AP2-associated protein kinase 1-like Protein

Overview
NameAP2-associated protein kinase 1-like Protein
Smed IDSMED30011581
Length (bp)2311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AP2-associated protein kinase 1-like Protein (SMED30011581) t-SNE clustered cells

Violin plots show distribution of expression levels for AP2-associated protein kinase 1-like Protein (SMED30011581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AP2-associated protein kinase 1-like Protein (SMED30011581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AP2-associated protein kinase 1-like Protein (SMED30011581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v6_1179_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v6_1179_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011581SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 238.424 bits (607), Expect = 9.256e-68
Identity = 141/344 (40.99%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F     + + M     +   FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  P+ N + S  P    L  P+K SE     T   +  ++ + P    ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTG--FTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNS--PIPAKLPEPVKASEAAAKKT---QPKARLTDPIPTTETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 238.424 bits (607), Expect = 1.417e-66
Identity = 143/348 (41.09%), Postives = 207/348 (59.48%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  P+ N + S  P    L  P+K SE     T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIP--AKLPEPVKASEAAAKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 237.654 bits (605), Expect = 6.984e-66
Identity = 143/348 (41.09%), Postives = 207/348 (59.48%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  P+ N + S  P    L  P+K SE     T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIP--AKLPEPVKASEAAAKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Match: BMP2K (BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC:18041])

HSP 1 Score: 228.024 bits (580), Expect = 3.385e-64
Identity = 134/336 (39.88%), Postives = 199/336 (59.23%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ +A+GG+ TV+   +    + ALK++ VNN   L  C REI I++ +   + I+ ++D  +     +++EV IL  +     + ++M     +   FTE +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       +++EI ++TTL+YR+PEM +LY   G   I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ ++L P+PE RP+I+Q++   F    K  PV N   S  P  +AL  PM  SE     +  + + + +  PT   ETSI PR RPK
Sbjct:   51 VTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTG--FTEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLY---GGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIP--SALPEPMTASEAAARKSQIKARITDTIGPT---ETSIAPRQRPK 375          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Match: BMP2K (BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC:18041])

HSP 1 Score: 228.024 bits (580), Expect = 5.553e-62
Identity = 134/336 (39.88%), Postives = 199/336 (59.23%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ +A+GG+ TV+   +    + ALK++ VNN   L  C REI I++ +   + I+ ++D  +     +++EV IL  +     + ++M     +   FTE +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       +++EI ++TTL+YR+PEM +LY   G   I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ ++L P+PE RP+I+Q++   F    K  PV N   S  P  +AL  PM  SE     +  + + + +  PT   ETSI PR RPK
Sbjct:   51 VTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTG--FTEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLY---GGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIP--SALPEPMTASEAAARKSQIKARITDTIGPT---ETSIAPRQRPK 375          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 184.111 bits (466), Expect = 8.017e-49
Identity = 142/383 (37.08%), Postives = 205/383 (53.52%), Query Frame = 1
Query:  148 KSITLKYE--SVVIDDKIAQGGYGTVYKAHSF-HKQYALKK-LCVNNEDKLLNCIRE-IFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIG--YPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTP-EPESRPNIYQLASVLFS-----------------------------MTSKSNPVQNCEKS-REPDLNALSLPMKESEFKMSNTNRQKKN-SKSSMPTQP--VETSIIPRNRPK 1173
            K +TLK +   V I+ +IA+GG+  VY A    + ++ALK+    +NE +L  C RE  F+ + +  + I+ FVDS      + I+E  +LT ++  N+   M    S +Q  T  ++L I T++ EAV+ +H+    PIIHRDLKVENVLI    P  YVLCDFGSAT + +       + ++ E+ + TT+ YRSPEM D +Y G E  IG K+DIWALGVL+Y +CFF +PF +S L+I S  +  P   P   D +KVL Y+L   +   RP+IYQ + + F                              M   SNP    + S R P+      P  +S  KM++ ++Q  + S  SMP+    VETS+ PR RPK
Sbjct:   36 KGVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHN-RPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMID-FYSGLE--IGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFPS-VPNIPDEIKVLIYMLLDIDVNRRPSIYQTSVLAFEANHRKPLSEEIQNKKCTDAVPSLKSCIQLMRDGSNPRNKRDSSPRNPE-----APPIQSSSKMASLSQQVPSISNISMPSGSGTVETSVAPRLRPK 408          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 183.726 bits (465), Expect = 8.866e-48
Identity = 142/383 (37.08%), Postives = 205/383 (53.52%), Query Frame = 1
Query:  148 KSITLKYE--SVVIDDKIAQGGYGTVYKAHSF-HKQYALKK-LCVNNEDKLLNCIRE-IFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIG--YPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTP-EPESRPNIYQLASVLFS-----------------------------MTSKSNPVQNCEKS-REPDLNALSLPMKESEFKMSNTNRQKKN-SKSSMPTQP--VETSIIPRNRPK 1173
            K +TLK +   V I+ +IA+GG+  VY A    + ++ALK+    +NE +L  C RE  F+ + +  + I+ FVDS      + I+E  +LT ++  N+   M    S +Q  T  ++L I T++ EAV+ +H+    PIIHRDLKVENVLI    P  YVLCDFGSAT + +       + ++ E+ + TT+ YRSPEM D +Y G E  IG K+DIWALGVL+Y +CFF +PF +S L+I S  +  P   P   D +KVL Y+L   +   RP+IYQ + + F                              M   SNP    + S R P+      P  +S  KM++ ++Q  + S  SMP+    VETS+ PR RPK
Sbjct:   36 KGVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHN-RPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMID-FYSGLE--IGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFP-SVPNIPDEIKVLIYMLLDIDVNRRPSIYQTSVLAFEANHRKPLSEEIQNKKCTDAVPSLKSCIQLMRDGSNPRNKRDSSPRNPE-----APPIQSSSKMASLSQQVPSISNISMPSGSGTVETSVAPRLRPK 408          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 183.726 bits (465), Expect = 8.866e-48
Identity = 142/383 (37.08%), Postives = 205/383 (53.52%), Query Frame = 1
Query:  148 KSITLKYE--SVVIDDKIAQGGYGTVYKAHSF-HKQYALKK-LCVNNEDKLLNCIRE-IFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIG--YPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTP-EPESRPNIYQLASVLFS-----------------------------MTSKSNPVQNCEKS-REPDLNALSLPMKESEFKMSNTNRQKKN-SKSSMPTQP--VETSIIPRNRPK 1173
            K +TLK +   V I+ +IA+GG+  VY A    + ++ALK+    +NE +L  C RE  F+ + +  + I+ FVDS      + I+E  +LT ++  N+   M    S +Q  T  ++L I T++ EAV+ +H+    PIIHRDLKVENVLI    P  YVLCDFGSAT + +       + ++ E+ + TT+ YRSPEM D +Y G E  IG K+DIWALGVL+Y +CFF +PF +S L+I S  +  P   P   D +KVL Y+L   +   RP+IYQ + + F                              M   SNP    + S R P+      P  +S  KM++ ++Q  + S  SMP+    VETS+ PR RPK
Sbjct:   36 KGVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHN-RPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMID-FYSGLE--IGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFP-SVPNIPDEIKVLIYMLLDIDVNRRPSIYQTSVLAFEANHRKPLSEEIQNKKCTDAVPSLKSCIQLMRDGSNPRNKRDSSPRNPE-----APPIQSSSKMASLSQQVPSISNISMPSGSGTVETSVAPRLRPK 408          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Match: gakh-1 (GAK Homolog [Source:UniProtKB/TrEMBL;Acc:Q20483])

