rab-like protein 3

Overview
Namerab-like protein 3
Smed IDSMED30011582
Length (bp)864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of rab-like protein 3 (SMED30011582) t-SNE clustered cells

Violin plots show distribution of expression levels for rab-like protein 3 (SMED30011582) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of rab-like protein 3 (SMED30011582) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for rab-like protein 3 (SMED30011582) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011582

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011582SMESG000018562.1 SmedASXL_018121SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30011582SMESG000041325.1 Contig3765GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011582SMESG000018562.1 Contig3765GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of rab-like protein 3 vs. Ensembl Human
Match: RABL3 (RAB, member of RAS oncogene family like 3 [Source:HGNC Symbol;Acc:HGNC:18072])

HSP 1 Score: 166.007 bits (419), Expect = 8.347e-50
Identity = 90/228 (39.47%), Postives = 137/228 (60.09%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIF 727
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GII V+D+TNKKS  NL  W  E L R+          T ++   G Y  + F++N           Q+P+LVIGT LDQI  +  H+++  R    ++    +EI L   +   LA G SN+V + RFFD+VI  + F
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRD-------LVPTGVLVTNGDYDQEQFADN-----------QIPLLVIGTKLDQIHETKRHEVL-TRTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYF 209          
BLAST of rab-like protein 3 vs. Ensembl Human
Match: RABL3 (RAB, member of RAS oncogene family like 3 [Source:HGNC Symbol;Acc:HGNC:18072])

HSP 1 Score: 145.206 bits (365), Expect = 5.882e-42
Identity = 73/179 (40.78%), Postives = 112/179 (62.57%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQII 580
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GII V+D+TNKKS  NL  W  E L R+          T ++   G Y  + F++N           Q+P+LVIGT LDQI  +  H+++
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRD-------LVPTGVLVTNGDYDQEQFADN-----------QIPLLVIGTKLDQIHETKRHEVL 161          
BLAST of rab-like protein 3 vs. Ensembl Human
Match: RABL3 (RAB, member of RAS oncogene family like 3 [Source:HGNC Symbol;Acc:HGNC:18072])

HSP 1 Score: 127.487 bits (319), Expect = 2.775e-36
Identity = 56/117 (47.86%), Postives = 84/117 (71.79%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GII V+D+TNKKS  NL  W  E L R+
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRD 117          
BLAST of rab-like protein 3 vs. Ensembl Human
Match: RABL3 (RAB, member of RAS oncogene family like 3 [Source:HGNC Symbol;Acc:HGNC:18072])

HSP 1 Score: 127.872 bits (320), Expect = 3.145e-36
Identity = 56/117 (47.86%), Postives = 84/117 (71.79%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GII V+D+TNKKS  NL  W  E L R+
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRD 117          
BLAST of rab-like protein 3 vs. Ensembl Human
Match: RAB34 (RAB34, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16519])

HSP 1 Score: 71.633 bits (174), Expect = 5.163e-14
Identity = 39/118 (33.05%), Postives = 62/118 (52.54%), Query Frame = 2
Query:   50 YLITLMSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            + IT  + ++  K+IV GD  VGKT L+N  C DT   N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   II+V+++ +  S  +  +WLA+ L+ N
Sbjct:   42 FPITNSAGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEV-LGIP----FSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKEN 154          
BLAST of rab-like protein 3 vs. Ensembl Celegans
Match: Y116A8C.10 (pep chromosome:WBcel235:IV:16934266:16936483:-1 gene:WBGene00013790.1 transcript:Y116A8C.10b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.10)

HSP 1 Score: 106.686 bits (265), Expect = 2.380e-27
Identity = 72/213 (33.80%), Postives = 106/213 (49.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNP----NWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVI 712
            KI+V GDS VGKT+L + +             + TIGA V +  H+Y+AGTP Q    +ELWDIGG   H  +  VF+ G  G ILV+D+TNK+SE NL  WL  +L   P   +G + ++S   + +       S           +P+L++GT  D +P           +G  S    YD + +   SL  +  G +NS+ + RFFD  +
Sbjct:   10 KILVLGDSCVGKTSLCHCIAGGGEPPGGGRSFDSTIGATVVMAWHEYRAGTPEQRTELLELWDIGGMVAHRQAAQVFFEGAVGAILVHDLTNKRSEENLATWLT-MLDGKP---RGAAPKSSKDPAAVALKVDIES---------CNIPVLIVGTKADLVP----------HKGPVS----YDRLHID--SLKIILRGSANSITLSRFFDSCL 193          
BLAST of rab-like protein 3 vs. Ensembl Celegans
Match: Y116A8C.10 (pep chromosome:WBcel235:IV:16934266:16939003:-1 gene:WBGene00013790.1 transcript:Y116A8C.10b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.10)

HSP 1 Score: 106.686 bits (265), Expect = 2.380e-27
Identity = 72/213 (33.80%), Postives = 106/213 (49.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNP----NWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVI 712
            KI+V GDS VGKT+L + +             + TIGA V +  H+Y+AGTP Q    +ELWDIGG   H  +  VF+ G  G ILV+D+TNK+SE NL  WL  +L   P   +G + ++S   + +       S           +P+L++GT  D +P           +G  S    YD + +   SL  +  G +NS+ + RFFD  +
Sbjct:   10 KILVLGDSCVGKTSLCHCIAGGGEPPGGGRSFDSTIGATVVMAWHEYRAGTPEQRTELLELWDIGGMVAHRQAAQVFFEGAVGAILVHDLTNKRSEENLATWLT-MLDGKP---RGAAPKSSKDPAAVALKVDIES---------CNIPVLIVGTKADLVP----------HKGPVS----YDRLHID--SLKIILRGSANSITLSRFFDSCL 193          
BLAST of rab-like protein 3 vs. Ensembl Celegans
Match: Y116A8C.10 (pep chromosome:WBcel235:IV:16934266:16939111:-1 gene:WBGene00013790.1 transcript:Y116A8C.10b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.10)

HSP 1 Score: 106.686 bits (265), Expect = 2.380e-27
Identity = 72/213 (33.80%), Postives = 106/213 (49.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNP----NWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVI 712
            KI+V GDS VGKT+L + +             + TIGA V +  H+Y+AGTP Q    +ELWDIGG   H  +  VF+ G  G ILV+D+TNK+SE NL  WL  +L   P   +G + ++S   + +       S           +P+L++GT  D +P           +G  S    YD + +   SL  +  G +NS+ + RFFD  +
Sbjct:   10 KILVLGDSCVGKTSLCHCIAGGGEPPGGGRSFDSTIGATVVMAWHEYRAGTPEQRTELLELWDIGGMVAHRQAAQVFFEGAVGAILVHDLTNKRSEENLATWLT-MLDGKP---RGAAPKSSKDPAAVALKVDIES---------CNIPVLIVGTKADLVP----------HKGPVS----YDRLHID--SLKIILRGSANSITLSRFFDSCL 193          
BLAST of rab-like protein 3 vs. Ensembl Celegans
Match: rab-35 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3])

