQGENDPGILSAHIMYSGIIHRQGENNPGILSAHIMYGGMIHRQGTLHPGDEIREINGSNVADKSIEALQSMLRDASGNVTFKIVPSSRGLGTNTDVFVRALFDYDPRSDDLIPCQRAGMAFHCSEILQVVNKADCYWWQAKKPDAN-EEFAGLIPSPELQEWRVAC-----IAAEKSKKQNGASCIWFSRKKKTY---------------------RDRYVAKHNAVFDRLDLVT-------YEEVVKMEKFKRKTLVLLGAHGVGRRHIKNTLINKFADKFAYPIPHTTRDPRAGEEDGKHYYFVSAEVMMSDIESNRYLEYGTHEGAMYGTKLDTITDIIENHKVAILDVEPQ-------GE--------------------------SLKRLAKESDQLRQTYGHLFDLTIVNNDIDETIAQLEEALERLGTTPQWVPISWIY 909          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 261.151 bits (666), Expect = 6.525e-80
Identity = 147/450 (32.67%), Postives = 245/450 (54.44%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSD-STKEIFDGC---------LEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            + ++K+ +E +G+TL+ + N + +I+RI+ GG+I R G LHVGD I EVN + + G+  E +Q  L  + G + L ++P+ +  P  C+++V+A FDY+PS+D  +P     L F  G++L+I+ ++D NWWQA+ +D      A +IPS   +E R          G KK    +K                     +C       ++ K +  ++S K +D         E   YEEV ++  F R++L+++GA GVGRR +KN LI S    F   +PHTS+     + +G+ Y FVS E+M  DI    YLE+G+    +YG K++T+R++++   + V+DV P AL++L+  EF P++V I+ P  + L +  +K + +G          L K  EDSE L   Y  + D+ I N ++E+    +  A+  L ++ QW+PV+W+Y
Sbjct:  105 VGLHKHANEHLGVTLKVEDN-QLIISRIIHGGMIDRQGLLHVGDIIKEVNGKDMSGNPSE-LQDYLAKSTGKITLKVLPSYYESPALCQVFVRAHFDYDPSKDDQIPCQDAGLAFKQGEVLQIVDQEDANWWQAKKVDDS--RAAGIIPSQICEERRRA--------GVKKDKPGSK--------------------FLCG------SKKKQKVMYKSSKNFD-----FEKHELPIYEEVAKMPPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWVY 511          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 201.83 bits (512), Expect = 9.629e-57
Identity = 136/485 (28.04%), Postives = 226/485 (46.60%), Query Frame = 1
Query:  331 EYHSGSRINRMEMSQ-DFSDSVSSQAVTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNN---WREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKS-CNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKL--YDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLD---VLSDSTKEIFDGCLEKLCEDSELLEML---------YRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWI 1728
            E + G  ++R   S  D S  +   +V I       +P+G T+ K+++G  +I RI+ GG   + G LH GDEI+E+N   + G S+  V  +L   +G++   +VP          +  ++V+A FDY+P +D  +P  ++ L F  GDIL ++ ++D NWWQA    ++    A LIPS   Q+ R           EK +  S K  C     R+K                   L  ++    FE +++  YD++ L    L  +P           +R ++L+G   +GR+ ++  LIQ  P  F+  +PHTS+     +IN  DYHFV     ++DI  + ++E+G+  D  YG   + ++ +I      +L++  +AL+ LR     P+V+FIS P  +    L     + F+  L     D E+ EM+         Y  + D  I N   E T   + Q +  L    QW+PV+W+
Sbjct:  169 EENEGRELSRQNSSDADQSSQMEDDSVKIVRIDKSCDPLGATV-KNEDGAVLIGRIVKGGAAEKSGLLHEGDEILEINGVHMKGKSVSEVCELLADMNGTLTFLLVPKTRSIGTLSRDRAVHVRANFDYDPYDDEFIPCRELGLAFRRGDILHVVDQEDQNWWQAWRAGEEGKKLAGLIPSKHFQQQRESMKHTVPADNEKTTEKSKKCLCIKRKRRKKV------------------LYNAQQNEVFEVDQVLTYDEVDL----LHPNPSR---------KRPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVPRHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRALRRGKIDPFNPKLNVALTDREIHEMVAKAREMEEAYGHYFDHTITNTDFERTFDELRQVIARLEDEPQWVPVSWL 621          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO47352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI8])

HSP 1 Score: 167.548 bits (423), Expect = 1.552e-44
Identity = 113/406 (27.83%), Postives = 204/406 (50.25%), Query Frame = 1
Query:  343 GSRINRMEMSQDFSDSVSSQAVT-ITINKNVSEPMGMTLRKDKN-GRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPN---NWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAV-TSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDS 1542