HSP 1 Score: 106.686 bits (265), Expect = 8.844e-24
Identity = 84/274 (30.66%), Postives = 138/274 (50.36%), Query Frame = 1
Query:  181 IDDKIAQGGYGTVYKA-HSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQC-FTESDVLLIMTNIS-EAVACLHHFTSTPI--------IHRDLKVENVLIGYPMRYVLCDFGSATLK--EVRP-CDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYI----LTPEPESR 948
            ++  IA+GG+GTV+ A ++  KQ A+K +  ++     +   EI +++ +  E I+   D+      S+                S  +   S   C F+ +DVLL    +S + V  + +FT+  +        IHRD+K EN+LI    +  LCDFGSAT K  E+ P  +  R  +Q+E+ ++TT   RSPE+ D+Y +     IG++ D WA+G L+Y + F   PF  S L+I++G++  P   P   + L     +    LTP P+ R
Sbjct:   41 VEKVIAKGGFGTVFLATNTKGKQVAVKIMLSHDAAATKDIDNEIDMMKKLQHENIIQLFDASAESRSSN---------------RSVKEYKISMEYCKFSIADVLLKYKEVSIDFVVRIIYFTTRALVYLHSVGAIHRDIKAENLLINGNGKLKLCDFGSATTKSIEMAPLSNSERLAVQEEMFKYTTPITRSPEVCDVYSN---WPIGKQQDNWAMGCLIYFVAFGEHPFDGSALAIINGKYKKP--PPVQQNQLSAFADLIAKCLTPNPDER 294          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7425729:7444660:1 gene:WBGene00006814.1 transcript:B0496.3h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 72.0182 bits (175), Expect = 1.413e-12
Identity = 82/315 (26.03%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  115 GYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKA--HSFHKQYA---LKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVF------ILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQF-TTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDS-----VLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPV 1008
            G   C+ +K+ K    ++E   I  K+  G YG V  A  H F ++ A   +KK  + ++  L+   REI I+  ++   I+             I+EVF      IL   Y  +   E+    S      E++   I   I+ AV   H      + HRDLK+EN+L+       + DFG +        D N       ++ F  +  Y SPE+ +     G    G + D W+LG+L+Y + + S+PF        V  I  G +  P+  P +  +L  +  +L   PE R  I+ +AS  +    ++ PV
Sbjct:   44 GAEPCSPTKKEKH---RFE---ITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMSALNHPNIIQ------------IYEVFENKDKIILVMEY--SSGGELYDYVSRCGSLPEAEARRIFRQITSAVLYCHKHR---VAHRDLKLENILLDQNNNAKIADFGLSNYF----ADKNL------LTTFCGSPLYASPEIIN-----GTPYKGPEVDCWSLGILLYTLVYGSMPFDGRDFNRMVRQIKRGAYFEPE-TPSTASML--IRNMLRVNPERRATIFDIASHWWLNLEENMPV 317          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0081189)

HSP 1 Score: 255.373 bits (651), Expect = 4.078e-74
Identity = 146/350 (41.71%), Postives = 208/350 (59.43%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAH------SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             K  T+   +V ++D +A+GG+  V+ A       S   +YALK++ VNNE  L    REI I  N+   + I+ +VDS I  T + + EV +L  +   ++ + M         FTE +VL I  +I+EAV+ LH +  TPIIHRDLKVEN+L      +VLCDFGSAT K + P       +Q+EI ++TTL+YR+PEM DLY   G   I  KADIWALG ++Y +CFFSLPFG+S L+I +GQF++PD   YS  + +++ Y+L P+ E RPNI+Q+  V F +  K NPVQN  K+  P+ + L +P  ESE K  +    K     ++      TS+ PR+RPK
Sbjct:   36 GKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLH-YCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLY---GGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPDSSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVPPFESEAKRISAAASKAAKAQNVSVVEAGTSVAPRSRPK 379          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0340326)

HSP 1 Score: 255.373 bits (651), Expect = 5.309e-74
Identity = 146/350 (41.71%), Postives = 208/350 (59.43%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAH------SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             K  T+   +V ++D +A+GG+  V+ A       S   +YALK++ VNNE  L    REI I  N+   + I+ +VDS I  T + + EV +L  +   ++ + M         FTE +VL I  +I+EAV+ LH +  TPIIHRDLKVEN+L      +VLCDFGSAT K + P       +Q+EI ++TTL+YR+PEM DLY   G   I  KADIWALG ++Y +CFFSLPFG+S L+I +GQF++PD   YS  + +++ Y+L P+ E RPNI+Q+  V F +  K NPVQN  K+  P+ + L +P  ESE K  +    K     ++      TS+ PR+RPK
Sbjct:   36 GKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLH-YCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLY---GGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPDSSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVPPFESEAKRISAAASKAAKAQNVSVVEAGTSVAPRSRPK 379          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0081187)

HSP 1 Score: 255.373 bits (651), Expect = 2.998e-71
Identity = 146/350 (41.71%), Postives = 208/350 (59.43%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAH------SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             K  T+   +V ++D +A+GG+  V+ A       S   +YALK++ VNNE  L    REI I  N+   + I+ +VDS I  T + + EV +L  +   ++ + M         FTE +VL I  +I+EAV+ LH +  TPIIHRDLKVEN+L      +VLCDFGSAT K + P       +Q+EI ++TTL+YR+PEM DLY   G   I  KADIWALG ++Y +CFFSLPFG+S L+I +GQF++PD   YS  + +++ Y+L P+ E RPNI+Q+  V F +  K NPVQN  K+  P+ + L +P  ESE K  +    K     ++      TS+ PR+RPK
Sbjct:   36 GKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLH-YCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLY---GGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPDSSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVPPFESEAKRISAAASKAAKAQNVSVVEAGTSVAPRSRPK 379          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0340325)

HSP 1 Score: 255.373 bits (651), Expect = 2.998e-71
Identity = 146/350 (41.71%), Postives = 208/350 (59.43%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAH------SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             K  T+   +V ++D +A+GG+  V+ A       S   +YALK++ VNNE  L    REI I  N+   + I+ +VDS I  T + + EV +L  +   ++ + M         FTE +VL I  +I+EAV+ LH +  TPIIHRDLKVEN+L      +VLCDFGSAT K + P       +Q+EI ++TTL+YR+PEM DLY   G   I  KADIWALG ++Y +CFFSLPFG+S L+I +GQF++PD   YS  + +++ Y+L P+ E RPNI+Q+  V F +  K NPVQN  K+  P+ + L +P  ESE K  +    K     ++      TS+ PR+RPK
Sbjct:   36 GKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLH-YCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLY---GGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPDSSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVPPFESEAKRISAAASKAAKAQNVSVVEAGTSVAPRSRPK 379          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Match: CG1227 (gene:FBgn0037491 transcript:FBtr0339736)

HSP 1 Score: 121.324 bits (303), Expect = 7.798e-30
Identity = 79/300 (26.33%), Postives = 147/300 (49.00%), Query Frame = 1
Query:  124 NCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAH--SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVD-------SIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSAT---LKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPF------GDSV-LSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQL 966
             C  S + +++ +      I +++A GG+  +      S  + YA+K++  ++ D     +REI   R +  E ++  VD        I+  T S +F   +L  +   +L+  ++          E+ +L I   + E +  +H     P+ HRDLK  N+ +      ++ D GS T   L+ V   D  R  LQDE  + +++ YR+PE   L+       I  + DIW+LG ++Y +C+F+ P+      GDSV L++LSG   +P+   Y++D+ +++ Y+L  +P  RP ++ +
Sbjct:   13 GCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLF--IVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQR--LQDEAEERSSIVYRAPE---LFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSV 305          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Match: aak1b (AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE-091118-25])