HSP 1 Score: 67.3958 bits (163), Expect = 3.983e-13
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            K+++ GDSGVGK++L+     +T   N   TIG   +I+  D            +++WD  G +      S +Y GT G+++VYDVTN +S  N+  WL EI
Sbjct:   12 KLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVK-----LQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEI 108          
BLAST of rab-like protein 3 vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 66.6254 bits (161), Expect = 6.891e-13
Identity = 36/104 (34.62%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYD+T++++ NN+ +WL EI R
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDR 111          
BLAST of rab-like protein 3 vs. Ensembl Fly
Match: CG4789 (gene:FBgn0030792 transcript:FBtr0074333)

HSP 1 Score: 151.754 bits (382), Expect = 3.614e-44
Identity = 92/252 (36.51%), Postives = 143/252 (56.75%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEIL-RRNPDMNQ--GCSEETSIMGSYLGDSFSN-NSDWY-----RRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKR 793
            M+   +V+I+V GDSGVGKT+L +++ ++  +  P WT+G  +++K+H ++ GT  +  Y VEL+D+GG  NH N+RSVFY+G DGIILV+D+TN KS+  L +WL EI+ +   D N+  G S   S        S  N  +D +           TQ PILV+GT LD +    + ++  ++ G  +     +EI L+  +  SLA G +++V + RFFD+VI  +   +  L    SS N  S    +R
Sbjct:    1 MAMNNRVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWLNCRNSRSLAAGTTDAVKLSRFFDRVIENRKALRAALAFGVSSSNAVSPPDRRR 252          
BLAST of rab-like protein 3 vs. Ensembl Fly
Match: CG15399 (gene:FBgn0031460 transcript:FBtr0077730)

HSP 1 Score: 77.0258 bits (188), Expect = 2.300e-16
Identity = 63/246 (25.61%), Postives = 109/246 (44.31%), Query Frame = 2
Query:   83 VKIIVAGDSGVGKTALVNMLCYDTVVTNPN-WTIGAQ---VEIKLHDYQA--------------------------GTPSQAN--YCVELWDIGG-YKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMK 721
            V+I++ GD GVGKT+L N++    +   P+  T+G +   V+++LH+Y                             TP+  N  Y VE +D+   ++     R  FY   DGI+LVY++    S+++L++WL + LR      Q C      + S L +                  PILV+GTNLD++      +   +RRG+ +     +E++++ +   S      N   +  F ++VI  K
Sbjct:   12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSSSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDSLHDWLYDPLR------QICKHRHLRIRSILKNH---------------NAPILVVGTNLDKL-----MRRPLRRRGSIAHQLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIEFK 231          
BLAST of rab-like protein 3 vs. Ensembl Fly
Match: RabX4 (gene:FBgn0051118 transcript:FBtr0084736)

HSP 1 Score: 68.9366 bits (167), Expect = 1.259e-13
Identity = 56/184 (30.43%), Postives = 87/184 (47.28%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLC----YDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR-RNPDMNQ-------GCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGT----NLDQIPPSINHQIIEQR 589
            K++V GDS VGKT +V+  C    YDT ++    TIG   + KL +   G P +    +++WD  G +      + +Y G  GI+L+YDVTN +S NNL+ WL  I    +PD+ +        CS    ++    G+  + N D          MP   +      N++    S+  +I EQR
Sbjct:   10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYIS----TIGIDFKQKLINLD-GVPIK----LQIWDTAGQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGEKIAENFD----------MPFFEVSCKSNINIEDAFLSLARKIREQR 174          
BLAST of rab-like protein 3 vs. Ensembl Fly
Match: Rab35 (gene:FBgn0031090 transcript:FBtr0333549)

HSP 1 Score: 67.781 bits (164), Expect = 2.706e-13
Identity = 37/102 (36.27%), Postives = 56/102 (54.90%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            K+++ GDSGVGK++L+     DT   +   TIG   +I+  D +          +++WD  G +      S +Y GT G+I+VYDVTN +S  N+  WL EI
Sbjct:   10 KLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEG-----MRVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI 106          
BLAST of rab-like protein 3 vs. Ensembl Fly
Match: Rab35 (gene:FBgn0031090 transcript:FBtr0303258)

HSP 1 Score: 67.781 bits (164), Expect = 2.706e-13
Identity = 37/102 (36.27%), Postives = 56/102 (54.90%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            K+++ GDSGVGK++L+     DT   +   TIG   +I+  D +          +++WD  G +      S +Y GT G+I+VYDVTN +S  N+  WL EI
Sbjct:   10 KLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEG-----MRVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI 106          
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Match: rabl3 (RAB, member of RAS oncogene family-like 3 [Source:NCBI gene;Acc:403048])

HSP 1 Score: 164.466 bits (415), Expect = 1.932e-49
Identity = 89/227 (39.21%), Postives = 136/227 (59.91%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  + +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L ++       S  T I+ S        N D+ R       +P+L+IGT  DQIP +  + ++  R    S+    +EI L   +   LA G SN+V + RFFD+VI  + F +
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYREGTPEEKAFYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALSKD-------SSPTGIIVS--------NGDYDREQFAENAVPLLLIGTKFDQIPENKRNDVL-TRTAFLSEDFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFTR 211          
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Match: rabl3 (RAB, member of RAS oncogene family-like 3 [Source:NCBI gene;Acc:403048])

HSP 1 Score: 164.466 bits (415), Expect = 1.932e-49
Identity = 89/227 (39.21%), Postives = 136/227 (59.91%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  + +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L ++       S  T I+ S        N D+ R       +P+L+IGT  DQIP +  + ++  R    S+    +EI L   +   LA G SN+V + RFFD+VI  + F +
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYREGTPEEKAFYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALSKD-------SSPTGIIVS--------NGDYDREQFAENAVPLLLIGTKFDQIPENKRNDVL-TRTAFLSEDFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFTR 211          
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Match: rabl3 (RAB, member of RAS oncogene family-like 3 [Source:NCBI gene;Acc:403048])

HSP 1 Score: 125.946 bits (315), Expect = 9.837e-36
Identity = 55/117 (47.01%), Postives = 85/117 (72.65%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  + +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L ++
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYREGTPEEKAFYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALSKD 117          
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Match: rab34a (RAB34, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-041010-197])