            G    R E     SDS    AV  + + K+  EP+G T++ D++ G  V+ARI+ GG++ R G+L VGD I E+N +SV+G +   V  I++   GSV   ++P    + +   + ++ ++A+F+Y+P+ D ++P  +  L    GDIL+++S++D NWWQA+  D DV++   L+PS + QE R +   +  +    K S+        F  R++K+K              H L++++     + E   D+   +     FSP  +         R +IL+                            TS+     + NG++Y+FVS   M +   N+ ++EYG+    LYG  +++++++I+   + +L V+P+A ++LR  E+ P+ V+I PP L+ L  +
Sbjct:  123 GDGGQRNENGYKGSDSDLELAVKYVRLIKSGKEPLGATVKCDEDTGDIVVARILRGGMVDRSGTLGVGDVIQEINNQSVIGKTTNEVVEIMERLSGSVLFKVIPMKAVDRKSTADTKVRLRALFNYDPANDDLIPCKEAGLPLVKGDILQVVSREDPNWWQARKED-DVNNTIGLVPSKQFQEKRFLFDRLFAETENHKHSSGGVNHVKNFRWRKRKKK-------------EHKLSDAQ-----KDETDGDKALTYEEVTMFSPVND-------KHRLVILI---------------------------DTSRRMRPYEANGREYYFVSRTTMENYAQNSKFIEYGEFRKCLYGTSVDSIKRVIRTGKMCILKVQPKAAKILRRKEYKPYFVYIKPPSLETLRST 475          

HSP 2 Score: 63.5438 bits (153), Expect = 1.363e-10
Identity = 37/164 (22.56%), Postives = 74/164 (45.12%), Query Frame = 1
Query: 1240 SAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +A +  TS+     + NG++Y+FVS   M +   N+ ++EYG+    LYG  +++++++I+   + +L V+P+                                 D  L  + +  E+LE  Y    D+ IVN  +++    +  ALN + +   W+P+ W +
Sbjct:  506 NAVLQDTSRRMRPYEANGREYYFVSRTTMENYAQNSKFIEYGEFRKCLYGTSVDSIKRVIRTGKMCILKVQPK---------------------------------DEDLHDMIKAGEVLEQEYGHVFDLTIVNDDLDNAFNQLRNALNRVATQPMWVPIEWTH 636          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO37539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE1])

HSP 1 Score: 143.28 bits (360), Expect = 1.403e-39
Identity = 71/196 (36.22%), Postives = 113/196 (57.65%), Query Frame = 1
Query: 1174 GAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSD-STKEIFDGC---------LEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            GA GVGRR +KN LI S    F   +PHTS+     + +G+ Y FVS E+M  DI    YLE+G+    +YG K++T+R++++   + V+DV P AL++L+  EF P++V I+ P  + L +  +K + +G          L K  EDSE L   Y  + D+ I N ++E+    +  A+  L ++ QW+PV+W+Y
Sbjct:    1 GAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWVY 196          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 366.311 bits (939), Expect = 1.470e-115
Identity = 183/446 (41.03%), Postives = 278/446 (62.33%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+      +CE      IYV+A F+Y+PS+D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I Q  ++ +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y    DM I+N  I++T++ + +A++ + + SQW+PV+W+Y
Sbjct:  485 VQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEFSLSTQIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGISE--DESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSTTSQWVPVSWVY 891          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 355.14 bits (910), Expect = 2.140e-111
Identity = 183/475 (38.53%), Postives = 278/475 (58.53%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+      +CE                                   IYV+A F+Y+PS+D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I Q  ++ +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y    DM I+N  I++T++ + +A++ + + SQW+PV+W+Y
Sbjct:  454 VQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEKESPTTSRQSPANGHSSINSSILDLPSTIQPHGRQIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGISE--DESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSTTSQWVPVSWVY 889          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 349.362 bits (895), Expect = 3.510e-109
