Mothers against decapentaplegic homolog

Overview
NameMothers against decapentaplegic homolog
Smed IDSMED30011589
Length (bp)1198
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mothers against decapentaplegic homolog (SMED30011589) t-SNE clustered cells

Violin plots show distribution of expression levels for Mothers against decapentaplegic homolog (SMED30011589) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mothers against decapentaplegic homolog (SMED30011589) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mothers against decapentaplegic homolog (SMED30011589) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011589

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011589h1SMcG0020761 dd_Smed_v4_8193_0_2dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30011589h1SMcG0020761 dd_Smed_v4_8193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011589h1SMcG0020761 dd_Smed_v4_8193_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Match: SMAD3 (SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:6769])

HSP 1 Score: 140.969 bits (354), Expect = 5.637e-39
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:   31 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 141          

HSP 2 Score: 54.6842 bits (130), Expect = 6.353e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  191 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 230          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Match: SMAD3 (SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:6769])

HSP 1 Score: 140.584 bits (353), Expect = 7.146e-38
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  121 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 231          

HSP 2 Score: 54.299 bits (129), Expect = 1.550e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  281 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 320          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Match: SMAD2 (SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:6768])

HSP 1 Score: 142.124 bits (357), Expect = 1.814e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 54.6842 bits (130), Expect = 1.524e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  398 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 437          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Match: SMAD2 (SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:6768])

HSP 1 Score: 142.124 bits (357), Expect = 1.814e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 54.6842 bits (130), Expect = 1.524e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  398 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 437          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Match: SMAD2 (SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:6768])

HSP 1 Score: 141.354 bits (355), Expect = 3.057e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Match: sma-2 (Dwarfin sma-2 [Source:UniProtKB/Swiss-Prot;Acc:Q02330])

HSP 1 Score: 109.768 bits (273), Expect = 2.558e-26
Identity = 53/106 (50.00%), Postives = 73/106 (68.87%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIK--GELFLECLSDNAIFVQSPMSNITSGWHPATVIKI 943
            W TV+YYELN+RVG+    ++  +TIDG+T P  + S+ SLG  +NV+R+A IE TR+ IG G K  Y++  G LF +C SD+AIFVQS   N  +G+H  TV+KI
Sbjct:  222 WATVSYYELNTRVGEQVKVSSTTITIDGFTDPCINGSKISLGLFSNVNRNATIENTRRHIGNGVKLTYVRSNGSLFAQCESDSAIFVQSSNCNYINGFHSTTVVKI 327          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Match: sma-2 (Dwarfin sma-2 [Source:UniProtKB/Swiss-Prot;Acc:Q02330])

HSP 1 Score: 109.768 bits (273), Expect = 2.558e-26
Identity = 53/106 (50.00%), Postives = 73/106 (68.87%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIK--GELFLECLSDNAIFVQSPMSNITSGWHPATVIKI 943
            W TV+YYELN+RVG+    ++  +TIDG+T P  + S+ SLG  +NV+R+A IE TR+ IG G K  Y++  G LF +C SD+AIFVQS   N  +G+H  TV+KI
Sbjct:  222 WATVSYYELNTRVGEQVKVSSTTITIDGFTDPCINGSKISLGLFSNVNRNATIENTRRHIGNGVKLTYVRSNGSLFAQCESDSAIFVQSSNCNYINGFHSTTVVKI 327          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Match: sma-3 (Dwarfin sma-3 [Source:UniProtKB/Swiss-Prot;Acc:P45896])

HSP 1 Score: 89.3521 bits (220), Expect = 1.948e-19
Identity = 45/108 (41.67%), Postives = 64/108 (59.26%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECL--SDNAIFVQSPMSNITSGWHPATVIKIPP 949
            W  +TY+ELNSRVG+ F      +T+DGYT+PS  ++R  LG LTNV+R+  IE TR  IGKG +    + ++ +     SD  +FVQS  +N+        V +IPP
Sbjct:  197 WAQITYFELNSRVGEVFKLVNLSITVDGYTNPSNSNTRICLGQLTNVNRNGTIENTRMHIGKGIQLDNKEDQMHIMITNNSDMPVFVQSKNTNLMMNMPLVKVCRIPP 304          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Match: daf-8 (Dwarfin sma [Source:UniProtKB/TrEMBL;Acc:Q21733])

HSP 1 Score: 76.6406 bits (187), Expect = 7.198e-15
Identity = 42/110 (38.18%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHS---SRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPPT 952
            W  + YYE  + +G+          IDG+T+    S   SRFSLG   N +RS      R  IGKG +FY + GE+++E L +  +FVQS  +N+ +G+   TV K+PPT
Sbjct:  349 WLKLIYYEEGTMIGEKADVEGHHCLIDGFTASRTDSETRSRFSLGWYNNPNRSPQTAEVRGLIGKGVRFYLLAGEVYVENLCNIPVFVQSIGANMKNGFQLNTVSKLPPT 458          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Match: daf-14 (Smad protein [Source:UniProtKB/TrEMBL;Acc:G5EEP2])

HSP 1 Score: 67.3958 bits (163), Expect = 1.921e-12
Identity = 38/93 (40.86%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNIT 910
            W T+ YYEL  R+G AF +  P +TIDG T  S    R SL    + SR++   + R  +G G +  Y  GEL+L  L+D  +FVQ P  N T
Sbjct:   90 WCTIFYYELTVRLGKAFEAKVPTITIDGATGAS-DECRMSLTSQPS-SRNSKSSQIRNTVGAGIQLAYENGELWLTVLTDQIVFVQCPFLNQT 180          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Match: Smox (gene:FBgn0025800 transcript:FBtr0340159)