HSP 1 Score: 246.514 bits (628), Expect = 9.235e-69
Identity = 140/351 (39.89%), Postives = 211/351 (60.11%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             ++ T+    V +++ +A+GG+  V+   +    + ALK++ VNNE  L  C REI I+R+++  + I+ F+DS I      D++EVFIL +F         ++  ++T       F+E + L I  +  EAVA LH +  TPIIHRDLKVEN+L+     YVLCDFGSAT+K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWA+G L+Y +CFF+LPFG+S ++I  G FT+PD+  YS D+ +++ Y+L P+P+ RP+IYQ++   F +  +  PVQN + S  P    L  P++ SE     +  Q K ++ + P    ETSI PR RPK
Sbjct:   37 GRNFTVGRHQVTVEETLAEGGFAIVFLVRTNQGVRCALKRMYVNNEHDLQVCKREIQIMRDLNGHKNIVGFLDSSITAVGGGDVWEVFILMDFCRGGQVVNLMNQRLQT------GFSEQEALQIFCDTCEAVARLHQY-KTPIIHRDLKVENILLHDRGHYVLCDFGSATMKFQNPQSEGVTAVEDEIKKYTTLSYRAPEMVNLYNG---KIITTKADIWAMGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSQDMHRLIRYMLEPDPDKRPDIYQVSFFAFKLARRDCPVQNVKNSPIP--AKLPEPIRASEAAAKKSQTQTK-ARLTDPIPTTETSITPRQRPK 374          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Match: aak1a (AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE-081105-101])

HSP 1 Score: 233.417 bits (594), Expect = 4.317e-67
Identity = 137/343 (39.94%), Postives = 204/343 (59.48%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ +A+GG+  V+   +    + ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+ES+VL I  +  EAVA LH     PIIHRDLKVEN+L+     YVLCDFGSA  +   P       +++EI ++TTL+YR+PEM +LY   G  VI  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+I+Q++   F ++ +  PVQN   S  P    L  P++ SE   +   + +  ++ + P    ETSI PR RPK G
Sbjct:   43 VTVEETVAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKMEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSESEVLQIFCDTCEAVARLHQ-CKPPIIHRDLKVENILLHDRGHYVLCDFGSAINRSQNPQTEGVAVVEEEIKKYTTLSYRAPEMVNLY---GGMVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSHDMHCLIRYMLEPDPDMRPDIFQVSYFAFKLSRRDCPVQNVHNSPIP--TKLPEPIRASE---AVAKKSQNKARLTDPVPTTETSIAPRQRPKAG 370          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Match: aak1a (AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE-081105-101])

HSP 1 Score: 233.802 bits (595), Expect = 3.668e-65
Identity = 139/343 (40.52%), Postives = 205/343 (59.77%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ +A+GG+  V+   +    + ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+ES+VL I  +  EAVA LH     PIIHRDLKVEN+L+     YVLCDFGSA  +   P       +++EI ++TTL+YR+PEM +LY   G  VI  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+I+Q++   F ++ +  PVQN   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   43 VTVEETVAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKMEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSESEVLQIFCDTCEAVARLHQ-CKPPIIHRDLKVENILLHDRGHYVLCDFGSAINRSQNPQTEGVAVVEEEIKKYTTLSYRAPEMVNLY---GGMVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSHDMHCLIRYMLEPDPDMRPDIFQVSYFAFKLSRRDCPVQNVHNSPIP--TKLPEPIRASE-AVAKKSQNKARLTDPVPT--TETSIAPRQRPKAG 370          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Match: bmp2k (BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-041212-72])

HSP 1 Score: 217.624 bits (553), Expect = 9.176e-61
Identity = 135/336 (40.18%), Postives = 190/336 (56.55%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQC-FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ IA+GG+  V+ A +    + ALK++ VNN   L    REI I++ +   + I+ ++DS        ++EV IL  +        +K M       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       ++DEI ++TTL+YR+PEM +LY       I  KADIWALG L+Y +CFF+LPFG+S ++I  G F VPD   +S  L  ++ Y+L P+ E RP+IYQ++   F +  K  PV N   S  P   +L  P   S+     +  + + + S  PT   ETSI PR RPK
Sbjct:   40 VTVEELIAEGGFSMVFLARTHSGVRCALKRMYVNNVHDLNIFRREITIMKELSGHKNIVRYLDSTTNAVGDSVWEVLILMEYC--KAGQVVKQMNQRLHIGFTEAEVLNIFCDACEAVARLHQ-CKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGITAVEDEIKKYTTLSYRAPEMINLYQG---KAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGTFAVPDGSKFSSKLHGLIRYMLEPDQEKRPDIYQVSYFAFRLAGKECPVPNLFNSPLP--TSLPEPFTASDIAAKKSLTKARITDSVGPT---ETSIAPRQRPK 364          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Match: bmp2k (BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-041212-72])

HSP 1 Score: 217.238 bits (552), Expect = 1.246e-60
Identity = 135/336 (40.18%), Postives = 190/336 (56.55%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQC-FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ IA+GG+  V+ A +    + ALK++ VNN   L    REI I++ +   + I+ ++DS        ++EV IL  +        +K M       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       ++DEI ++TTL+YR+PEM +LY       I  KADIWALG L+Y +CFF+LPFG+S ++I  G F VPD   +S  L  ++ Y+L P+ E RP+IYQ++   F +  K  PV N   S  P   +L  P   S+     +  + + + S  PT   ETSI PR RPK
Sbjct:   40 VTVEELIAEGGFSMVFLARTHSGVRCALKRMYVNNVHDLNIFRREITIMKELSGHKNIVRYLDSTTNAVGDSVWEVLILMEYC--KAGQVVKQMNQRLHIGFTEAEVLNIFCDACEAVARLHQ-CKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGITAVEDEIKKYTTLSYRAPEMINLYQG---KAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGTFAVPDGSKFSSKLHGLIRYMLEPDQEKRPDIYQVSYFAFRLAGKECPVPNLFNSPLP--TSLPEPFTASDIAAKKSLTKARITDSVGPT---ETSIAPRQRPK 364          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 243.047 bits (619), Expect = 2.358e-70
Identity = 144/353 (40.79%), Postives = 208/353 (58.92%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL ++         ++  ++T       FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +CFF+LPFG+S +SI  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  +  PVQN   +  P    L  P+K  E     T   +  ++ + P    ETSI PR RPKPG
Sbjct:   32 GRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMNQRLQT------GFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSG---KMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIP--VKLPEPIKAGEAAAKKT---QPKARLTDPVPTTETSIAPRQRPKPG 369          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 243.047 bits (619), Expect = 7.001e-70
Identity = 144/353 (40.79%), Postives = 208/353 (58.92%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL ++         ++  ++T       FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +CFF+LPFG+S +SI  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  +  PVQN   +  P    L  P+K  E     T   +  ++ + P    ETSI PR RPKPG
Sbjct:   32 GRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMNQRLQT------GFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSG---KMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIP--VKLPEPIKAGEAAAKKT---QPKARLTDPVPTTETSIAPRQRPKPG 369          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 243.047 bits (619), Expect = 2.772e-68
Identity = 144/353 (40.79%), Postives = 208/353 (58.92%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL ++         ++  ++T       FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +CFF+LPFG+S +SI  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  +  PVQN   +  P    L  P+K  E     T   +  ++ + P    ETSI PR RPKPG
Sbjct:   32 GRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMNQRLQT------GFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSG---KMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIP--VKLPEPIKAGEAAAKKT---QPKARLTDPVPTTETSIAPRQRPKPG 369          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 243.432 bits (620), Expect = 1.824e-67
Identity = 144/353 (40.79%), Postives = 208/353 (58.92%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL ++         ++  ++T       FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +CFF+LPFG+S +SI  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  +  PVQN   +  P    L  P+K  E     T   +  ++ + P    ETSI PR RPKPG
Sbjct:   32 GRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMNQRLQT------GFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSG---KMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIP--VKLPEPIKAGEAAAKKT---QPKARLTDPVPTTETSIAPRQRPKPG 369          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 243.047 bits (619), Expect = 4.878e-67
Identity = 145/359 (40.39%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL ++            C   Q            FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +CFF+LPFG+S +SI  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  +  PVQN   +  P    L  P+K  E     T   +  ++ + P    ETSI PR RPKPG
Sbjct:   32 GRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDY------------CRGGQVVNLMNQRLQTGFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSG---KMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIP--VKLPEPIKAGEAAAKKT---QPKARLTDPVPTTETSIAPRQRPKPG 369          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Match: Aak1 (AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI:1098687])