Identity = 183/489 (37.42%), Postives = 278/489 (56.85%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-------------------------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+      +CE                                                 IYV+A F+Y+PS+D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I Q  ++ +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y    DM I+N  I++T++ + +A++ + + SQW+PV+W+Y
Sbjct:  444 VQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEKESPTTSRQSPANGHSSINSSILDLPSTIQPHGRQIVSRTPIKDKMSVKIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGISE--DESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSTTSQWVPVSWVY 893          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: caskb (peripheral plasma membrane protein CASK [Source:NCBI gene;Acc:101172563])

HSP 1 Score: 340.502 bits (872), Expect = 2.076e-105
Identity = 179/488 (36.68%), Postives = 274/488 (56.15%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE------------------------------------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +    C++ARIM GG+IHR G+LHVGDEI E+N+ SV   ++E +Q++L+   GS+   IVP+   +  +CE                                                IYV+A F+Y+P++D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NG +Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+RQI    ++ +LDVEPQAL++LR  EFAP+VV+I+ P    L+    E  D  L++L  +SE L+  Y  + D  ++N  I+DT++ + +A++ + +  QW+PV+W+Y
Sbjct:  487 VQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSMSCEKESPDLSRQSPANGHASVTSSILDLPSTIQPKGRVVSRPAIKDKLSIKIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKVPFFKRKTLVLLGAHGVGRRHIKNTLIAKHPDRFAYPIPHTTRVPKKDEKNGTNYYFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRQIHAQGMMAILDVEPQALKILRTAEFAPYVVYIAAP---TLTPGLTE--DDSLQRLQLESETLQRTYAHYFDQTVINNEIDDTIRLLEEAVDLVSTAPQWVPVSWVY 935          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 338.191 bits (866), Expect = 8.720e-105
Identity = 176/448 (39.29%), Postives = 266/448 (59.38%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCE-----------------------IYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALN 1686
            +   KN  EPMG+TL+ ++   C++ARIM GG+IHR G+LHVGDEI E+N  SV   ++E +Q++L+   GS+   IVP+      +CE                       IYV+A F+Y+PS+D ++P  +  + F VGDI++IISKDD+NWWQ + L+   +  A LIPS ELQE R     ++K   E++++                          C        + K +   +   ++DQL L         YEEV+++  F R++L+LLGAHGVGRRHIKN LI   P  F+ P+PHT++ P  ++ NGK+Y+FVSH+QM+ DI+NN YLEYG  +D +YG +LET+R+I Q  ++ +LDVEPQAL++LR  EFAP+VVFI+ P    ++    E  D  L++L ++SE+L+  Y    DM I+N  I++T++ + +A++
Sbjct:  485 VQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEKESPTTSRQSPANGHSSINSSILIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGK-LENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQAS--------------------------CTWFGKKKKQYKDKYLAKHNAVFDQLDLVT-------YEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGISE--DESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMD 893          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000062837.1 (SMESG000062837.1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 457/457 (100.00%), Postives = 457/457 (100.00%), Query Frame = 1
Query:  361 MEMSQDFSDSVSSQAVTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            MEMSQDFSDSVSSQAVTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQKKRKKRSSKVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY
Sbjct:    1 MEMSQDFSDSVSSQAVTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQKKRKKRSSKVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 457          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.555e-129
Identity = 196/440 (44.55%), Postives = 286/440 (65.00%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +  G+C++ARIM GG+IHR G+LHVGDEI E+N+ESVVG ++E++Q++LK+A GSV L IVP+    P  CEIYVKAMF+Y P +D ++P SQ  + F +GDIL+IISKDD+NWWQA+            + SAE + +             ++S     +C  F  +++                     +SK +   +   ++DQL L         YEEV+ +  F R++L+LLGAHGVGRRHIKN LIQS P  F+ P+PHT++ P  +++NGK+Y FVSHE+M+ DI NN YLEYG  ++ +YG KL+T+R I    +I +LDVEPQALR+LR  EF+P+VVFI+ P L  ++D    + DG LE+L  +SE+LE+ Y  + D++IVN  IEDT++ + ++++E+ S++QW+PV W+Y
Sbjct:  440 VQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQAR------------LWSAEWRSASLAI---------ERSKQETANCAWFGKKKR---------------------QSKDKYRAKHSGVFDQLDLVT-------YEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 829          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 400.979 bits (1029), Expect = 4.933e-129
Identity = 196/440 (44.55%), Postives = 286/440 (65.00%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +  G+C++ARIM GG+IHR G+LHVGDEI E+N+ESVVG ++E++Q++LK+A GSV L IVP+    P  CEIYVKAMF+Y P +D ++P SQ  + F +GDIL+IISKDD+NWWQA+            + SAE + +             ++S     +C  F  +++                     +SK +   +   ++DQL L         YEEV+ +  F R++L+LLGAHGVGRRHIKN LIQS P  F+ P+PHT++ P  +++NGK+Y FVSHE+M+ DI NN YLEYG  ++ +YG KL+T+R I    +I +LDVEPQALR+LR  EF+P+VVFI+ P L  ++D    + DG LE+L  +SE+LE+ Y  + D++IVN  IEDT++ + ++++E+ S++QW+PV W+Y
Sbjct:  491 VQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQAR------------LWSAEWRSASLAI---------ERSKQETANCAWFGKKKR---------------------QSKDKYRAKHSGVFDQLDLV-------TYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 880          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.309e-128
Identity = 196/440 (44.55%), Postives = 286/440 (65.00%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFVLRQXXXXXXXXXVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLEFSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            +   KN  EPMG+TL+ +  G+C++ARIM GG+IHR G+LHVGDEI E+N+ESVVG ++E++Q++LK+A GSV L IVP+    P  CEIYVKAMF+Y P +D ++P SQ  + F +GDIL+IISKDD+NWWQA+            + SAE + +             ++S     +C  F  +++                     +SK +   +   ++DQL L         YEEV+ +  F R++L+LLGAHGVGRRHIKN LIQS P  F+ P+PHT++ P  +++NGK+Y FVSHE+M+ DI NN YLEYG  ++ +YG KL+T+R I    +I +LDVEPQALR+LR  EF+P+VVFI+ P L  ++D    + DG LE+L  +SE+LE+ Y  + D++IVN  IEDT++ + ++++E+ S++QW+PV W+Y
Sbjct:  510 VQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQAR------------LWSAEWRSASLAI---------ERSKQETANCAWFGKKKR---------------------QSKDKYRAKHSGVFDQLDLV-------TYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 899          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 227.639 bits (579), Expect = 1.591e-64
Identity = 100/192 (52.08%), Postives = 146/192 (76.04%), Query Frame = 1
Query: 1156 RSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWIY 1731
            ++L+LLGAHGVGRRHIKN LIQS P  F+ P+PHT++ P  +++NGK+Y FVSHE+M+ DI NN YLEYG  ++ +YG KL+T+R I    +I +LDVEPQALR+LR  EF+P+VVFI+ P L  ++D    + DG LE+L  +SE+LE+ Y  + D++IVN  IEDT++ + ++++E+ S++QW+PV W+Y
Sbjct:  640 KTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 830          