HSP 1 Score: 140.584 bits (353), Expect = 6.997e-37
Identity = 65/120 (54.17%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  590 DASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            DA+ +   +  F  W +++YYELN+RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+  +E+TR+ IGKG + YYI GE+F ECLSD++IFVQSP  N   GWHPATV KIPP
Sbjct:  281 DAAPVMYHEPAF--WCSISYYELNTRVGETFHASQPSITVDGFTDPS-NSERFCLGLLSNVNRNEVVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPP 397          

HSP 2 Score: 51.6026 bits (122), Expect = 7.143e-7
Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +P   CSS S
Sbjct:  447 RQTVTSTPCWIELHLNGPLQWLDRVLTQMGSPRLPCSSMS 486          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Match: Smox (gene:FBgn0025800 transcript:FBtr0071192)

HSP 1 Score: 140.584 bits (353), Expect = 6.997e-37
Identity = 65/120 (54.17%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  590 DASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            DA+ +   +  F  W +++YYELN+RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+  +E+TR+ IGKG + YYI GE+F ECLSD++IFVQSP  N   GWHPATV KIPP
Sbjct:  281 DAAPVMYHEPAF--WCSISYYELNTRVGETFHASQPSITVDGFTDPS-NSERFCLGLLSNVNRNEVVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPP 397          

HSP 2 Score: 51.6026 bits (122), Expect = 7.143e-7
Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +P   CSS S
Sbjct:  447 RQTVTSTPCWIELHLNGPLQWLDRVLTQMGSPRLPCSSMS 486          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Match: Mad (gene:FBgn0011648 transcript:FBtr0077616)

HSP 1 Score: 129.798 bits (325), Expect = 3.659e-33
Identity = 60/120 (50.00%), Postives = 82/120 (68.33%), Query Frame = 2
Query:  590 DASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            D +Q++  +  F  W ++ YYELN RVG+ F      V +DG+T+PS +S R  LG L+NV+R++ IE TR+ IGKG   YY+ GE++ ECLSD+AIFVQS   N   G+HP+TV KIPP
Sbjct:  249 DVAQVSYSEPAF--WASIAYYELNCRVGEVFHCNNNSVIVDGFTNPSNNSDRCCLGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPP 366          

HSP 2 Score: 49.2914 bits (116), Expect = 4.471e-6
Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCW+E+HL+ PL+ LD  L ++ +P N  SS S
Sbjct:  416 RQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNAISSVS 455          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Match: Mad (gene:FBgn0011648 transcript:FBtr0332372)

HSP 1 Score: 129.798 bits (325), Expect = 8.334e-33
Identity = 60/120 (50.00%), Postives = 82/120 (68.33%), Query Frame = 2
Query:  590 DASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            D +Q++  +  F  W ++ YYELN RVG+ F      V +DG+T+PS +S R  LG L+NV+R++ IE TR+ IGKG   YY+ GE++ ECLSD+AIFVQS   N   G+HP+TV KIPP
Sbjct:  319 DVAQVSYSEPAF--WASIAYYELNCRVGEVFHCNNNSVIVDGFTNPSNNSDRCCLGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPP 436          

HSP 2 Score: 49.2914 bits (116), Expect = 4.754e-6
Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCW+E+HL+ PL+ LD  L ++ +P N  SS S
Sbjct:  486 RQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNAISSVS 525          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Match: Med (gene:FBgn0011655 transcript:FBtr0085816)

HSP 1 Score: 83.9593 bits (206), Expect = 4.292e-17
Identity = 45/105 (42.86%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFA--SATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKF-YYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVI 937
            W ++ Y+EL+++VG+ F   SA P V IDGY  PS   +RF LG L+NV R+   ER R  IGKG +     +G+++L CLSDN++FVQS   +  +G  P   +
Sbjct:  472 WCSIAYFELDTQVGETFKVPSAKPNVIIDGYVDPS-GGNRFCLGALSNVHRTEQSERARLHIGKGVQLDLRGEGDVWLRCLSDNSVFVQSYYLDREAGRTPGDAV 575          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Match: smad3b (SMAD family member 3b [Source:ZFIN;Acc:ZDB-GENE-030128-4])

HSP 1 Score: 140.969 bits (354), Expect = 2.332e-37
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +S F  W +++YYELN RVG+ F ++ P +T+DG+T PS ++ RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  217 LDLQPVTYCESAF--WCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NAERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 334          

HSP 2 Score: 52.7582 bits (125), Expect = 4.179e-7
Identity = 22/40 (55.00%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +P+ +CSS S
Sbjct:  384 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPNLRCSSVS 423          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Match: smad3a (SMAD family member 3a [Source:ZFIN;Acc:ZDB-GENE-000509-3])

HSP 1 Score: 140.198 bits (352), Expect = 4.918e-37
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 54.299 bits (129), Expect = 1.476e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Match: smad3a (SMAD family member 3a [Source:ZFIN;Acc:ZDB-GENE-000509-3])

HSP 1 Score: 140.198 bits (352), Expect = 4.918e-37
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 54.299 bits (129), Expect = 1.476e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Match: smad2 (SMAD family member 2 [Source:NCBI gene;Acc:30639])

HSP 1 Score: 139.428 bits (350), Expect = 1.763e-36
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  262 MDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 379          

HSP 2 Score: 55.8398 bits (133), Expect = 5.133e-8
Identity = 24/42 (57.14%), Postives = 33/42 (78.57%), Query Frame = 1
Query:  946 SDRQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            S RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 SRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 469          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Match: smad2 (SMAD family member 2 [Source:NCBI gene;Acc:30639])

HSP 1 Score: 139.428 bits (350), Expect = 1.763e-36
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  262 MDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 379          

HSP 2 Score: 55.8398 bits (133), Expect = 5.133e-8
Identity = 24/42 (57.14%), Postives = 33/42 (78.57%), Query Frame = 1
Query:  946 SDRQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            S RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 SRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 469          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Match: rgs19 (regulator of G-protein signaling 19 [Source:Xenbase;Acc:XB-GENE-5736048])