HSP 1 Score: 70.4774 bits (171), Expect = 7.298e-14
Identity = 35/106 (33.02%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            K+IV GD  VGKT L+N  C D    N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   +I+V+D+T+  S  +  +WL + ++ N
Sbjct:   54 KVIVVGDLAVGKTCLINRFCKDVFDKNYKATIGVDFEMERFEV-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAVIIVFDLTDVASLEHTRQWLEDAMKEN 154          
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Match: rab34a (RAB34, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-041010-197])

HSP 1 Score: 70.4774 bits (171), Expect = 9.585e-14
Identity = 35/106 (33.02%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            K+IV GD  VGKT L+N  C D    N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   +I+V+D+T+  S  +  +WL + ++ N
Sbjct:   55 KVIVVGDLAVGKTCLINRFCKDVFDKNYKATIGVDFEMERFEV-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAVIIVFDLTDVASLEHTRQWLEDAMKEN 155          
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Match: gmfb (glia maturation factor, beta [Source:Xenbase;Acc:XB-GENE-6077246])

HSP 1 Score: 74.7146 bits (182), Expect = 6.457e-16
Identity = 51/144 (35.42%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  320 GIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNL 742
            GIILV+D+TNKKS  NL  W  E L R+        + T ++   G Y  + F++N           Q+P+LVIGT LDQIP +   +++  R    ++    +EI L   +   LA G SN+V + RFFD+V S +     +L
Sbjct:    4 GIILVHDLTNKKSSQNLYRWSLEALNRDL-------QPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIPEAKRSEVL-TRTAFLAEDFNAEEINLDCTNTRCLAAGSSNAVKLSRFFDKVQSTQFLRLVSL 128          
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Match: znf770 (zinc finger protein 770 [Source:Xenbase;Acc:XB-GENE-940142])

HSP 1 Score: 72.7886 bits (177), Expect = 8.934e-15
Identity = 38/113 (33.63%), Postives = 58/113 (51.33%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            +  Y+  K+IV GD  VGKT L+N  C DT   N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   II+ +D+T+  S  +  +WL + L+ N
Sbjct:   14 VGRYKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEI-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAIIIAFDLTDVSSLEHTKQWLQDALKEN 121          
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Match: znf770 (zinc finger protein 770 [Source:Xenbase;Acc:XB-GENE-940142])

HSP 1 Score: 72.7886 bits (177), Expect = 1.921e-14
Identity = 38/110 (34.55%), Postives = 57/110 (51.82%), Query Frame = 2
Query:   74 YQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            Y+  K+IV GD  VGKT L+N  C DT   N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   II+ +D+T+  S  +  +WL + L+ N
Sbjct:   50 YKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEI-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAIIIAFDLTDVSSLEHTKQWLQDALKEN 154          
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 68.1662 bits (165), Expect = 3.755e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   14 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 112          
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 68.1662 bits (165), Expect = 3.843e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 111          
BLAST of rab-like protein 3 vs. Ensembl Mouse
Match: Rabl3 (RAB, member RAS oncogene family-like 3 [Source:MGI Symbol;Acc:MGI:1914907])

HSP 1 Score: 170.629 bits (431), Expect = 9.236e-52
Identity = 92/228 (40.35%), Postives = 141/228 (61.84%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIF 727
            M++  +VK++V GDSGVGK++LV++LC++ V+ NP+WT+G  V+I++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E+L R+       +  T ++   G Y  + F++N           Q+P+LVIGT LDQI  +  H+++  R    ++    +EI L   +  S A G SN+V + RFFD+VI  + F
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCHNQVLGNPSWTVGCSVDIRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEVLNRD-------AVPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIHETKRHEVL-IRTAFLAEDFNAEEINLDCTNPRSSAAGSSNAVKLSRFFDKVIEKRYF 209          
BLAST of rab-like protein 3 vs. Ensembl Mouse
Match: Rabl3 (RAB, member RAS oncogene family-like 3 [Source:MGI Symbol;Acc:MGI:1914907])

HSP 1 Score: 131.339 bits (329), Expect = 6.472e-38
Identity = 58/118 (49.15%), Postives = 87/118 (73.73%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNP 406
            M++  +VK++V GDSGVGK++LV++LC++ V+ NP+WT+G  V+I++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E+L R+ 
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCHNQVLGNPSWTVGCSVDIRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEVLNRDA 118          
BLAST of rab-like protein 3 vs. Ensembl Mouse
Match: Rab34 (RAB34, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:104606])