HSP 1 Score: 238.81 bits (608), Expect = 8.516e-67
Identity = 142/348 (40.80%), Postives = 208/348 (59.77%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  PV N + S  P    L  P+K SE  +  T   +  ++ + P    ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIP--AKLPEPVKASEAAVKKT---QPKARLTDPIPTTETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Match: Aak1 (AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI:1098687])

HSP 1 Score: 238.81 bits (608), Expect = 1.857e-66
Identity = 144/348 (41.38%), Postives = 208/348 (59.77%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  PV N + S  P    L  P+K SE  +  T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIP--AKLPEPVKASEAAVKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Match: Bmp2k (BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2155456])

HSP 1 Score: 228.409 bits (581), Expect = 1.760e-64
Identity = 135/337 (40.06%), Postives = 201/337 (59.64%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ +A+GG+ TV+  + HS  +  ALK++ VNN   L  C REI I++ +   + I+ ++D  +     +++EV IL  +     + ++M     +   FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       +++EI ++TTL+YR+PEM +LY   G   I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ ++L P+PE RP+I+Q++   F    K  PV N   S  P  + L  PM  +E     +  + + + +  PT   ETSI PR RPK
Sbjct:   48 VTLEESLAEGGFSTVFLVRTHSGIR-CALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTG--FTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLY---GGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSHNVHCLIRFMLEPDPECRPDIFQVSYFAFKFAKKDCPVSNINNSFLP--STLPEPMTATEAAARKSQMKARITDTIGPT---ETSIAPRQRPK 372          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Match: Bmp2k (BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2155456])

HSP 1 Score: 227.639 bits (579), Expect = 4.676e-62
Identity = 135/337 (40.06%), Postives = 201/337 (59.64%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ +A+GG+ TV+  + HS  +  ALK++ VNN   L  C REI I++ +   + I+ ++D  +     +++EV IL  +     + ++M     +   FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       +++EI ++TTL+YR+PEM +LY   G   I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ ++L P+PE RP+I+Q++   F    K  PV N   S  P  + L  PM  +E     +  + + + +  PT   ETSI PR RPK
Sbjct:   48 VTLEESLAEGGFSTVFLVRTHSGIR-CALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTG--FTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLY---GGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSHNVHCLIRFMLEPDPECRPDIFQVSYFAFKFAKKDCPVSNINNSFLP--STLPEPMTATEAAARKSQMKARITDTIGPT---ETSIAPRQRPK 372          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Match: Gak (cyclin G associated kinase [Source:MGI Symbol;Acc:MGI:2442153])

HSP 1 Score: 122.479 bits (306), Expect = 5.548e-28
Identity = 90/281 (32.03%), Postives = 141/281 (50.18%), Query Frame = 1
Query:  193 IAQGGYGTVYKAHSFH--KQYALKKLCVNNEDKLLNCIREIFILRNVHCEY-ILHFVDSIIY---QTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRP----CDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSV-LSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSN 1002
            +A+GG+  VY+A      ++YALK+L  N E+K    I+E+  L+ +     I+ F  +      ++D+   E  +LT      L   +K +        +S +L I      AV  +H     PIIHRDLKVEN+L+       LCDFGSAT     P        R  +++EI++ TT  YR+PE+ DLY +     IG K DIWALG ++Y +CF   PF D   L I++G++++P +         ++  +L   PE R +I ++   L  + +  N
Sbjct:   46 LAEGGFAFVYEAQDLGSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKRVECKGPLSCDS-ILKIFYQTCRAVQHMHR-QKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSN---FPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYTVFHDLIRAMLKVNPEERLSIAEVVRQLQEIAAARN 321          
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Match: sp|F1SPM8|AAK1_PIG (AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 8.862e-66
Identity = 145/348 (41.67%), Postives = 207/348 (59.48%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTES+VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  PV N + S  P    L  P+K SE     T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTESEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSFFSFKLLKKECPVPNVQNSPIP--AKLPEPVKASEAAAKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Match: sp|Q3UHJ0|AAK1_MOUSE (AP2-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Aak1 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 1.299e-65
Identity = 144/348 (41.38%), Postives = 208/348 (59.77%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  PV N + S  P    L  P+K SE  +  T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIP--AKLPEPVKASEAAVKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Match: sp|F1MH24|AAK1_BOVIN (AP2-associated protein kinase 1 OS=Bos taurus OX=9913 GN=AAK1 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 1.547e-65
Identity = 145/354 (40.96%), Postives = 204/354 (57.63%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F            C   Q            FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      VI  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  P+ N + S  P    L  P+K SE     T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDF------------CRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIP--TKLPEPVKASEAAAKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Match: sp|Q2M2I8|AAK1_HUMAN (AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3)