HSP 1 Score: 142.895 bits (359), Expect = 3.191e-38
Identity = 66/112 (58.93%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSDNAIFVQSP  N   GWHPATV KIPP
Sbjct:  181 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVEMTRRHIGRGVRLYYIGGEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPP 291          

HSP 2 Score: 54.299 bits (129), Expect = 1.660e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  341 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 380          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Match: rgs19 (regulator of G-protein signaling 19 [Source:Xenbase;Acc:XB-GENE-5736048])

HSP 1 Score: 143.28 bits (360), Expect = 5.754e-38
Identity = 66/112 (58.93%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSDNAIFVQSP  N   GWHPATV KIPP
Sbjct:  230 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVEMTRRHIGRGVRLYYIGGEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPP 340          

HSP 2 Score: 54.299 bits (129), Expect = 1.807e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  390 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 429          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Match: rgs19 (regulator of G-protein signaling 19 [Source:Xenbase;Acc:XB-GENE-5736048])

HSP 1 Score: 142.895 bits (359), Expect = 6.327e-38
Identity = 66/112 (58.93%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSDNAIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVEMTRRHIGRGVRLYYIGGEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 54.299 bits (129), Expect = 1.842e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Match: rgs19 (regulator of G-protein signaling 19 [Source:Xenbase;Acc:XB-GENE-5736048])

HSP 1 Score: 143.28 bits (360), Expect = 6.563e-38
Identity = 66/112 (58.93%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSDNAIFVQSP  N   GWHPATV KIPP
Sbjct:  236 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVEMTRRHIGRGVRLYYIGGEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPP 346          

HSP 2 Score: 54.299 bits (129), Expect = 2.014e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  396 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 435          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Match: eif3m (eukaryotic translation initiation factor 3 subunit M [Source:Xenbase;Acc:XB-GENE-968605])

HSP 1 Score: 142.51 bits (358), Expect = 8.102e-38
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Match: Smad2 (SMAD family member 2 [Source:MGI Symbol;Acc:MGI:108051])

HSP 1 Score: 142.124 bits (357), Expect = 1.246e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 54.6842 bits (130), Expect = 1.046e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  398 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 437          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Match: Smad2 (SMAD family member 2 [Source:MGI Symbol;Acc:MGI:108051])

HSP 1 Score: 141.739 bits (356), Expect = 1.799e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Match: Smad2 (SMAD family member 2 [Source:MGI Symbol;Acc:MGI:108051])

HSP 1 Score: 141.739 bits (356), Expect = 2.664e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 1.043e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Match: Smad2 (SMAD family member 2 [Source:MGI Symbol;Acc:MGI:108051])

HSP 1 Score: 141.739 bits (356), Expect = 2.664e-37
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 1.043e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Match: Smad3 (SMAD family member 3 [Source:MGI Symbol;Acc:MGI:1201674])

HSP 1 Score: 140.584 bits (353), Expect = 4.510e-37
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 54.299 bits (129), Expect = 1.497e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Match: sp|O70436|SMAD2_RAT (Mothers against decapentaplegic homolog 2 OS=Rattus norvegicus OX=10116 GN=Smad2 PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.667e-36
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 7.108e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Match: sp|Q5R7C0|SMAD2_PONAB (Mothers against decapentaplegic homolog 2 OS=Pongo abelii OX=9601 GN=SMAD2 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.771e-36
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 7.235e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Match: sp|Q62432|SMAD2_MOUSE (Mothers against decapentaplegic homolog 2 OS=Mus musculus OX=10090 GN=Smad2 PE=1 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 1.863e-36
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 7.299e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Match: sp|Q15796|SMAD2_HUMAN (Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.940e-36
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 7.171e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Match: sp|Q1W668|SMAD2_BOVIN (Mothers against decapentaplegic homolog 2 OS=Bos taurus OX=9913 GN=SMAD2 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.125e-36
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 7.299e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Match: A0A5F4CVU9 (Mothers against decapentaplegic homolog OS=Canis lupus familiaris OX=9615 GN=SMAD2 PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.579e-40
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 54.6842 bits (130), Expect = 1.579e-40
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  388 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 427          
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Match: A0A2K5ZHD7 (Mothers against decapentaplegic homolog OS=Mandrillus leucophaeus OX=9568 GN=SMAD2 PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.579e-40
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 54.6842 bits (130), Expect = 1.579e-40
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  388 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 427          
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Match: A0A2K5K729 (Mothers against decapentaplegic homolog OS=Colobus angolensis palliatus OX=336983 GN=SMAD2 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.630e-40
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 1.630e-40
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  418 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 457          
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Match: A0A2K6CWI1 (Mothers against decapentaplegic homolog OS=Macaca nemestrina OX=9545 GN=SMAD2 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.630e-40
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 1.630e-40
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  418 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 457          
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Match: A0A2K6KLW4 (Mothers against decapentaplegic homolog OS=Rhinopithecus bieti OX=61621 GN=SMAD2 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.630e-40
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 LDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 54.6842 bits (130), Expect = 1.630e-40
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  418 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 457          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Match: smad2 (SMAD family member 2 [Source:NCBI gene;Acc:103025750])

HSP 1 Score: 141.739 bits (356), Expect = 1.405e-37
Identity = 77/180 (42.78%), Postives = 106/180 (58.89%), Query Frame = 2
Query:  410 TNLSALLMEKNSSVRPPTLTPDGKRLNDLATVDCNLLKAIESSR*ERLMLLVKQLNVCKLDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            TN  A +   N+ +  P   P G    D  T D  L +++++     L           +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  175 TNFPAGIEPPNNYI--PETPPPGYISEDGETSDQQLNQSMDTGSPAELSPSTLSPVNHGMDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 349          