HSP 1 Score: 68.5514 bits (166), Expect = 2.375e-13
Identity = 37/110 (33.64%), Postives = 56/110 (50.91%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMN 415
            K+IV GD  VGKT L+N  C DT   N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   II+V+++ +  S  +  +WL + L+ N   N
Sbjct:    6 KVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEV-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLTDALKENDPSN 110          
BLAST of rab-like protein 3 vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 68.1662 bits (165), Expect = 3.571e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 111          
BLAST of rab-like protein 3 vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 67.781 bits (164), Expect = 3.982e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 108          
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5ZKR4|RABL3_CHICK (Rab-like protein 3 OS=Gallus gallus OX=9031 GN=RABL3 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 4.913e-51
Identity = 92/230 (40.00%), Postives = 139/230 (60.43%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M+   +VK++V GDSGVGK++LV++LC++ V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG      S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R+          T ++   G Y  + F++N           Q+P+LVIGT LDQIP +  ++++  R    ++    +EI L   +   LA G SN+V + RFFD+VI  + F K
Sbjct:    1 MAALDRVKVLVLGDSGVGKSSLVHLLCHNQVLGNPSWTVGCSVDVRIHDYKEGTPEEKTYYIELWDVGGSVGSATSVKSTRAVFYNSLNGIILVHDLTNKKSSQNLYRWSLEALNRD-------VAPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIPETKRNEVL-TRTAFLAEDFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFFK 211          
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9D4V7|RABL3_MOUSE (Rab-like protein 3 OS=Mus musculus OX=10090 GN=Rabl3 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.461e-51
Identity = 92/228 (40.35%), Postives = 141/228 (61.84%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIF 727
            M++  +VK++V GDSGVGK++LV++LC++ V+ NP+WT+G  V+I++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E+L R+       +  T ++   G Y  + F++N           Q+P+LVIGT LDQI  +  H+++  R    ++    +EI L   +  S A G SN+V + RFFD+VI  + F
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCHNQVLGNPSWTVGCSVDIRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEVLNRD-------AVPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIHETKRHEVL-IRTAFLAEDFNAEEINLDCTNPRSSAAGSSNAVKLSRFFDKVIEKRYF 209          
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Match: sp|A4IHM6|RABL3_XENTR (Rab-like protein 3 OS=Xenopus tropicalis OX=8364 GN=rabl3 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.052e-51
Identity = 92/233 (39.48%), Postives = 141/233 (60.52%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNL 742
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V+++LH+Y+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R+        + T ++   G Y  + F++N           Q+P+LVIGT LDQIP +   +++  R    ++    +EI L   +   LA G SN+V + RFFD+VI  +   + NL
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRLHEYREGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNAVNGIILVHDLTNKKSSQNLYRWSLEALNRDL-------QPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIPEAKRSEVL-TRTAFLAEDFNAEEINLDCTNTRCLAAGSSNAVKLSRFFDKVIEKRYSREGNL 214          
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Match: sp|Q6GPS4|RABL3_XENLA (Rab-like protein 3 OS=Xenopus laevis OX=8355 GN=rabl3 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.410e-50
Identity = 92/230 (40.00%), Postives = 137/230 (59.57%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNL 742
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V+++LH+Y+ GTP +  Y  ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R          +   MG  +      N D+ R      Q+P+LVIGT LDQIP +  ++++  R    ++    +EI L   +   LA G SN+V + RFFD+VI  +   + NL
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRLHEYREGTPEEKTYYTELWDVGGSVGSASSVKSTRAVFYNAVNGIILVHDLTNKKSSQNLYRWSLEALNR----------DLQPMGVLV-----TNGDYDREQFADNQIPLLVIGTKLDQIPEAKRNEVL-TRTAFLAEDFNAEEINLDCTNTRCLAAGSSNAVKLSRFFDKVIEKRYPREGNL 214          
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Match: sp|Q32LJ6|RABL3_BOVIN (Rab-like protein 3 OS=Bos taurus OX=9913 GN=RABL3 PE=2 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 3.302e-49
Identity = 91/228 (39.91%), Postives = 138/228 (60.53%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIM---GSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIF 727
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R+          T ++   G Y  + F++N           Q+P+LVIGT LDQI  +  H+++  R    ++    +EI L   +   LA G SN+V + RFFD+VI  + F
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALNRD-------LVPTGVLVTNGDYDREQFADN-----------QIPLLVIGTKLDQIHENKRHEVL-TRTAFLAEDFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYF 209          
BLAST of rab-like protein 3 vs. TrEMBL
Match: A0A1S3JWL0 (rab-like protein 3 OS=Lingula unguis OX=7574 GN=LOC106176779 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.459e-59
Identity = 107/250 (42.80%), Postives = 154/250 (61.60%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSR-----YSNKRHV 799
            M+   KV+I+V GDSGVGKT+LV+M+C++  + NP+WTIG  V++KLHDY+AGTP++  Y +ELWDIGG  +H NSRS+FYS  +GIILV+D++N+KS  NL +WLAEIL +     +G   E      Y  + F+ N           Q+PILVIGT  D +  ++  + +  R  + ++    DEI L+   +  LAPG SN+V + RFFD+V+  +  +  NL   +S V +D R     YS   HV
Sbjct:    1 MAATDKVRILVVGDSGVGKTSLVHMICHNEPMLNPSWTIGCSVDVKLHDYKAGTPAEKTYFIELWDIGGSSSHKNSRSIFYSPVNGIILVHDLSNRKSHQNLRKWLAEILNK-----EGKGIENGYYDDYDPEQFAGN-----------QIPILVIGTKAD-LAETVKKETLLSRMSSIAEECCADEINLACNQVKYLAPGSSNAVRLSRFFDKVLERRYHSSNNLQTSQSPV-VDRRRPAMHYSKSSHV 232          
BLAST of rab-like protein 3 vs. TrEMBL
Match: E2B2L7 (Rab-like protein 3 OS=Harpegnathos saltator OX=610380 GN=EAI_00177 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.189e-58
Identity = 104/247 (42.11%), Postives = 151/247 (61.13%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKT---NLDIIRSSVNIDSRYSNKRH 796
            M+   KVKIIV GDSGVGKT+L +++C    ++NP+WT+G  VE+KLH+Y+ GTP+Q  Y +ELWD+GG +NH N+RSVFY+ T+GIILV+D+TN+KS+ NL +WL E+L ++   ++  S +      ++G               LT +PILVIGT LD IP   ++  + +R    ++    DEI L    + SLA G S+SV + RFFD+VI  + +      NLD  R  +   S Y+   H
Sbjct:    1 MAAIDKVKIIVVGDSGVGKTSLTHLICQQQPISNPSWTVGCSVEVKLHEYREGTPNQRRYFIELWDVGGSQNHKNTRSVFYNPTNGIILVHDLTNRKSQQNLQKWLEEVLNKDGTFSKSKSFDDFDPEKFVG---------------LTHIPILVIGTKLDLIPEVKSN--VHRRSSTIAEECGADEIFLDCRQIRSLAAGSSSSVKLSRFFDKVIERRYYASREGFNLDKRRPPLYSSSVYTKSYH 230          
BLAST of rab-like protein 3 vs. TrEMBL
Match: A0A088AHT6 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=LOC552042 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.317e-56
Identity = 101/222 (45.50%), Postives = 142/222 (63.96%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFN 730
            M+   KVKIIV GDSGVGKT+L +++C    ++NP+WTIG  VE+KLH+Y+ GTP+Q  Y +ELWDIGG +NH N+RSVFY+ T+GIILV+D+TN+KS+ NL +WL E+L          S++++ M S   D F        +    TQ+PILVIGT LD I        +++R    ++    DEI L    + SLA G S+SV + RFFD+VI  + ++
Sbjct:    1 MAAIDKVKIIVLGDSGVGKTSLTHLICQQQPISNPSWTIGCSVEVKLHEYKEGTPNQRRYFIELWDIGGSQNHKNTRSVFYNPTNGIILVHDLTNRKSQQNLQKWLEEVL----------SKDSNYMKSKSFDDFDPE-----KFVGSTQIPILVIGTKLDLIAEV--RTSVQRRSSTIAEECGADEIFLDCHQVRSLAAGSSSSVKLSRFFDKVIERRYYS 205          
BLAST of rab-like protein 3 vs. TrEMBL
Match: A0A154PS64 (Rab-like protein 3 OS=Dufourea novaeangliae OX=178035 GN=WN55_07490 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 7.934e-56
Identity = 99/222 (44.59%), Postives = 141/222 (63.51%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFN 730
            M+   KVKIIV GDSGVGKT+L +++C    ++NP+WTIG  VE+KLH+Y+  TP+Q  Y +ELWDIGG +NH N+RSVFY+ T+GIILV+D+TN+KS+ NL +WL E+L          S++++ M S   D F        +    TQ+PILVIGT LD +        + +R    ++    DEI L +  + SLA G S+SV + RFFD+VI  + ++
Sbjct:    1 MAAIDKVKIIVVGDSGVGKTSLTHLICQQQPISNPSWTIGCSVEVKLHEYKERTPNQRRYFIELWDIGGSQNHKNTRSVFYNPTNGIILVHDLTNRKSQQNLQKWLEEVL----------SKDSNYMKSKPFDDFDPE-----KFVGSTQIPILVIGTKLDLVAEV--RSSVHRRSSTIAEECGADEIFLDSRQVRSLAAGSSSSVKLSRFFDKVIERRYYS 205          
BLAST of rab-like protein 3 vs. TrEMBL
Match: E9J5Z9 (Uncharacterized protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_10594 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 9.727e-56
Identity = 99/222 (44.59%), Postives = 140/222 (63.06%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFN 730
            M+   KVKIIV GDSGVGKT+L +++C    + NP+WTIG  VE+KLH+Y+ GTP+Q  Y VELWD+GG ++H N+RSVFY+ T+GIILV+D+TN+KS+ NL +WL E+L ++   ++  S +      ++G                TQ+PILVIGT LD I  S N     +R    ++    DEI L    + SLA G S+SV + RFFD+VI  + ++
Sbjct:    1 MAAIDKVKIIVVGDSGVGKTSLTHLICQQLPIGNPSWTIGCSVEVKLHEYKEGTPNQRRYFVELWDVGGSQSHKNTRSVFYNPTNGIILVHDLTNRKSQQNLQKWLEEVLSKDGTFSKSKSFDDFDPEKFVGS---------------TQIPILVIGTKLDLISES-NFVKSNRRSATIAEECGADEIFLDCRQIRSLAAGSSSSVKLSRFFDKVIERRYYS 206          
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Match: rabl3 (RAB, member of RAS oncogene family like 3 [Source:NCBI gene;Acc:103041457])