HSP 1 Score: 237.654 bits (605), Expect = 3.354e-65
Identity = 143/348 (41.09%), Postives = 207/348 (59.48%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K  P+ N + S  P    L  P+K SE     T + K      +PT   ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIP--AKLPEPVKASEAAAKKT-QPKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Match: sp|P0C1X8|AAK1_RAT (AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.249e-64
Identity = 143/348 (41.09%), Postives = 207/348 (59.48%), Query Frame = 1
Query:  160 LKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            +  + V +D+ +A+GG+  V+   + +  + ALK++ VNNE  L  C REI I+R++   + I+ ++DS I    S D++EV IL +F         ++  ++T       FTE++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       ++DEI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+F+LPFG+S ++I  G FT+PD+  YS D +  L Y+L P+P+ RP+IYQ++   F +  K  PV N + S  P    L  P+K SE  +  T   +  ++ + P    ETSI PR RPK G
Sbjct:   41 IGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFTENEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSG---KIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQD-MHCLIYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIP--TKLPEPVKASEAAVKKT---QPKARLTDPIPTTETSIAPRQRPKAG 372          
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Match: A0A0X3P1N6 (BMP-2-inducible protein kinase (Fragment) OS=Schistocephalus solidus OX=70667 GN=BMP2K PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 2.189e-78
Identity = 136/329 (41.34%), Postives = 208/329 (63.22%), Query Frame = 1
Query:   88 ENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSF-HKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKES 1071
            ENE I     ++N    +  K   +    + ++  IA+GG+G V +  S   + +A+K+ CVNN+  L    RE+ I+ ++  + IL ++DS I +T+  I+EV ++T+FYP +++  +      +Q F E++VL ++ ++ EAV+ LHH   TPIIHRDLK+EN+LI     +VLCDFGSAT + + P        Q+EI + TTLAYR+PEM DLY +GG+  IG   DIWALG ++Y +CFFSLPFG + L+I +GQF +PDH  YS  L K++ ++L+ E   RP+I+Q+AS+ FS+  + NPV N   S+ P   +L+ P+ ES
Sbjct:   12 ENELISSQSAHHNSL--QTGKQFFVGNHKLTVEGIIAEGGFGVVCRVRSQDGRVFAMKRTCVNNKSDLATVKREVTIVSSLSHKNILKYIDSTITETEPGIYEVLLVTSFYPGSVAQVLTERRQKNQRFLETEVLRVLCDVCEAVSRLHH-CETPIIHRDLKIENILIDGQKNFVLCDFGSATSRVLHPGKHGPLRCQEEIEKHTTLAYRAPEMVDLYTNGGQP-IGPPVDIWALGCVVYGLCFFSLPFGANALAIQTGQFVIPDHSSYSPRLHKLIKFMLSVEALKRPDIFQVASLAFSLLGRPNPVLNVNASQLPSWQSLTEPLTES 336          
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Match: A0A139WLH0 (AP2-associated protein kinase 1-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC000132 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.315e-77
Identity = 163/412 (39.56%), Postives = 237/412 (57.52%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPV--ETSIIPRNRPKPGGKLQ-NYNNCHNTVQKPXXXXXXXXXXXXXXPDLLDFESQLEIESNNFETANQFSKTKSVDKL 1365
             K  T+  ++V ++D +A+GG+  VY     +  +YALK++ VNNE  L    REI I  ++   + I+ +VDS +  T   ++EV +L  +  +N+   MK    ++  FTE +VL I  +  EAV+ LHH   TPIIHRDLKVEN+L+G    YV+CDFGSAT K + P D     +++EI ++TTL+YR+PEM D+Y       I  KADIWALG L+Y +CFF+LPFG+S L+I SG F++PD+  YS  L +++ Y+L P+P+ RP+I+Q++ V F + SK NPV+N  KS  P L  L +P  ESE K +      K      P  P+   TS++PR RPK       N NN   T+  P+ +  K +      P +  + S       NF+T   F   K +D L
Sbjct:   24 GKVFTVGRQTVTVEDILAEGGFAIVYLVKGTNGTRYALKRMYVNNEQDLNVAKREIQIASSLSGHKNIIGYVDSSLTATGGGVYEVLLLMPYCQENVFGLMKQRGKAN--FTEHEVLTIFCDTCEAVSRLHH-CKTPIIHRDLKVENILVGENGNYVICDFGSATAKVLNPADKGVAPVEEEIKRYTTLSYRAPEMVDMYCG---KPITTKADIWALGCLLYRLCFFTLPFGESTLAIQSGNFSIPDNSKYSKGLHQLMRYMLEPDPDKRPDIFQVSCVAFQLLSKENPVKNLMKSPIPKLEDLPVPPFESELKKAQVKVYNKT-----PAAPIVEGTSVMPRQRPKGSSTTPLNLNNIPLTLS-PSPTTSKKSQSPVTQPPVTTYPS-------NFQTQPTFEPVKQLDSL 416          
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Match: A0A023G4X8 (Putative ark protein kinase family (Fragment) OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.999e-77
Identity = 149/345 (43.19%), Postives = 211/345 (61.16%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAH-SFHKQYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
             K  T+   +V ++D IA+GG+  V+    S + +YALK++ VN E  L  C REI I  N+   + I+ FVDS+I      ++EV +L ++Y  ++   M     S   F+E +VL I  +I EAV+ LHH   TPI+HRDLKVEN+LI     YVLCDFGSAT K + P       +++EI ++TTLAYR+PEM +LY      +I  KADIWALG L+Y +CFFSLPFG+S L+I SG FT+PD+  YS  +  ++ Y+L  +PE RP+I+Q++ V FS+  K  PVQN   S  P++  L +P  +SE K+S++    K  +S        TS+ PR RPK
Sbjct:   51 GKVFTVGRHTVTVEDVIAEGGFAIVFLVKGSNNVRYALKRMFVNEEHGLNVCKREIQIASNLSGHKNIIGFVDSVINHVGGGVYEVLMLMHYYKGHVLQLMNDKLQSG--FSEQEVLKIFCDICEAVSRLHH-CQTPIVHRDLKVENILISDSGHYVLCDFGSATAKSLNPQTQGVAVVEEEILKYTTLAYRAPEMVELYSG---KLITTKADIWALGCLLYKLCFFSLPFGESALAIQSGNFTIPDNSRYSKQMHSLIRYMLEVQPEKRPDIFQVSYVAFSLAGKECPVQNLHNSPIPNIEQLPVPQCDSEGKLSSS----KPPRSLQVPVAEGTSVAPRQRPK 385          
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Match: A0A4S2L7X9 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009198 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.034e-75
Identity = 146/346 (42.20%), Postives = 210/346 (60.69%), Query Frame = 1
Query:  172 SVVIDDKIAQGGYGTVYKAHSFHKQ-YALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKM--------SNTNRQKKNSKSSMPTQPVETSII---PRNRPK 1173
            S+V+D+ IA+GG+G V++  S   Q YALK+ CVN+   +  C REI I+ ++  + IL  +DS I +    IFEV +LT +YP +LS  +       Q  TE +VL I  ++ EAV  LHH   TPIIHRDLKVEN+LI     +VLCDFGSAT + + P     +  Q+EI+++TTLAYR+PEM +LY +     +G + DIWALG L+Y +CF +LPFGDS L+I SG +++PD  PYS+ L +++ Y+L  +   RP+I+Q++++ FS+T++ NP QN      P    LS+P +ES+ K           T R    S  S    P  T+ I   PR RP+
Sbjct:   46 SLVVDEIIAEGGFGVVFRVRSQQGQHYALKRTCVNSAQNMAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHHQRLTEVEVLRIFCDLCEAVCRLHH-CKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVP---LGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTSPYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSIPPRESQLKALRTQPLVHEPTKRSSPLSSGSQLATPFSTTSITLAPRQRPR 387          
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Match: A0A3R7H2D9 (AP2-associated protein kinase 1 OS=Clonorchis sinensis OX=79923 GN=AAK1 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.896e-75
Identity = 147/346 (42.49%), Postives = 210/346 (60.69%), Query Frame = 1
Query:  172 SVVIDDKIAQGGYGTVYKAHSFHKQY-ALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKM--------SNTNRQKKNSKSSMPTQPVETSII---PRNRPK 1173
            S+V+D+ IA+GG+G V++  S   QY ALK+ CVN+   L  C REI I+ ++  + IL  +DS I +    IFEV +LT +YP +LS  +       Q  TE +VL I  ++ EAV  LHH   TPIIHRDLKVEN+LI     +VLCDFGSAT + + P     +  Q+EI+++TTLAYR+PEM +LY +     +G + DIWALG L+Y +CF +LPFGDS L+I SG +++PD  PYS+ L +++ Y+L  +   RP+I+Q++++ FS+T++ NP QN      P    LS+P +ES+ K           T R    S  +    P  TS I   PR RP+
Sbjct:   46 SLVVDEIIAEGGFGVVFRVRSQQGQYYALKRTCVNSAQNLAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHQQRLTEVEVLRIFCDLCEAVCRLHH-CKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVP---LGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTSPYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSMPPRESQLKALRTQPVVHEPTKRSSPLSSGNQLATPFSTSSITLAPRQRPR 387          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Match: aak1b (AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE-091118-25])