HSP 2 Score: 186.422 bits (472), Expect = 4.895e-50
Identity = 88/184 (47.83%), Postives = 123/184 (66.85%), Query Frame = 1
Query:  412 ITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWREPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSPARLIP-------SAELQESRAVTSILDKVTGEKKSNASAK 942
            +   KN  EPMG+TL+ +  G+C++ARIM GG+IHR G+LHVGDEI E+N+ESVVG ++E++Q++LK+A GSV L IVP+    P  CEIYVKAMF+Y P +D ++P SQ  + F +GDIL+IISKDD+NWWQA+     +++ A LIP         ++ + +     L    G  K N  AK
Sbjct:  440 VQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPVRNYRNGDRQVWQLKEANKRLQTALGLAKRNDRAK 623          
The following BLAST results are available for this feature:
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK1.938e-11740.04calcium/calmodulin dependent serine protein kinase... [more]
CASK3.520e-11440.68calcium/calmodulin dependent serine protein kinase... [more]
CASK6.684e-11340.04calcium/calmodulin dependent serine protein kinase... [more]
CASK9.488e-11340.04calcium/calmodulin dependent serine protein kinase... [more]
CASK4.187e-11139.09calcium/calmodulin dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-24.091e-11940.84pep chromosome:WBcel235:X:12399517:12406131:-1 gen... [more]
lin-27.539e-11540.84pep chromosome:WBcel235:X:12399517:12414037:-1 gen... [more]
magu-21.067e-4625.66MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.067e-4625.66MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-23.073e-4625.66MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK3.247e-12241.63gene:FBgn0013759 transcript:FBtr0112873[more]
CASK4.032e-12242.70gene:FBgn0013759 transcript:FBtr0301327[more]
CASK6.939e-12241.77gene:FBgn0013759 transcript:FBtr0301328[more]
CASK9.565e-12142.57gene:FBgn0013759 transcript:FBtr0084161[more]
CASK1.404e-12041.63gene:FBgn0013759 transcript:FBtr0112872[more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
caskb5.227e-11137.26calcium/calmodulin-dependent serine protein kinase... [more]
caska1.614e-10837.68calcium/calmodulin-dependent serine protein kinase... [more]
caska4.811e-10837.68calcium/calmodulin-dependent serine protein kinase... [more]
mpp13.988e-10337.95membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
mpp18.747e-9637.67membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wbp111.572e-11641.59WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp113.667e-11340.49WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp111.079e-10938.53WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp111.208e-10938.53WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp119.797e-10938.84WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cask4.397e-11340.04calcium/calmodulin-dependent serine protein kinase... [more]
Cask5.725e-11340.04calcium/calmodulin-dependent serine protein kinase... [more]
Cask2.786e-11139.09calcium/calmodulin-dependent serine protein kinase... [more]
Cask1.703e-10938.11calcium/calmodulin-dependent serine protein kinase... [more]
Mpp11.204e-10036.82membrane protein, palmitoylated [Source:MGI Symbol... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24210|CSKP_DROME9.588e-12042.57Peripheral plasma membrane protein CASK OS=Drosoph... [more]
sp|P54936|LIN2_CAEEL9.590e-11440.84Protein lin-2 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|O14936|CSKP_HUMAN1.238e-10838.11Peripheral plasma membrane protein CASK OS=Homo sa... [more]
sp|O70589|CSKP_MOUSE1.576e-10838.11Peripheral plasma membrane protein CASK OS=Mus mus... [more]