HSP 2 Score: 53.9138 bits (128), Expect = 1.656e-7
Identity = 22/40 (55.00%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +P+ +CSS S
Sbjct:  399 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPTVRCSSMS 438          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Match: smad2 (SMAD family member 2 [Source:NCBI gene;Acc:103025750])

HSP 1 Score: 141.739 bits (356), Expect = 2.233e-37
Identity = 77/180 (42.78%), Postives = 106/180 (58.89%), Query Frame = 2
Query:  410 TNLSALLMEKNSSVRPPTLTPDGKRLNDLATVDCNLLKAIESSR*ERLMLLVKQLNVCKLDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            TN  A +   N+ +  P   P G    D  T D  L +++++     L           +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  205 TNFPAGIEPPNNYI--PETPPPGYISEDGETSDQQLNQSMDTGSPAELSPSTLSPVNHGMDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 379          

HSP 2 Score: 53.9138 bits (128), Expect = 1.817e-7
Identity = 22/40 (55.00%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +P+ +CSS S
Sbjct:  429 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPTVRCSSMS 468          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Match: smad3b (mothers against decapentaplegic homolog 3 [Source:NCBI gene;Acc:103027004])

HSP 1 Score: 140.198 bits (352), Expect = 3.628e-37
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            LD   +   +S F  W +++YYELN RVG+ F ++ P +T+DG+T PS ++ RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  218 LDLQPVTYCESAF--WCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NAERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 335          

HSP 2 Score: 54.299 bits (129), Expect = 1.184e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  385 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 424          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Match: smad3a (mothers against decapentaplegic homolog 3 [Source:NCBI gene;Acc:103027811])

HSP 1 Score: 139.813 bits (351), Expect = 5.214e-37
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGEIFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 54.299 bits (129), Expect = 1.207e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Match: smad3b (mothers against decapentaplegic homolog 3 [Source:NCBI gene;Acc:103027004])

HSP 1 Score: 139.428 bits (350), Expect = 6.288e-37
Identity = 64/112 (57.14%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS ++ RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  216 YCESAFWCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NAERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 326          

HSP 2 Score: 54.299 bits (129), Expect = 1.248e-7
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  376 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS 415          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Sea Lamprey
Match: SMAD3 (SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:6769])

HSP 1 Score: 137.887 bits (346), Expect = 2.010e-38
Identity = 63/113 (55.75%), Postives = 84/113 (74.34%), Query Frame = 2
Query:  620 IFCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            ++CE   W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+  +E TR+ IG+G + YYI GE+F ECLS++AIFVQSP  N   GWHPATV KIPP
Sbjct:   63 MYCEPAFWCSIGYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNQVVEMTRRHIGRGVRLYYIGGEVFAECLSESAIFVQSPNCNQRYGWHPATVCKIPP 174          

HSP 2 Score: 53.9138 bits (128), Expect = 1.684e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQTIT+TPCW+E+HLN PL+ LD  L ++ +P+ +CSS S
Sbjct:  224 RQTITSTPCWIELHLNGPLQWLDRVLTQMGSPTVRCSSIS 263          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Sea Lamprey
Match: SMAD3 (SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:6769])

HSP 1 Score: 137.502 bits (345), Expect = 1.063e-36
Identity = 62/112 (55.36%), Postives = 84/112 (75.00%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+N++R+  +E TR+ IG+G + YYI GE+F ECLS++AIFVQSP  N   GWHPATV KIPP
Sbjct:  235 YCEPAFWCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNINRNQTVEMTRRHIGRGVRLYYIGGEVFAECLSESAIFVQSPNCNQRYGWHPATVCKIPP 345          

HSP 2 Score: 53.9138 bits (128), Expect = 3.395e-8
Identity = 22/38 (57.89%), Postives = 31/38 (81.58%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSS 1065
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS
Sbjct:  395 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSS 432          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Sea Lamprey
Match: smad9 (SMAD family member 9 [Source:ZFIN;Acc:ZDB-GENE-031014-1])

HSP 1 Score: 120.939 bits (302), Expect = 1.501e-30
Identity = 55/105 (52.38%), Postives = 77/105 (73.33%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIP 946
            W ++ YYEL +RVG+AF +++  V +DG+T PS + +RF LG L++V+R++ IE TR+ IGKG   YY+ GE+F ECLSD++IFVQS   N   G+HP TV KIP
Sbjct:  269 WCSIVYYELTNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSHVNRNSTIENTRRHIGKGVHLYYVGGEVFAECLSDSSIFVQSRNCNYHHGFHPTTVCKIP 373          

HSP 2 Score: 46.595 bits (109), Expect = 7.712e-6
Identity = 20/40 (50.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCWVE+HL+ PL+ LD  L ++ +P    SS S
Sbjct:  424 RQDVTSTPCWVEIHLHGPLQWLDKVLTQMGSPHMPISSVS 463          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010406.1 (pep scaffold:Pmarinus_7.0:GL476769:63937:79511:-1 gene:ENSPMAG00000009414.1 transcript:ENSPMAT00000010406.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 5.545e-17
Identity = 42/105 (40.00%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFA--SATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYI-KGELFLECLSDNAIFVQSPMSNITSGWHPATVI 937
            W ++ Y+E++ +VG+ F   S+ PIVT+DGY  PS    RF LG L+NV R+   E+ R  IGKG +     +G++++ CLSD+A+FVQS   +  +G  P   +
Sbjct:  338 WCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPS-GGDRFCLGQLSNVHRTDASEKARLHIGKGVQLECRGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAV 441          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Nematostella
Match: EDO39594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L0])