HSP 1 Score: 243.817 bits (621), Expect = 3.222e-72
Identity = 142/353 (40.23%), Postives = 211/353 (59.77%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             ++ T+    V +++ +A+GG+  V+   +    + ALK++ VNNE  L  C REI I+R++   + I+ F+DS + Q    D++EVFIL +F         ++  ++T       F+E++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K   P       +++EI ++TTL+YR+PEM +LY      +I  KADIWALG L+Y +C+FSLPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++     +  +  PVQN + S  P  N L  P++ SE     +  Q K ++ + P    ETSI PR RPK G
Sbjct:   36 GRNFTVGRHQVTVEETLAEGGFAIVFLVRTNQGVRCALKRMYVNNEYDLQVCRREIQIMRDLSGHKNIVGFLDSSVTQVGGGDVWEVFILMDFCKGGQVVNLMNQRLQTG------FSEAEVLQIFCDSCEAVAQLHQ-CKTPIIHRDLKVENILLHEKGHYVLCDFGSATKKFQNPQSEGVTIVEEEIKKYTTLSYRAPEMVNLY---NGKIITTKADIWALGCLLYKLCYFSLPFGESQVAICDGNFTIPDNSRYSHDMHCLIRYMLEPDPDKRPDIYQVSHFACRLARRDCPVQNVKNSPLP--NKLPEPVRASEAAAKKSQTQTK-ARLTDPIPTTETSITPRQRPKAG 375          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000003200.2 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 239.58 bits (610), Expect = 8.562e-67
Identity = 146/359 (40.67%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ IA+GG+  V+   +    + ALK++ VNNE  L  C REI I+R+ V  + I+ F+DS I    S D++EV IL +F            C   Q            F+E +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT +   P       +++EI ++TTL+YR+PEM +LY   G  +I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K   VQN   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   36 GRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDF------------CRGGQVVNLMNQRLQTGFSEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLY---GGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEPIRASE-AVAKKSQTKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000054610.1 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 240.35 bits (612), Expect = 1.516e-66
Identity = 146/359 (40.67%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ IA+GG+  V+   +    + ALK++ VNNE  L  C REI I+R+ V  + I+ F+DS I    S D++EV IL +F            C   Q            F+E +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT +   P       +++EI ++TTL+YR+PEM +LY   G  +I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K   VQN   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   36 GRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDF------------CRGGQVVNLMNQRLQTGFSEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLY---GGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEPIRASE-AVAKKSQTKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000051497.1 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 240.35 bits (612), Expect = 1.948e-66
Identity = 146/359 (40.67%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ IA+GG+  V+   +    + ALK++ VNNE  L  C REI I+R+ V  + I+ F+DS I    S D++EV IL +F            C   Q            F+E +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT +   P       +++EI ++TTL+YR+PEM +LY   G  +I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K   VQN   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   36 GRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDF------------CRGGQVVNLMNQRLQTGFSEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLY---GGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEPIRASE-AVAKKSQTKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000042526.1 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 240.35 bits (612), Expect = 2.113e-66
Identity = 146/359 (40.67%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  145 SKSITLKYESVVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDNLSSEMKTMCSSSQC-----------FTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
             +  T+    V +D+ IA+GG+  V+   +    + ALK++ VNNE  L  C REI I+R+ V  + I+ F+DS I    S D++EV IL +F            C   Q            F+E +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT +   P       +++EI ++TTL+YR+PEM +LY   G  +I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS D+  ++ Y+L P+P+ RP+IYQ++   F +  K   VQN   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   36 GRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDF------------CRGGQVVNLMNQRLQTGFSEPEVLQIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLY---GGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEPIRASE-AVAKKSQTKARLTDPIPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006448.1 (pep scaffold:Pmarinus_7.0:GL476771:264361:311032:-1 gene:ENSPMAG00000005802.1 transcript:ENSPMAT00000006448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.588 bits (623), Expect = 2.717e-69
Identity = 146/342 (42.69%), Postives = 202/342 (59.06%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAH-SFHKQYALKKLCVNNEDKLLNCIREIFILRNV--HCEYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESE-FKMSNTNRQKKNSKSSM--PTQPVETSIIPRNRPKPG 1179
            V +++ +A+GG+  V+    S   + ALK++ VNNE  L  C REI I++ +  H   + +   SI  QT S ++EV IL        + ++M    S+   FTE +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       ++DEI ++TTL+YR+PEM +LY       I  K+DIWALG L+Y +CFF+LPFG+S ++I  G FT+PDH  YS ++  ++ Y+L P+P+SRP IYQ+A   F ++ K  P+ N        +N LSLP K  E  K S    +K  SK+ +     P ETSI PR RPK G
Sbjct:   45 VTVEEVLAEGGFAIVFLVKTSGGVRSALKRMYVNNEHDLKVCQREITIMKELSGHKNIVGYLDSSINAQTSSGVWEVLILMEICRAGQVVNQMNQRLSTG--FTECEVLRIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDNGNYVLCDFGSATNKILNPQAHGVSAVEDEIKKYTTLSYRAPEMVNLYNG---TPITAKSDIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDHSRYSHEMHCLIRYMLEPDPDSRPEIYQVACFAFKLSGKECPILN--------VNGLSLPNKLPEPLKASEAAARKTQSKTKLTETVGPTETSIAPRQRPKAG 372          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007073.1 (pep scaffold:Pmarinus_7.0:GL477321:233302:247915:1 gene:ENSPMAG00000006397.1 transcript:ENSPMAT00000007073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.106 bits (588), Expect = 1.015e-67
Identity = 141/327 (43.12%), Postives = 194/327 (59.33%), Query Frame = 1
Query:  202 GGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSII-YQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQ-CFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRP 1170
            GG+  V+ A +    Q ALK++ VNNE  L  C REI I++ +   + I+ ++DS I  Q  ++++EV +L  F        +  M    Q  F+E +VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K +         +++EI ++TTL+YRSPEM +LY       I  KADIWALG L+Y +CFFSLPFG+S ++I  G FTVPD+  YS DL  ++ Y+L PEP++RP+I+Q+ASV F +  K  PV N   +  P  + L  P+  SE   +   R +  +K   P  P ETSI+PR  P
Sbjct:    1 GGFSVVFLARTHSGIQCALKRMYVNNEHDLKVCKREITIMKELSGHKNIVGYLDSAINAQAATEVWEVLVLMEFCKGAAGQVVNQMNRRLQNGFSEREVLSIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLHDNGNYVLCDFGSATNKVLNTQVSGVPAVEEEIQKYTTLSYRSPEMVNLYSGIP---ITTKADIWALGCLLYKLCFFSLPFGESQVAICDGSFTVPDNSKYSHDLHCLIRYMLEPEPDTRPDIFQVASVGFKLAKKDCPVPNLHSAPVP--SRLPEPLLASE---AAARRIQVKTKLPDPCGPTETSIVPRQIP 318          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Match: stk16 (serine/threonine kinase 16 [Source:ZFIN;Acc:ZDB-GENE-050417-102])