HSP 1 Score: 163.31 bits (412), Expect = 4.224e-49
Identity = 87/227 (38.33%), Postives = 135/227 (59.47%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M++  +VK++V GDSGVGK++LV+++C + V+ NP+WT+G  V++++HDY+ GTP +  Y +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L ++       S  T ++ S        N D+ R       +P+L+IGT  DQIP +    ++  R    S+    +EI L + +    A G SN+V + RFFD+VI  + F +
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLVCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSMEALNKD-------SSPTGVIVS--------NGDYDREQFAENPIPLLIIGTKYDQIPENKRSDVL-TRTAFLSEDFNAEEINLDSTNPRYFAAGSSNAVKLSRFFDKVIEKRYFTR 211          
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Match: rab34a (ras-related protein Rab-34-like [Source:NCBI gene;Acc:103022556])

HSP 1 Score: 70.8626 bits (172), Expect = 6.396e-14
Identity = 36/110 (32.73%), Postives = 56/110 (50.91%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMN 415
            K+IV GD  VGKT L+N  C D    N   TIG   E++  +   G P    + ++LWD  G +      S +Y G   +I+V+D+T+  S  +  +WL + ++ N   N
Sbjct:   54 KVIVVGDLAVGKTCLINRFCKDAFDKNYKATIGVDFEMERFEV-LGVP----FSLQLWDTAGQERFKCIASTYYRGAQAVIIVFDLTDVASLQHTRQWLEDAMKENDPTN 158          
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Match: rab36 (ras-related protein Rab-36 [Source:NCBI gene;Acc:103042607])

HSP 1 Score: 70.4774 bits (171), Expect = 8.157e-14
Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN 403
            M   +  K +V GD  VGKT L+N  C D    +   TIG   EI+  +  +G P    Y +++WD  G +      S +Y G   II V+D+ + K+  +  +WL E LR N
Sbjct:   50 MDRLKMSKAVVVGDLNVGKTCLINRFCKDAFDRDYKATIGVDFEIERFEL-SGLP----YSLQIWDTAGQEKFKCIASAYYRGAQVIITVFDMADIKTLEHTRQWLVEALREN 157          
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000045110.1 (ras-related protein Rab-1A [Source:NCBI gene;Acc:103028654])

HSP 1 Score: 67.781 bits (164), Expect = 2.804e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 108          
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Match: rab1ba (zRAB1B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-873])

HSP 1 Score: 68.1662 bits (165), Expect = 3.031e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   31 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEIDR 129          
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 67.781 bits (164), Expect = 7.215e-14
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 111          
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Match: rab36 (RAB36, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040910-5])

HSP 1 Score: 66.6254 bits (161), Expect = 3.105e-13
Identity = 34/119 (28.57%), Postives = 63/119 (52.94%), Query Frame = 2
Query:   56 ITLMSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRN-PD 409
            IT +   +  K++V GD  VGKT L+N  C DT   +   TIG   E++  +   G P    + +++WD  G +      + +Y G   +++V+D+ + +S ++  +WL + ++ N PD
Sbjct:   25 ITYLYVLKISKVVVVGDLAVGKTCLINRFCKDTFDRDYKATIGVDFEVERFEI-CGVP----FSLQIWDTAGQERFKCIAAAYYRGAQVVLVVFDLADIESLDHAKQWLKDAMKENDPD 138          
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 62.003 bits (149), Expect = 7.024e-12
Identity = 37/121 (30.58%), Postives = 59/121 (48.76%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMG 448
            K+++ GDSGVGKT ++     D   +    TIG   +I+  D            +++WD  G +      + +Y G  GI+LVYD+TN+KS  N+  W+     RN + +     E  I+G
Sbjct:   10 KLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIK-----LQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWI-----RNIEEHASADVEKMILG 120          
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001552.1 (pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 gene:ENSPMAG00000001403.1 transcript:ENSPMAT00000001552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 9.412e-12
Identity = 29/104 (27.88%), Postives = 56/104 (53.85%), Query Frame = 2
Query:   80 KVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            +VK+++ G+S VGKT+L+  L  +  + N   T+G    +    Y      +A   +E+WD  G + H     +F+   +  +L YD+++++S N L  W++E+
Sbjct:   12 RVKLVLIGESNVGKTSLLRRLARNQFIPNEVATVG----VAFQSYVVHL-EEAPVRLEIWDTAGQERHRMLTPIFFRNAEAAVLTYDISSQESFNKLQFWISEL 110          
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Match: RAB31 (RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9771])