HSP 1 Score: 135.961 bits (341), Expect = 5.469e-36
Identity = 64/121 (52.89%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +DA  I   +  +  W +++YYE+N+RVG+ F ++ P +T+DG+T PS  S RF LG L+N++R+  IE TRK IGKG + YYI GE+F ECLSD++IFVQSP  N    WHPATV KIPP
Sbjct:  217 IDAQPIQYTEPTY--WCSISYYEMNTRVGETFHASQPSLTVDGFTDPS-SSDRFCLGLLSNINRNPPIEMTRKHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYNWHPATVCKIPP 334          

HSP 2 Score: 53.9138 bits (128), Expect = 5.779e-8
Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS  CSS S
Sbjct:  384 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSAPCSSVS 423          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Nematostella
Match: EDO47037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC1])

HSP 1 Score: 118.242 bits (295), Expect = 1.326e-29
Identity = 55/106 (51.89%), Postives = 77/106 (72.64%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSP-SPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIP 946
            W ++ YYELN+RVG+ F + +  + +DG+T P + +S RF LG L+NV+R++ IE TR+ IGKG   YY+ GE++ ECLSD+AIFVQS   N + G+HP TV KIP
Sbjct:  240 WCSIAYYELNNRVGELFHAKSTSLIVDGFTDPNTTNSERFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSAIFVQSRNCNHSHGFHPTTVCKIP 345          

HSP 2 Score: 49.6766 bits (117), Expect = 1.383e-6
Identity = 21/40 (52.50%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCW+EVHL+ PL+ LD  L ++ +P N  SS S
Sbjct:  396 RQDVTSTPCWIEVHLHGPLQWLDKVLSQMGSPRNPISSVS 435          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Nematostella
Match: EDO31382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY32])

HSP 1 Score: 78.5666 bits (192), Expect = 4.879e-16
Identity = 44/111 (39.64%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFA--SATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKF-YYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVI-KIPPT 952
            W ++ Y+EL+ +VG+ F   S  P VT+DGY  PS   +RF LG L+NV R+   ER R  IGKG +     +G++++ CLS++++FVQS   +  +G  P   + KI P+
Sbjct:  209 WCSIAYFELDQQVGEIFKVTSNCPSVTVDGYVDPSG-GNRFCLGQLSNVHRTEASERARLHIGKGVQLDVRGEGDVWVRCLSEHSVFVQSYYLDREAGRCPGDAVHKIYPS 318          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Nematostella
Match: EDO25528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW81])

HSP 1 Score: 56.6102 bits (135), Expect = 1.235e-10
Identity = 29/63 (46.03%), Postives = 39/63 (61.90%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAF--ASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIG 814
            W ++ Y+EL+ +VG+ F   S  P VT+DGY  PS   +RF LG L+NV R+   ER R  IG
Sbjct:    5 WCSIAYFELDQQVGEIFKVTSNCPSVTVDGYVDPS-GGNRFCLGQLSNVHRTEASERARLHIG 66          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Match: ENSORLT00000014829.2 (SMAD family member 2 [Source:NCBI gene;Acc:101167556])

HSP 1 Score: 142.895 bits (359), Expect = 5.882e-38
Identity = 79/180 (43.89%), Postives = 107/180 (59.44%), Query Frame = 2
Query:  410 TNLSALLMEKNSSVRPPTLTPDGKRLNDLATVDCNLLKAIESSR*ERLMLLVKQLNVCKLDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            TN  A +   N+ +  P   P G    D  T D  + +++ES      M       V  +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  181 TNFPAGIEPPNNYI--PDTPPPGYMSEDGETSDQQMNQSMESGS-PAEMSPSTLSPVTGMDLQPVTYSEPAF--WCSIAYYELNQRVGENFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 354          

HSP 2 Score: 55.0694 bits (131), Expect = 7.358e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  404 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 443          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Match: ENSORLT00000014832.2 (SMAD family member 2 [Source:NCBI gene;Acc:101167556])

HSP 1 Score: 142.895 bits (359), Expect = 1.064e-37
Identity = 79/180 (43.89%), Postives = 107/180 (59.44%), Query Frame = 2
Query:  410 TNLSALLMEKNSSVRPPTLTPDGKRLNDLATVDCNLLKAIESSR*ERLMLLVKQLNVCKLDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            TN  A +   N+ +  P   P G    D  T D  + +++ES      M       V  +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  211 TNFPAGIEPPNNYI--PDTPPPGYMSEDGETSDQQMNQSMESGS-PAEMSPSTLSPVTGMDLQPVTYSEPAF--WCSIAYYELNQRVGENFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 384          

HSP 2 Score: 55.0694 bits (131), Expect = 6.766e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  434 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 473          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Match: ENSORLT00000002749.2 (mothers against decapentaplegic homolog 3 [Source:NCBI gene;Acc:101169523])

HSP 1 Score: 140.198 bits (352), Expect = 3.742e-37
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  623 FCE---WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +CE   W +++YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  226 YCEPAFWCSISYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 336          

HSP 2 Score: 53.9138 bits (128), Expect = 1.407e-7
Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS  CSS S
Sbjct:  386 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIHCSSVS 425          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Match: smad2 (mothers against decapentaplegic homolog 2 [Source:NCBI gene;Acc:101159109])

HSP 1 Score: 139.813 bits (351), Expect = 7.643e-37
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  231 MDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 348          

HSP 2 Score: 55.0694 bits (131), Expect = 5.833e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  398 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSARCSSMS 437          
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Match: smad2 (mothers against decapentaplegic homolog 2 [Source:NCBI gene;Acc:101159109])

HSP 1 Score: 139.428 bits (350), Expect = 1.400e-36
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 2
Query:  587 LDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            +D   +   +  F  W ++ YYELN RVG+ F ++ P +T+DG+T PS +S RF LG L+NV+R+A +E TR+ IG+G + YYI GE+F ECLSD+AIFVQSP  N   GWHPATV KIPP
Sbjct:  261 MDLQPVTYSEPAF--WCSIAYYELNQRVGETFHASQPSLTVDGFTDPS-NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP 378          