sp|Q62915|CSKP_RAT1.254e-10738.44Peripheral plasma membrane protein CASK OS=Rattus ... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G0P41.128e-13547.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A564YFJ65.991e-13146.59Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A158QEK57.934e-13146.59Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A267FPT34.175e-13047.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3WJ935.708e-13045.09Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
caskb2.007e-11640.68calcium/calmodulin-dependent serine protein kinase... [more]
caska1.763e-11440.45calcium/calmodulin-dependent serine protein kinase... [more]
mpp11.149e-10638.41membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
mpp12.742e-10538.41membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
caska6.745e-8840.38calcium/calmodulin-dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004699.11.663e-8034.36pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
ENSPMAT00000008487.12.388e-7433.92pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
ENSPMAT00000008482.13.358e-7233.12pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
mpp7a1.456e-5928.60membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
MPP57.468e-2635.25membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK11.478e-1629.13Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393646.588e-8533.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375386.525e-8032.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335779.629e-5728.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473521.552e-4427.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375391.403e-3936.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK1.470e-11541.03calcium/calmodulin dependent serine protein kinase... [more]
CASK2.140e-11138.53calcium/calmodulin dependent serine protein kinase... [more]
CASK3.510e-10937.42calcium/calmodulin dependent serine protein kinase... [more]
caskb2.076e-10536.68peripheral plasma membrane protein CASK [Source:NC... [more]
CASK8.720e-10539.29calcium/calmodulin dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062837.10.000e+0100.00SMESG000062837.1[more]
SMESG000060582.11.555e-12944.55SMESG000060582.1[more]
SMESG000060582.14.933e-12944.55SMESG000060582.1[more]
SMESG000060582.11.309e-12844.55SMESG000060582.1[more]
SMESG000060582.11.591e-6452.08SMESG000060582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011594 ID=SMED30011594|Name=Peripheral plasma membrane protein CASK|organism=Schmidtea mediterranea sexual|type=transcript|length=1839bp
TCCGATCTCGGAAGTATTGATTAGCTGCACCGAGAAATCAATTATGGAGC
TGCTTTCTACTGCTGCCATTAGGCAGTTGTGCGCACGTGATTCTATCTAG
CCCAAATGAAATCTATTGATTAGTCGATTTGGTAGCCAATATTTTCCCCG
GATTGCCTCGATAATGTTGATCTGCTTCGTTGTTTATCATTTCACTGATT
TTAAAACAAGCCTTAATCTATTGGAGGATTATATATTTATTTTTTCAGTT
TTCAAATTTGGATTTTATTGTTGGAAAAATTCTGATCAAAAATTCTTTGA
AAAACGGATTCCATTCGATATTTGAATACTGAATATCATTCAGGATCTCG
GATAAATAGAATGGAAATGAGTCAGGATTTTTCCGACAGTGTCTCATCTC
AAGCTGTGACAATCACCATTAATAAAAACGTTTCAGAGCCCATGGGAATG
ACATTGAGGAAAGATAAAAACGGTCGCTGTGTTATAGCAAGAATTATGAT
CGGTGGATTGATCCATCGGCATGGCAGTTTACATGTGGGAGATGAAATCG
TCGAAGTCAATGCTGAGTCTGTTGTTGGTGACAGTTTAGAATTCGTGCAA
AGAATTTTGAAAAGTGCCCATGGTTCAGTTTATTTGACGATTGTACCAAA
CAACTGGCGGGAGCCTCCCAATTGTGAAATATATGTAAAGGCCATGTTTG
ATTATGAACCATCTGAAGATTCAATAGTTCCAGCCAGTCAAATGGCTTTG
ACATTTTATGTTGGCGATATCTTACGAATAATCAGCAAGGATGACAATAA
TTGGTGGCAAGCCCAACACTTGGACCAAGATGTTGACAGTCCGGCTCGTT