HSP 1 Score: 84.7297 bits (208), Expect = 3.988e-18
Identity = 75/292 (25.68%), Postives = 132/292 (45.21%), Query Frame = 1
Query:  112 VGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFH--KQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYP-DNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFT--TLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPF------GDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPN 954
            +G  NC  S+   SI  K    +  +++ +GG+  V      H  + YALK++  +++D     +RE+ + R      +L    S + +      EV++L  +Y    L  E++ + +     TE  ++ I   I   +  +H        HRDLK  NVL+      VL D GS     +   + +R+ +  ++++    T++YR+PE   L+      +I  + DIW+LG +++ + F   PF      GDSV   +     VP    YS  L K+L  ++  +P  RP 
Sbjct:    1 MGQANCICSRGIFSIDDKRYFFI--EQLGEGGFSYVDLVEGAHNGRFYALKRIVCHDKDDHKGALREVEMHRAFRHPNVLPLEGSRVVERGPKC-EVWLLLPYYQRGTLWDELEKLRNKHSFMTEERIVGIFRGICSGLKDIH---DKGFAHRDLKPTNVLLSDEDVPVLMDLGSMEKARIEIKN-SREAMALQVTRAVRCTISYRAPE---LFTVPSHCIIDARTDIWSLGCVLFAMMFLEGPFDGVFQRGDSVALAVQSSVNVPSSSRYSQPLRKLLTSLMDVDPSERPT 282          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 77.0258 bits (188), Expect = 3.512e-15
Identity = 68/232 (29.31%), Postives = 109/232 (46.98%), Query Frame = 1
Query:  277 EDKLLNCIREIFILRNVHCE-YILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDS-----VLSILSGQ--FTVPDHCPYSDDLLKVLNYILTPEPESR 948
            ED   + ++E+ IL+ V    +I+  +D+  Y++ +  F VF L          E+    +     +E D   IM +I E V  LH   +  I+HRDLK EN+L+   M   L DFG +   ++RP +  R+          T  Y SPE+     D      G++ D+WA GV+MY +   S PF        +  I+ G+  F+ P+    SD +  +++ +L  EPE R
Sbjct:   69 EDIYSSTVKEVDILKAVSGHPHIITLIDA--YESSTFFFLVFDLMK------RGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLH---AKNIVHRDLKPENILLDDNMNIRLSDFGFSM--QLRPGERLRE-------LCGTPGYLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSPPFWHRKQMTMLRLIMDGKYDFSTPEWEDRSDTVKDLISRLLVVEPEKR 280          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Match: NIM1K (NIM1 serine/threonine protein kinase [Source:HGNC Symbol;Acc:HGNC:28646])

HSP 1 Score: 72.0182 bits (175), Expect = 1.189e-13
Identity = 59/185 (31.89%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  430 SSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQF-TTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPF-----GDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQL 966
              E+ T  S+       +  L+   I+ AV  +H      ++HRDLK ENV         + DFG +T   V P         + +S F  +  Y +PE   L+ D  +  +G + D+WALGVL++ I   +LPF     G   LSIL G F+VP   P S     ++  IL P P+ RP   Q+
Sbjct:  124 GGELFTRVSTVGALPHDEAKLVFAQITAAVKHMHECG---VVHRDLKAENVFYAGNCWVKVGDFGFST--TVTP--------NERLSTFCGSPPYAAPE---LFRD--QSYLGPQVDVWALGVLLFFIASGTLPFRADTVGKLKLSILDGCFSVPLRVPAS--CCNLITTILRPLPDERPTAAQI 288          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Match: ARK1 (Serine/threonine protein kinase; involved in regulation of the cortical actin cytoskeleton; involved in control of endocytosis; ARK1 has a paralog, PRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000004965])

HSP 1 Score: 145.976 bits (367), Expect = 5.516e-37
Identity = 106/325 (32.62%), Postives = 165/325 (50.77%), Query Frame = 1
Query:  112 VGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKA-------HSFHKQYALKKLCVNNEDKLLNCIREIFILRNV-HCEYILHFVDSIIYQT--DSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDL---QDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPF---GDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREP 1035
            +G YN         +T+    V I   +  GG+  VY A       HS      LK++ V ++  L     E+  +R + +  Y++ ++DS   +    +  +EVF+L  +     L   M T   +     E ++L IM+ +++ VA +H     P+IHRD+K+ENVLI     Y LCDFGS     +RP   N Q+L   Q +I + TT  YRSPEM D +       I  K+DIWALG+ +Y +C+++ PF   GD  L+ILSG+F  P +  YS+ L  ++  IL  +P  RPN+YQL   +  M +   P+ + +  + P
Sbjct:    6 IGTYNV-----GTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR--LHEFEILQIMSQVTQGVAAMHAL-QPPLIHRDIKIENVLISANNEYKLCDFGSVC-GIIRPPR-NSQELSYVQQDILKNTTAQYRSPEMIDTFRG---LPIDEKSDIWALGIFLYKLCYYTTPFEKGGD--LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Match: PRK1 (Protein serine/threonine kinase; regulates the organization and function of the actin cytoskeleton and reduces endocytic ability of cell through the phosphorylation of the Pan1p-Sla1p-End3p protein complex; PRK1 has a paralog, ARK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001357])

HSP 1 Score: 135.191 bits (339), Expect = 3.553e-33
Identity = 101/302 (33.44%), Postives = 156/302 (51.66%), Query Frame = 1
Query:  193 IAQGGYGTVYKA-------HSFHKQYALKKLCVNNEDKLLNCIRE----IFILRNVHCEYILHFVDSIIYQTDSDI-FEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQD---LQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSV-LSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNA 1047
            +  GG+  VY A       +S      LK++ V ++  L N +R     + +LRN   ++++ ++DS   ++ + I +EVF+L  F     L   M T   +     ES++L IM+   + +  +H     P+IHRD+K+ENVLI +   Y +CDFGS +   +RP   N Q+   +Q +I   TT  YRSPEM DLY       I  K+DIWALGV +Y IC+++ PF  S    IL  ++  P    YSD L  ++  +L   P  RPNI Q+   +  + +K  P++N    R  + NA
Sbjct:   28 LTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHKQGL-NTLRAEVDAMKLLRN--NKHVVSYIDSHAARSVNGIAYEVFVLMEFCERGGLIDFMNTRLQNR--LQESEILEIMSQTVQGITAMHAL-QPPLIHRDIKIENVLISHDGLYKVCDFGSVS-GVIRPPR-NTQEFNYVQHDILTNTTAQYRSPEMIDLYRG---LPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKPCPIRNFYLLRAMNQNA 318          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Match: AKL1 (Ser-Thr protein kinase; member (with Ark1p and Prk1p) of the Ark kinase family; involved in endocytosis and actin cytoskeleton organization [Source:SGD;Acc:S000000263])

HSP 1 Score: 112.079 bits (279), Expect = 8.874e-26
Identity = 80/246 (32.52%), Postives = 129/246 (52.44%), Query Frame = 1
Query:  253 LKKLCVNNEDKLLNCIREIFILRNVH-CEYILHFVDSIIYQTDSDI--FEVFILTNFYPD-NLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQD---LQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFG-DSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQL 966
            LK++ V +E+ L     E+ +++ +     I+ + DS   +    +  FEV +L    P+ +L   M    S+    TE++++ IM +++ +++ +H+   + +IHRD+K+ENVL+     + L DFGS +     P     QD   L   I   TT  YRSPEM DLY       I  K+DIWALGV +Y + FF+ PF      +IL  ++  P +  YS  L+ ++  +L   P  RPNIYQ+
Sbjct:   77 LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLDYMNQRLSTK--LTEAEIVKIMYDVALSISQMHYLPVS-LIHRDIKIENVLVDAKNNFKLADFGSTST--CFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRC---LPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQV 313          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Match: PSK2 (PAS-domain containing serine/threonine protein kinase; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation); PSK2 has a paralog, PSK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005405])