HSP 2 Score: 55.4546 bits (132), Expect = 5.719e-8
Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQT+T+TPCW+E+HLN PL+ LD  L ++ +PS +CSS S
Sbjct:  428 RQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSARCSSMS 467          
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Match: SMESG000056334.1 (SMESG000056334.1)

HSP 1 Score: 132.494 bits (332), Expect = 1.749e-34
Identity = 61/106 (57.55%), Postives = 78/106 (73.58%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            W TV YYELNSRVG+AF +  P + IDG+T PS ++ RF LG L+NV+R++ IE TR+ IGKG   YY+ GE+F ECLSD++IFVQS   N    +HP+TV KIPP
Sbjct:  216 WSTVVYYELNSRVGEAFHARLPSIIIDGFTDPSNNADRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVFAECLSDSSIFVQSRNCNYRHNFHPSTVCKIPP 321          

HSP 2 Score: 52.7582 bits (125), Expect = 2.535e-7
Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCWVE+HLN PLK LD  L ++  P N  SS S
Sbjct:  371 RQDVTSTPCWVEIHLNGPLKWLDRVLTKMGAPRNPISSVS 410          
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Match: SMESG000056334.1 (SMESG000056334.1)

HSP 1 Score: 132.109 bits (331), Expect = 1.928e-34
Identity = 61/106 (57.55%), Postives = 78/106 (73.58%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            W TV YYELNSRVG+AF +  P + IDG+T PS ++ RF LG L+NV+R++ IE TR+ IGKG   YY+ GE+F ECLSD++IFVQS   N    +HP+TV KIPP
Sbjct:  217 WSTVVYYELNSRVGEAFHARLPSIIIDGFTDPSNNADRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVFAECLSDSSIFVQSRNCNYRHNFHPSTVCKIPP 322          

HSP 2 Score: 52.7582 bits (125), Expect = 2.452e-7
Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCWVE+HLN PLK LD  L ++  P N  SS S
Sbjct:  372 RQDVTSTPCWVEIHLNGPLKWLDRVLTKMGAPRNPISSVS 411          
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Match: SMESG000031386.1 (SMESG000031386.1)

HSP 1 Score: 123.635 bits (309), Expect = 7.936e-31
Identity = 56/106 (52.83%), Postives = 75/106 (70.75%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            W ++ YYEL+   G+ F  +T  +T+DG+T P+  S RF LG ++NV+R+   E  R+ IGKG + YYI GE+F ECLS++AIFVQSP  N  +GWHPATV KIPP
Sbjct:  315 WCSIRYYELSVAFGETFHCSTSCLTVDGFTDPA-QSDRFCLGLVSNVNRNPQTELARRHIGKGLRLYYIGGEVFAECLSESAIFVQSPNCNYLNGWHPATVCKIPP 419          

HSP 2 Score: 54.299 bits (129), Expect = 9.212e-8
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  910 IWLASCYGHKNTSDRQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            I L+   G  +   RQT+T TPCW+E+HLN PL+ LD  L+ +E+P   C+S S
Sbjct:  455 IRLSFVKGWGSDYRRQTVTNTPCWIEIHLNGPLQWLDRVLKEMESPLMPCNSVS 508          
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Match: SMESG000011457.1 (SMESG000011457.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.179e-30
Identity = 55/106 (51.89%), Postives = 77/106 (72.64%), Query Frame = 2
Query:  632 WGTVTYYELNSRVGDAFASATPIVTIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELFLECLSDNAIFVQSPMSNITSGWHPATVIKIPP 949
            W ++ YYELN+RVG+AF ++   + +DG+T PS +S RF LG L+NV+R++ IE TR+ IGKG   YY+ G+++ ECLSD++IFVQS   N    +HP TV KIPP
Sbjct:  261 WCSIVYYELNNRVGEAFFASKLSIIVDGFTDPSNNSDRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGDVYAECLSDSSIFVQSRNCNYHHNFHPTTVCKIPP 366          