TAATTCCAAGTGCCGAACTCCAAGAGAGCAGAGCTGTAACCTCAATACTC
GATAAAGTAACAGGAGAAAAAAAATCCAATGCTTCAGCCAAATCATGCAA
TCCATTTGTTCTTCGACAAAAGAAACGGAAAAAACGATCTTCCAAAGTTC
CAATAATTTGTAATGGAGTTGCTCATTCTTTGGCAGAATCGAAATGTCGT
AACTATTTTGAATCGGAGAAATTGTATGATCAATTACATTTGTTTTTGTC
GGATTTGGAATTTTCTCCTTATGAGGAAGTTATTGAGATCGCTGAATTTT
CTCGTCGGTCATTAATACTGCTCGGAGCTCACGGAGTCGGCAGGAGACAC
ATCAAAAATGCTCTCATTCAAAGTTTCCCCCATTTGTTTTCGGCTCCGGT
TCCGCATACCTCCAAAGCCCCACTTGCCAATCAGATCAACGGGAAAGATT
ATCATTTCGTCAGTCACGAACAGATGCTCTCCGACATCGCAAACAATCTG
TATTTAGAATATGGGAAACAAGACGATATTTTATATGGAATAAAGCTTGA
AACTGTCCGTCAAATCATTCAATGCCGAATTATACCTGTTCTCGACGTTG
AGCCCCAAGCCCTTCGGTTATTAAGAAATGGAGAATTCGCACCTTTTGTT
GTTTTTATTTCCCCTCCCCACTTGGATGTCTTGTCTGATTCAACGAAAGA
AATTTTCGATGGATGTTTGGAAAAACTTTGTGAAGATAGCGAATTATTAG
AAATGCTCTACAGACCTTTCATAGACATGGAGATCGTCAATTACAGTATA
GAGGACACGGTGAAACCTATCGTCCAAGCTCTGAATGAACTCCATAGTAA
TTCACAGTGGATTCCCGTTGCTTGGATTTATTAAAATGGAAATATTGGGC
TTTTCAAATTTTTATTGTTTAAATGATTACTAAAATGTTAATTTCTTATT
CGATAGGAGTTATTGGTTAAGATTAACGCTGAAATAGAT
back to top

protein sequence of SMED30011594-orf-1

>SMED30011594-orf-1 ID=SMED30011594-orf-1|Name=SMED30011594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MEMSQDFSDSVSSQAVTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGL
IHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNNWR
EPPNCEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQ
AQHLDQDVDSPARLIPSAELQESRAVTSILDKVTGEKKSNASAKSCNPFV
LRQKKRKKRSSKVPIICNGVAHSLAESKCRNYFESEKLYDQLHLFLSDLE
FSPYEEVIEIAEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHT
SKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVR
QIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPHLDVLSDSTKEIFD
GCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQW
IPVAWIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR001478PDZ
IPR008145GK/Ca_channel_bsu
IPR027417P-loop_NTPase
IPR008144Guanylate_kin-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 107..174
e-value: 1.4E-6
score: 37.8
IPR001452SH3 domainPFAMPF00018SH3_1coord: 111..155
e-value: 1.4E-5
score: 24.6
IPR001452SH3 domainPROSITEPS50002SH3coord: 104..175
score: 16.35
IPR008145Guanylate kinase/L-type calcium channel beta subunitSMARTSM00072gk_7coord: 264..445
e-value: 2.2E-40
score: 150.2
IPR008145Guanylate kinase/L-type calcium channel beta subunitPFAMPF00625Guanylate_kincoord: 265..442
e-value: 9.7E-45
score: 152.5
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 26..98
e-value: 3.2E-12
score: 56.6
IPR001478PDZ domainPFAMPF00595PDZcoord: 18..94
e-value: 4.9E-12
score: 46.0
IPR001478PDZ domainPROSITEPS50106PDZcoord: 17..98
score: 15.199
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 12..99
e-value: 3.6E-22
score: 79.7
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 7..98
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 256..457
e-value: 3.8E-54
score: 185.2
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 100..233
e-value: 2.4E-23
score: 84.6
NoneNo IPR availablePANTHERPTHR23122MEMBRANE-ASSOCIATED GUANYLATE KINASE MAGUKcoord: 18..457
NoneNo IPR availablePANTHERPTHR23122:SF7PERIPHERAL PLASMA MEMBRANE PROTEIN CASKcoord: 18..457
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 17..95
e-value: 1.08733E-16
score: 72.5994
IPR008144Guanylate kinase-like domainPROSITEPS50052GUANYLATE_KINASE_2coord: 265..442
score: 35.365
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 263..453
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 83..180