HSP 1 Score: 58.9214 bits (141), Expect = 7.734e-11
Identity = 33/112 (29.46%), Postives = 57/112 (50.89%), Query Frame = 2
Query:   77 QKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVE--LWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNP 406
            +++K+ + GD+GVGK+++V     D    N N TIGA    K       T  Q N   +  +WD  G +   +   ++Y G+   ++VYD+T ++S   L  W+ E+ +  P
Sbjct:    4 RELKVCLLGDTGVGKSSIVCRFVQDNFDPNINPTIGASFMTK-------TMPQGNEVHKYLIWDTAGQERFRSLAPMYYRGSAAAVIVYDITKEESFQMLKSWVRELRQHGP 108          
BLAST of rab-like protein 3 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 64.3142 bits (155), Expect = 7.756e-13
Identity = 37/104 (35.58%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ G+SGVGK+ L+     DT   +   TIG   +IK  +    T       +++WD  G +      S +Y G+ GII+VYDVT+++S N +  WL EI R
Sbjct:   10 KLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVK-----LQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDR 108          
BLAST of rab-like protein 3 vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 62.7734 bits (151), Expect = 2.906e-12
Identity = 39/112 (34.82%), Postives = 55/112 (49.11%), Query Frame = 2
Query:   65 MSNYQK--VKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEIL 394
            MS+ +K  +K+I+ GDSGVGKT+L++    D        TIGA    K    +          +++WD  G +   +    FY G D  +LVYDVTN  S  N+  W  E L
Sbjct:    1 MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK----EVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFL 108          
BLAST of rab-like protein 3 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 62.3882 bits (150), Expect = 3.675e-12
Identity = 38/114 (33.33%), Postives = 58/114 (50.88%), Query Frame = 2
Query:   83 VKIIVAGDSGVGKTALVNMLCYDTVVTNPNW--TIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ 418
            +KI++ GDSGVGK+ L+     D    NP++  TIG   +IK  D            ++LWD  G +      + +Y G  GIILVYDVT++++  N+ +W   +     D  Q
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKF--NPSFITTIGIDFKIKTVDINGKKVK-----LQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQ 127          
BLAST of rab-like protein 3 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 60.8474 bits (146), Expect = 1.656e-11
Identity = 35/110 (31.82%), Postives = 53/110 (48.18%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMN 415
            KI++ GDSGVGK+ L++    D        TIG +   +  + +           ++WD  G + +    S +Y G  G ++VYD++   S  N N WL E LR N D N
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVE-----NKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTE-LRENADDN 118          
BLAST of rab-like protein 3 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 58.9214 bits (141), Expect = 6.209e-11
Identity = 36/110 (32.73%), Postives = 57/110 (51.82%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMN 415
            KI++ GDSGVGK+ L++    +    +   TIG +   +  +   G   +A    ++WD  G + +    S +Y G  G ++VYD++   S  N N WL+E LR N D N
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEID-GKRIKA----QIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSE-LRENADDN 118          
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Match: EDO47568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA7])

HSP 1 Score: 176.022 bits (445), Expect = 2.294e-54
Identity = 92/229 (40.17%), Postives = 140/229 (61.14%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEE--------TSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRG-NFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKI 724
            M+  +KV+I V GDSGVGKT+LV+++C++  +++  WTIG  VE+KL+DY+ G P    + +E WDIGG  NH NSRS+FY+G +G+ILV+D+TN+KS  NL +WLAE+L  + D+    +++        T I+  Y  + F+ N           Q+P++V+GT LDQ  PS   ++    RG NF +    D I +  M++  L PG +NS  +  FFD+VI  + 
Sbjct:    1 MAAVEKVRIAVVGDSGVGKTSLVHLICHEESISSAAWTIGCTVEVKLYDYKEGMPGGKTFFLEFWDIGGSANHENSRSIFYNGINGLILVHDLTNRKSFTNLRKWLAEVLNASKDLYGANNKQKDSWFGFTTDIIEEYDPEQFAGN-----------QIPVIVVGTKLDQARPS---RLTSTARGMNFVEEIGADVISIDCMNVKQLRPGTANSKKLINFFDKVIERRF 215          
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Match: EDO28311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6U3])

HSP 1 Score: 139.043 bits (349), Expect = 1.050e-41
Identity = 59/110 (53.64%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEIL 394
            M+  +KV+I V GDSGVGKT+LV+++C++  +++  WTIG  VE+KL+DY+ G P    + +E WDIGG  NH NSRS+FY+G +G+ILV+D+TN+KS  NL +WLAE+L
Sbjct:    1 MAAVEKVRIAVVGDSGVGKTSLVHLICHEESISSAAWTIGCTVEVKLYDYKEGMPGGKTFFLEFWDIGGSANHENSRSIFYNGINGLILVHDLTNRKSFTNLRKWLAEVL 110          
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 67.781 bits (164), Expect = 1.224e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 111          
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 65.0846 bits (157), Expect = 7.127e-13
Identity = 34/102 (33.33%), Postives = 59/102 (57.84%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            K+++ GDSGVGKT ++     +T   NP++     ++ K+   + G        +++WD  G +      + +Y G  GI+LVYDVTN+KS +N+++WL +I
Sbjct:   11 KLLLIGDSGVGKTCIIFRFADNTF--NPSFISTIGIDFKIKTLELGGKKIK---LQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKI 107          
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Match: EDO43129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN1])

HSP 1 Score: 64.3142 bits (155), Expect = 2.249e-12
Identity = 34/102 (33.33%), Postives = 55/102 (53.92%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            KI++ GDSGVGK+ L+     D+   +   TIG   +IK               +++WD  G +      S +Y G  G+++VYD+T ++S NNL++WL E+
Sbjct:   18 KILLIGDSGVGKSCLLLRFVDDSHRESYQTTIGVDFKIKTMRVDGKVVK-----LQIWDTAGQERFRTITSSYYRGAHGVMIVYDITKRESYNNLHKWLMEV 114          
BLAST of rab-like protein 3 vs. Ensembl Medaka
Match: rabl3 (RAB, member of RAS oncogene family like 3 [Source:NCBI gene;Acc:101173619])

HSP 1 Score: 166.777 bits (421), Expect = 1.887e-50
Identity = 90/227 (39.65%), Postives = 136/227 (59.91%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  + +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R+       S  T ++ S        N D+ R       +P+L+IGT  DQIP S   +++  R    S+    +EI L   +   LA G SN+V + RFFD+VI  + F +
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRIHDYKEGTPEEKTFYIELWDVGGSVGSASSLKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALNRD-------SSPTGVIVS--------NGDYDREQFAENPVPLLLIGTKFDQIPESKRSEVL-TRTAFLSEDFIAEEINLDCTNPRYLAAGTSNAVKLSRFFDKVIEKRYFTR 211          
BLAST of rab-like protein 3 vs. Ensembl Medaka
Match: rabl3 (RAB, member of RAS oncogene family like 3 [Source:NCBI gene;Acc:101173619])