HSP 2 Score: 51.9878 bits (123), Expect = 5.367e-7
Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  952 RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            RQ +T+TPCW+E+HLN PL  LD  L ++ TP N  SS S
Sbjct:  416 RQDVTSTPCWIEIHLNGPLHWLDKVLSQMGTPRNPISSVS 455          
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Match: SMESG000017169.1 (SMESG000017169.1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.507e-21
Identity = 47/81 (58.02%), Postives = 57/81 (70.37%), Query Frame = 1
Query:  829 LLHKRRIVPRMFE*QCNICPISHVKYHIWLASCYGHKNTSDRQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 1071
            +LH+  +  R FE    + P+  ++    ++   G   +  RQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS
Sbjct:   33 ILHQHEL--RGFEAVFALTPLCSIR----ISFVKGWGASYSRQTITATPCWVEVHLNQPLKCLDAALQRLETPSNQCSSRS 107          
The following BLAST results are available for this feature:
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMAD35.637e-3958.04SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SMAD37.146e-3858.04SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SMAD21.814e-3754.55SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
SMAD21.814e-3754.55SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
SMAD23.057e-3754.55SMAD family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sma-22.558e-2650.00Dwarfin sma-2 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
sma-22.558e-2650.00Dwarfin sma-2 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
sma-31.948e-1941.67Dwarfin sma-3 [Source:UniProtKB/Swiss-Prot;Acc:P4... [more]
daf-87.198e-1538.18Dwarfin sma [Source:UniProtKB/TrEMBL;Acc:Q21733][more]
daf-141.921e-1240.86Smad protein [Source:UniProtKB/TrEMBL;Acc:G5EEP2][more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smox6.997e-3754.17gene:FBgn0025800 transcript:FBtr0340159[more]
Smox6.997e-3754.17gene:FBgn0025800 transcript:FBtr0071192[more]
Mad3.659e-3350.00gene:FBgn0011648 transcript:FBtr0077616[more]
Mad8.334e-3350.00gene:FBgn0011648 transcript:FBtr0332372[more]
Med4.292e-1742.86gene:FBgn0011655 transcript:FBtr0085816[more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smad3b2.332e-3754.55SMAD family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
smad3a4.918e-3758.04SMAD family member 3a [Source:ZFIN;Acc:ZDB-GENE-00... [more]
smad3a4.918e-3758.04SMAD family member 3a [Source:ZFIN;Acc:ZDB-GENE-00... [more]
smad21.763e-3653.72SMAD family member 2 [Source:NCBI gene;Acc:30639][more]
smad21.763e-3653.72SMAD family member 2 [Source:NCBI gene;Acc:30639][more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs193.191e-3858.93regulator of G-protein signaling 19 [Source:Xenbas... [more]
rgs195.754e-3858.93regulator of G-protein signaling 19 [Source:Xenbas... [more]
rgs196.327e-3858.93regulator of G-protein signaling 19 [Source:Xenbas... [more]
rgs196.563e-3858.93regulator of G-protein signaling 19 [Source:Xenbas... [more]
eif3m8.102e-3854.55eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smad21.246e-3754.55SMAD family member 2 [Source:MGI Symbol;Acc:MGI:10... [more]
Smad21.799e-3754.55SMAD family member 2 [Source:MGI Symbol;Acc:MGI:10... [more]
Smad22.664e-3754.55SMAD family member 2 [Source:MGI Symbol;Acc:MGI:10... [more]
Smad22.664e-3754.55SMAD family member 2 [Source:MGI Symbol;Acc:MGI:10... [more]
Smad34.510e-3758.04SMAD family member 3 [Source:MGI Symbol;Acc:MGI:12... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70436|SMAD2_RAT1.667e-3654.55Mothers against decapentaplegic homolog 2 OS=Rattu... [more]
sp|Q5R7C0|SMAD2_PONAB1.771e-3654.55Mothers against decapentaplegic homolog 2 OS=Pongo... [more]
sp|Q62432|SMAD2_MOUSE1.863e-3654.55Mothers against decapentaplegic homolog 2 OS=Mus m... [more]
sp|Q15796|SMAD2_HUMAN1.940e-3654.55Mothers against decapentaplegic homolog 2 OS=Homo ... [more]
sp|Q1W668|SMAD2_BOVIN2.125e-3654.55Mothers against decapentaplegic homolog 2 OS=Bos t... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5F4CVU91.579e-4054.55Mothers against decapentaplegic homolog OS=Canis l... [more]
A0A2K5ZHD71.579e-4054.55Mothers against decapentaplegic homolog OS=Mandril... [more]
A0A2K5K7291.630e-4054.55Mothers against decapentaplegic homolog OS=Colobus... [more]
A0A2K6CWI11.630e-4054.55Mothers against decapentaplegic homolog OS=Macaca ... [more]
A0A2K6KLW41.630e-4054.55Mothers against decapentaplegic homolog OS=Rhinopi... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smad21.405e-3742.78SMAD family member 2 [Source:NCBI gene;Acc:1030257... [more]
smad22.233e-3742.78SMAD family member 2 [Source:NCBI gene;Acc:1030257... [more]
smad3b3.628e-3754.55mothers against decapentaplegic homolog 3 [Source:... [more]
smad3a5.214e-3758.04mothers against decapentaplegic homolog 3 [Source:... [more]
smad3b6.288e-3757.14mothers against decapentaplegic homolog 3 [Source:... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SMAD32.010e-3855.75SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SMAD31.063e-3655.36SMAD family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
smad91.501e-3052.38SMAD family member 9 [Source:ZFIN;Acc:ZDB-GENE-031... [more]
ENSPMAT00000010406.15.545e-1740.00pep scaffold:Pmarinus_7.0:GL476769:63937:79511:-1 ... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO395945.469e-3652.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470371.326e-2951.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313824.879e-1639.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255281.235e-1046.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000014829.25.882e-3843.89SMAD family member 2 [Source:NCBI gene;Acc:1011675... [more]
ENSORLT00000014832.21.064e-3743.89SMAD family member 2 [Source:NCBI gene;Acc:1011675... [more]
ENSORLT00000002749.23.742e-3758.04mothers against decapentaplegic homolog 3 [Source:... [more]
smad27.643e-3753.72mothers against decapentaplegic homolog 2 [Source:... [more]
smad21.400e-3653.72mothers against decapentaplegic homolog 2 [Source:... [more]
back to top
BLAST of Mothers against decapentaplegic homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056334.11.749e-3457.55SMESG000056334.1[more]
SMESG000056334.11.928e-3457.55SMESG000056334.1[more]
SMESG000031386.17.936e-3152.83SMESG000031386.1[more]
SMESG000011457.11.179e-3051.89SMESG000011457.1[more]
SMESG000017169.18.507e-2158.02SMESG000017169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011589 ID=SMED30011589|Name=Mothers against decapentaplegic homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1198bp
ACCCCATTAAAACAAAAATTACCCTATTAAAACATAAATTACCCCATTTA
AACACAATTACCACATTAAAACAAAAATTACCGCATTAAAACAAAAATTC
CTCCACTTAAACAAAAATTATCTCATTAAAACAAAAATTATCCCATTACA
TAATTTTATAATCAATAATAAATATTTATTAAATCGATAATATTATTTTA
TTTTACTAATCGATATAATTTTTTAATCAATAAAAATTTATTTATGAAAT
CGATAATATTAATTTATCTGATTATTGATTTTACGTATTATTAATCAATT
GCTATTGAAAAAACCATAAAAAACAGCCTCATCACCATGGGATATATTAT
ATAAAACATGAAATCAAAATTTGAGCACAATATGGCGTTTAGAATCTTTC
TCGTCTCCCACAAACTTGTCTGCATTGCTGATGGAAAAGAACTCATCCGT
CCGGCCTCCAACGCTTACACCGGACGGGAAACGGCTGAATGACCTCGCCA
CTGTCGACTGTAACCTGTTGAAAGCCATAGAAAGTAGTAGATGAGAGCGA
TTGATGTTATTGGTAAAGCAACTAAATGTGTGTAAATTAGACGCCAGCCA
AATAGCAACTGACCAATCGATATTCTGTGAATGGGGCACCGTGACGTACT
ACGAGCTGAACTCGCGAGTCGGTGACGCGTTCGCGTCCGCAACTCCCATT
GTCACCATTGACGGTTACACCTCACCGTCGCCTCACAGCAGCAGGTTCAG
TCTCGGCCATTTGACCAATGTTTCCAGGAGCGCCAATATCGAGAGGACCA
GAAAATTTATCGGCAAAGGCGCTAAATTTTACTACATAAAAGGAGAATTG
TTCCTCGAATGTTTGAGTGACAATGCAATATTTGTCCAATCTCCCATGTC
AAATATCACATCTGGCTGGCATCCTGCTACGGTCATAAAAATACCTCCGA
CCGTCAAACCATTACTGCAACACCATGTTGGGTAGAAGTGCATTTAAATC
AACCATTAAAGTGCCTAGATGCAGCTTTACAGCGGCTGGAAACTCCATCA
AATCAGTGTTCTTCAAGAAGTTGAAATTTTAAATATATATATTTTGGATA
AATTTTTTTCAGTTTGAAATATCTATTTGAACACAAATATTTTTGCAATA
GCACAAGTGCTAATCAATGACAATAATATTATTATGATTTAATGCGTC
back to top