HSP 1 Score: 167.162 bits (422), Expect = 2.313e-50
Identity = 90/227 (39.65%), Postives = 136/227 (59.91%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNS----RSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNK 733
            M++  +VK++V GDSGVGK++LV++LC + V+ NP+WT+G  V++++HDY+ GTP +  + +ELWD+GG     +S    R+VFY+  +GIILV+D+TNKKS  NL  W  E L R+       S  T ++ S        N D+ R       +P+L+IGT  DQIP S   +++  R    S+    +EI L   +   LA G SN+V + RFFD+VI  + F +
Sbjct:    1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRIHDYKEGTPEEKTFYIELWDVGGSVGSASSLKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALNRD-------SSPTGVIVS--------NGDYDREQFAENPVPLLLIGTKFDQIPESKRSEVL-TRTAFLSEDFIAEEINLDCTNPRYLAAGTSNAVKLSRFFDKVIEKRYFTR 211          
BLAST of rab-like protein 3 vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 69.707 bits (169), Expect = 7.324e-14
Identity = 39/104 (37.50%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  D    T       +++WD  G +      S +Y G  GII+VYDVT ++S NN+ +WL EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKTVK-----LQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDR 108          
BLAST of rab-like protein 3 vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 69.707 bits (169), Expect = 7.324e-14
Identity = 39/104 (37.50%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  D    T       +++WD  G +      S +Y G  GII+VYDVT ++S NN+ +WL EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKTVK-----LQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDR 108          
BLAST of rab-like protein 3 vs. Ensembl Medaka
Match: rab1aa (ras-related protein Rab-1A [Source:NCBI gene;Acc:101162421])

HSP 1 Score: 67.781 bits (164), Expect = 2.843e-13
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT+++S NN+ +WL EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDR 108          
BLAST of rab-like protein 3 vs. Planmine SMEST
Match: SMESG000018562.1 (SMESG000018562.1)

HSP 1 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 252/257 (98.05%), Postives = 252/257 (98.05%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ-GCSEETSIMGSYLGD---SFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 823
            MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ GCSEETSIMGSYLGD   SFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFS VNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT
Sbjct:    1 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQEGCSEETSIMGSYLGDSFYSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSLVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 257          
BLAST of rab-like protein 3 vs. Planmine SMEST
Match: SMESG000018562.1 (SMESG000018562.1)

HSP 1 Score: 502.286 bits (1292), Expect = 0.000e+0
Identity = 252/262 (96.18%), Postives = 252/262 (96.18%), Query Frame = 2
Query:   65 MSNYQKVKIIVAGDS-----GVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ-GCSEETSIMGSYLGDSF---SNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 823
            MSNYQKVKIIVAGDS     GVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ GCSEETSIMGSYLGDSF   SNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFS VNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT
Sbjct:    1 MSNYQKVKIIVAGDSVINSLGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQEGCSEETSIMGSYLGDSFYSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSLVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 262          
BLAST of rab-like protein 3 vs. Planmine SMEST
Match: SMESG000018562.1 (SMESG000018562.1)