protein sequence of SMED30011589-orf-1

>SMED30011589-orf-1 ID=SMED30011589-orf-1|Name=SMED30011589-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MLLVKQLNVCKLDASQIATDQSIFCEWGTVTYYELNSRVGDAFASATPIV
TIDGYTSPSPHSSRFSLGHLTNVSRSANIERTRKFIGKGAKFYYIKGELF
LECLSDNAIFVQSPMSNITSGWHPATVIKIPPTVKPLLQHHVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013790Dwarfin
IPR001132SMAD_dom_Dwarfin-type
IPR017855SMAD-like_dom_sf
IPR008984SMAD_FHA_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0001657ureteric bud development
GO:0001701in utero embryonic development
GO:0001706endoderm formation
GO:0001707mesoderm formation
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0010718positive regulation of epithelial to mesenchymal transition
GO:0017015regulation of transforming growth factor beta receptor signaling pathway
GO:0023019signal transduction involved in regulation of gene expression
GO:0030073insulin secretion
GO:0030324lung development
GO:0030513positive regulation of BMP signaling pathway
GO:0031016pancreas development
GO:0032924activin receptor signaling pathway
GO:0035265organ growth
GO:0035556intracellular signal transduction
GO:0038092nodal signaling pathway
GO:0045165cell fate commitment
GO:0045892negative regulation of transcription, DNA-templated
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048340paraxial mesoderm morphogenesis
GO:0048589developmental growth
GO:0048617embryonic foregut morphogenesis
GO:0048701embryonic cranial skeleton morphogenesis
GO:0051098regulation of binding
GO:0060021palate development
GO:0060039pericardium development
GO:0060395SMAD protein signal transduction
GO:0070723response to cholesterol
GO:1900224positive regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry
GO:0006468protein phosphorylation
GO:0007179transforming growth factor beta receptor signaling pathway
GO:0007182common-partner SMAD protein phosphorylation
GO:0007183SMAD protein complex assembly
GO:0007352zygotic specification of dorsal/ventral axis
GO:0007369gastrulation
GO:0007389pattern specification process
GO:0007492endoderm development
GO:0007507heart development
GO:0008285negative regulation of cell proliferation
GO:0009749response to glucose
GO:0009791post-embryonic development
GO:0009880embryonic pattern specification
GO:0009952anterior/posterior pattern specification
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0032444activin responsive factor complex
GO:0043234protein complex
GO:0071141SMAD protein complex
GO:0071144SMAD2-SMAD3 protein complex
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001077transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0003690double-stranded DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005160transforming growth factor beta receptor binding
GO:0019902phosphatase binding
GO:0030618transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity
GO:0031625ubiquitin protein ligase binding
GO:0033613activating transcription factor binding
GO:0034713type I transforming growth factor beta receptor binding
GO:0042803protein homodimerization activity
GO:0046332SMAD binding
GO:0046872metal ion binding
GO:0046982protein heterodimerization activity
GO:0070410co-SMAD binding
GO:0070411I-SMAD binding
GO:0070412R-SMAD binding
GO:0008134transcription factor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001132SMAD domain, Dwarfin-typeSMARTSM00524dwBultra2coord: 25..143
e-value: 5.3E-22
score: 89.1
IPR001132SMAD domain, Dwarfin-typePFAMPF03166MH2coord: 26..133
e-value: 2.4E-33
score: 115.9
IPR001132SMAD domain, Dwarfin-typePROSITEPS51076MH2coord: 27..143
score: 32.082
IPR017855SMAD-like domain superfamilyGENE3DG3DSA:2.60.200.10coord: 17..140
e-value: 1.9E-36
score: 127.5
IPR013790DwarfinPANTHERPTHR13703SMADcoord: 25..134
NoneNo IPR availablePANTHERPTHR13703:SF42MOTHERS AGAINST DECAPENTAPLEGIC HOMOLOG 2coord: 25..134
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 27..134