HSP 1 Score: 460.685 bits (1184), Expect = 2.598e-166
Identity = 228/233 (97.85%), Postives = 228/233 (97.85%), Query Frame = 2
Query:  137 MLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ-GCSEETSIMGSYLGDSF---SNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 823
            MLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQ GCSEETSIMGSYLGDSF   SNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFS VNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT
Sbjct:    1 MLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQEGCSEETSIMGSYLGDSFYSFSNNSDWYRRSSNLTQMPILVIGTNLDQIPPSINHQIIEQRRGNFSLVNQYDEIILSNMSLDSLAPGCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRIDKGT 233          
BLAST of rab-like protein 3 vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.493e-14
Identity = 37/102 (36.27%), Postives = 57/102 (55.88%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEI 391
            K+++ GDSGVGKT+L+     +T  T+   TIG   +IK  D +          +++WD  G +      + +Y G  GI+LVYDVT+  S NN+N+W+  I
Sbjct:   10 KLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEG-----KKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNI 106          
BLAST of rab-like protein 3 vs. Planmine SMEST
Match: SMESG000026323.1 (SMESG000026323.1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.888e-13
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   86 KIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILR 397
            K+++ GDSGVGK+ L+     DT   +   TIG   +I+  +    T       +++WD  G +      S +Y G  GII+VYDVT++ S NN+  WL+EI R
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIK-----LQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNVKNWLSEIDR 108          
The following BLAST results are available for this feature:
BLAST of rab-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RABL38.347e-5039.47RAB, member of RAS oncogene family like 3 [Source:... [more]
RABL35.882e-4240.78RAB, member of RAS oncogene family like 3 [Source:... [more]
RABL32.775e-3647.86RAB, member of RAS oncogene family like 3 [Source:... [more]
RABL33.145e-3647.86RAB, member of RAS oncogene family like 3 [Source:... [more]
RAB345.163e-1433.05RAB34, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y116A8C.102.380e-2733.80pep chromosome:WBcel235:IV:16934266:16936483:-1 ge... [more]
Y116A8C.102.380e-2733.80pep chromosome:WBcel235:IV:16934266:16939003:-1 ge... [more]
Y116A8C.102.380e-2733.80pep chromosome:WBcel235:IV:16934266:16939111:-1 ge... [more]
rab-353.983e-1335.29RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3][more]
rab-16.891e-1334.62RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG47893.614e-4436.51gene:FBgn0030792 transcript:FBtr0074333[more]
CG153992.300e-1625.61gene:FBgn0031460 transcript:FBtr0077730[more]
RabX41.259e-1330.43gene:FBgn0051118 transcript:FBtr0084736[more]
Rab352.706e-1336.27gene:FBgn0031090 transcript:FBtr0333549[more]
Rab352.706e-1336.27gene:FBgn0031090 transcript:FBtr0303258[more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl31.932e-4939.21RAB, member of RAS oncogene family-like 3 [Source:... [more]
rabl31.932e-4939.21RAB, member of RAS oncogene family-like 3 [Source:... [more]
rabl39.837e-3647.01RAB, member of RAS oncogene family-like 3 [Source:... [more]
rab34a7.298e-1433.02RAB34, member RAS oncogene family a [Source:ZFIN;A... [more]
rab34a9.585e-1433.02RAB34, member RAS oncogene family a [Source:ZFIN;A... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmfb6.457e-1635.42glia maturation factor, beta [Source:Xenbase;Acc:X... [more]
znf7708.934e-1533.63zinc finger protein 770 [Source:Xenbase;Acc:XB-GEN... [more]
znf7701.921e-1434.55zinc finger protein 770 [Source:Xenbase;Acc:XB-GEN... [more]
rab1a3.755e-1336.54RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
rab1a3.843e-1336.54RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rabl39.236e-5240.35RAB, member RAS oncogene family-like 3 [Source:MGI... [more]
Rabl36.472e-3849.15RAB, member RAS oncogene family-like 3 [Source:MGI... [more]
Rab342.375e-1333.64RAB34, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a3.571e-1336.54RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a3.982e-1336.54RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of rab-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZKR4|RABL3_CHICK4.913e-5140.00Rab-like protein 3 OS=Gallus gallus OX=9031 GN=RAB... [more]
sp|Q9D4V7|RABL3_MOUSE6.461e-5140.35Rab-like protein 3 OS=Mus musculus OX=10090 GN=Rab... [more]
sp|A4IHM6|RABL3_XENTR9.052e-5139.48Rab-like protein 3 OS=Xenopus tropicalis OX=8364 G... [more]
sp|Q6GPS4|RABL3_XENLA3.410e-5040.00Rab-like protein 3 OS=Xenopus laevis OX=8355 GN=ra... [more]
sp|Q32LJ6|RABL3_BOVIN3.302e-4939.91Rab-like protein 3 OS=Bos taurus OX=9913 GN=RABL3 ... [more]
back to top
BLAST of rab-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JWL05.459e-5942.80rab-like protein 3 OS=Lingula unguis OX=7574 GN=LO... [more]
E2B2L72.189e-5842.11Rab-like protein 3 OS=Harpegnathos saltator OX=610... [more]
A0A088AHT61.317e-5645.50Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
A0A154PS647.934e-5644.59Rab-like protein 3 OS=Dufourea novaeangliae OX=178... [more]
E9J5Z99.727e-5644.59Uncharacterized protein (Fragment) OS=Solenopsis i... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl34.224e-4938.33RAB, member of RAS oncogene family like 3 [Source:... [more]
rab34a6.396e-1432.73ras-related protein Rab-34-like [Source:NCBI gene;... [more]
rab368.157e-1433.63ras-related protein Rab-36 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000045110.12.804e-1336.54ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab1ba3.031e-1336.54zRAB1B, member RAS oncogene family a [Source:ZFIN;... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1aa7.215e-1436.54RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab363.105e-1328.57RAB36, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a7.024e-1230.58RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000001552.19.412e-1227.88pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 g... [more]
RAB317.734e-1129.46RAB31, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT17.756e-1335.58Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT72.906e-1234.82Rab family GTPase; GTP-binding protein of the rab ... [more]
SEC43.675e-1233.33Rab family GTPase; essential for vesicle-mediated ... [more]
YPT321.656e-1131.82Rab family GTPase involved in the exocytic pathway... [more]
YPT316.209e-1132.73Rab family GTPase; involved in the exocytic pathwa... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475682.294e-5440.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283111.050e-4153.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401671.224e-1336.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408457.127e-1333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431292.249e-1233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of rab-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl31.887e-5039.65RAB, member of RAS oncogene family like 3 [Source:... [more]
rabl32.313e-5039.65RAB, member of RAS oncogene family like 3 [Source:... [more]
zgc:1719277.324e-1437.50ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
zgc:1719277.324e-1437.50ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
rab1aa2.843e-1336.54ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of rab-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018562.10.000e+098.05SMESG000018562.1[more]
SMESG000018562.10.000e+096.18SMESG000018562.1[more]
SMESG000018562.12.598e-16697.85SMESG000018562.1[more]
SMESG000030619.18.493e-1436.27SMESG000030619.1[more]
SMESG000026323.14.888e-1336.54SMESG000026323.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011582 ID=SMED30011582|Name=rab-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=864bp
ATTTTGATTTTTAAAATATTGATTCAATTTTGAAAAACATTTGTTTATAT
ATTTAATAACTTTAATGTCAAATTATCAAAAAGTTAAAATAATTGTTGCT
GGCGATTCTGGCGTAGGAAAAACTGCTTTAGTAAATATGTTATGCTATGA
TACAGTTGTGACAAACCCGAATTGGACCATTGGTGCCCAAGTTGAAATTA
AACTACATGACTACCAAGCTGGAACTCCGTCACAAGCAAATTATTGTGTC
GAATTATGGGATATAGGAGGCTACAAGAATCATACAAATTCGAGATCAGT
ATTTTATTCTGGAACTGATGGAATAATTTTAGTTTATGATGTTACAAATA
AGAAGTCGGAAAATAATCTTAATGAATGGTTAGCAGAAATTTTGAGACGC
AATCCAGACATGAACCAAGGATGTAGTGAAGAAACATCTATAATGGGTTC
TTACTTAGGAGATTCTTTTTCTAATAATTCTGATTGGTATCGAAGATCTA
GCAATTTAACTCAAATGCCTATTCTTGTAATAGGAACTAATTTAGATCAA
ATTCCTCCTTCGATAAATCATCAAATCATTGAACAACGCCGTGGGAATTT
CTCCCAAGTTAATCAATACGACGAAATAATTTTATCAAACATGTCATTGG
ATTCTCTGGCACCGGGATGTAGTAATTCAGTAGTAATAGATAGATTCTTC
GATCAAGTAATCAGTATGAAAATATTTAACAAAACTAATTTAGATATCAT
CCGCTCTTCTGTCAATATTGATAGCCGATATTCCAATAAGAGACATGTAC
TGATAAGAATTGATAAAGGGACTTAATGTATTTGAAATAAAAATTTTATT
GATTTGAAAAAAAA
back to top

protein sequence of SMED30011582-orf-1

>SMED30011582-orf-1 ID=SMED30011582-orf-1|Name=SMED30011582-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=254bp
MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDY
QAGTPSQANYCVELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSEN
NLNEWLAEILRRNPDMNQGCSEETSIMGSYLGDSFSNNSDWYRRSSNLTQ
MPILVIGTNLDQIPPSINHQIIEQRRGNFSQVNQYDEIILSNMSLDSLAP
GCSNSVVIDRFFDQVISMKIFNKTNLDIIRSSVNIDSRYSNKRHVLIRID
KGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR013684MIRO-like
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 153..166
score: 24.69
coord: 7..28
score: 40.35
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 7..148
e-value: 1.8E-6
score: -28.9
NoneNo IPR availablePFAMPF08477Roccoord: 8..114
e-value: 7.2E-19
score: 68.2
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 5..233
NoneNo IPR availablePANTHERPTHR24073:SF964coord: 5..233
NoneNo IPR availablePROSITEPS51419RABcoord: 1..257
score: 11.842
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..168