HSP 1 Score: 75.485 bits (184), Expect = 2.078e-14
Identity = 49/152 (32.24%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  511 EAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQL 966
            + VA + H     I+HRD+K ENV++       L DFGSA   +  P DV             T+ Y +PE+      GG    G+  DIWALGVL+Y I +   P+ + +  IL G+         S++ + ++  ILT E + RP I ++
Sbjct:  958 QVVASIKHLHDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPFDV----------FVGTMDYAAPEVL-----GGSSYKGKPQDIWALGVLLYTIIYKENPYYN-IDEILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 74.7146 bits (182), Expect = 3.299e-14
Identity = 76/284 (26.76%), Postives = 127/284 (44.72%), Query Frame = 1
Query:  193 IAQGGYGTVYKAHSFH--KQYALKKLCVNNE-DKLLNCIREIFILRNV-HCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPE--MADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCP------YSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPV 1008
            I +G +G VYK ++    + YA+K L ++++ D++ +  REI  L ++     I  +  S  Y  D+ ++   I+ +    +L S ++          E  + +IM  +  A+ C+H      +IHRD+K  NVLI       LCDFG A   +V    + RQ +        T  + +PE  M  +YYD        K DIW+LG+  Y I   + P+ D V ++ + Q  +    P      YS  L + +   L  +P+ R +   L    F    K+ P 
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGS--YLKDTSLW--IIMEHCAGGSLRSLLR-----PGKIDEKYIGVIMRELLVALKCIHKDN---VIHRDIKAANVLITNEGNVKLCDFGVAA--QVNQTSLRRQTMAG------TPYWMAPEVIMEGVYYD-------TKVDIWSLGITTYEIATGNPPYCD-VEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPT 284          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Match: EDO39786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S938])

HSP 1 Score: 233.802 bits (595), Expect = 4.931e-70
Identity = 140/361 (38.78%), Postives = 207/361 (57.34%), Query Frame = 1
Query:  109 NVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFHKQ-YALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPGGK 1185
            ++G ++CTV                ++ IA+GG+  V+   +   Q  ALK++ VNN   L  C +EI I++ V   +  + F+DS I QT  DIFEV IL  +  +    ++     ++  F+ES VL I T+  EAVA LH   S P+IHRDLKVEN+L      +VLCDFGSAT K+  P       +++EI ++TTL YR+PEM DLY      +I  K+DIWALG L+Y +CFF+LPFG+S L+I + QFT P++  YS  L  +++YIL P+P++RP+IYQ++   F +  +  PV N  KS  P      LP  + +  + + +R  +     +   PV TS+ PR RP+  G+
Sbjct:   23 SIGRFHCTV----------------EEIIAEGGFALVFLVKTPQGQRLALKRVSVNNSHDLDICKQEISIMKLVSGHKNTIRFIDSKILQTSPDIFEVLILMEYCKEGHVVQLMNERINTG-FSESLVLKIFTDACEAVALLHQ-ASPPVIHRDLKVENILCSDRRDFVLCDFGSATRKDTDPQADGVTHVEEEIQKYTTLPYRAPEMVDLY---SGKIISTKSDIWALGCLLYKLCFFTLPFGESPLAIQNAQFTFPENSRYSKGLHSLISYILDPDPDTRPDIYQVSFEAFRLRGQDCPVLNVNKSSVPQF----LPEPKQKPDVVDKSRTAR-----LRDGPVTTSLTPRQRPRAAGQ 353          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Match: EDO43926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX98])

HSP 1 Score: 141.739 bits (356), Expect = 6.344e-35
Identity = 100/286 (34.97%), Postives = 153/286 (53.50%), Query Frame = 1
Query:  181 IDDKIAQGGYGTVYKAHSFH--KQYALKKLCVNNEDKLLNCIREIFILRNV--HCEYILHFVDSIIYQTDSD--IFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCD----VNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSV-LSILSGQFTVP----DHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTS 993
            I   IA+GGYG V+ A      K+YALK+L   +E    N ++EI +L+ +  H   +  +  + + + +S   + E  ILT      +    +      Q F+   +L I   +  AV+ +H   S PIIHRDLK+EN+LIG   +  LCDFGSAT + + P D    +NR   +DEI + TT  YR+PEM DLY +     +  KADIWALG +++ +CF   PF DS  L I++ ++T+P    ++  Y D    ++N  L   PE RP I  + + L ++ +
Sbjct:   17 IKRVIAEGGYGFVFVAQDGKTGKEYALKRLMAGDEAANKNILQEINMLKRLRGHPNVVQFYSAASLGEKESGHGMTEYLILTELCTGIVDRVYQV--RDGQPFSPDQILRIFYQLCRAVSHMHK-QSPPIIHRDLKIENMLIGSKGQIKLCDFGSATTEPLTPDDSWTALNRSLAEDEIQRNTTPMYRAPEMVDLYSN---LPVTEKADIWALGCVLFYLCFMEHPFEDSAKLRIINAKYTIPEMDREYTMYHD----LINSTLVVHPEDRPCIRDILTQLEALAA 292          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Match: EDO33625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN4])

HSP 1 Score: 79.337 bits (194), Expect = 7.380e-16
Identity = 66/237 (27.85%), Postives = 116/237 (48.95%), Query Frame = 1
Query:  178 VIDDKIAQGGYGTVYKAHS--FHKQYALKKLCVNN--EDKLLNCI-REIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPE-MADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFT 870
             + D + +G Y  V  A+S    KQ A+K +      +D L   + REI ++++++   ++   ++I  +T S I+ +  L +      + ++     S+    E++  L    + +AV  LH+     ++HRDLK EN+L+    R ++ DFG A  + V   D  ++ L        + AY  PE +  + YDG        ADIW+LGV++Y +   SLPF D+ L +L  Q +
Sbjct:   62 ALGDTLGKGSYAVVKAAYSRKLKKQVAVKIVTKKKAPDDYLTKFLPREIQVMKHLNHSNVVSLHEAI--ETSSRIYIILDLAD------NGDLLEYIRSNGAIPENEARLFYHQLVDAVEYLHN---KGVVHRDLKCENILLNRDNRILISDFGFARTQHVM-ADTGKRRLSQTFC--GSYAYAPPEILRGIAYDGT------LADIWSLGVVLYTMVSASLPFDDTNLKVLLEQVS 278          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Match: EDO37951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE61])

HSP 1 Score: 76.2554 bits (186), Expect = 6.336e-15
Identity = 72/274 (26.28%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  181 IDDKIAQGGYGTVYKAHS--FHKQYALKKLCVNN--EDKLLNCI-REIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQF--TTLAYRSPE-MADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQ----FTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQL 966
            + D + +G Y  V KA+S  + +  A+K +C     ED L   + REI +L+ +   Y+   ++ I   T      ++I+T+   +    ++     +    TE     +   I+  V   H+  S  I+HRDLK EN+L+   +  ++ DFG A     R C +     + ++S     + AY +PE +  + YD         AD+W++GV++Y +    LPF DS L  L  Q     T       SD    +++ +LT     R  + QL
Sbjct:   54 LGDVLGKGSYAVVRKANSKRYKRDVAIKIICKKKAPEDFLTKFLPREIKVLKKIKNTYVTTLLEVIETNT-----RMYIITDLAENG---DLLEYIRTHGALTEKASRRLFRQITAGV---HYIHSQDIVHRDLKCENLLLDKDLNIIISDFGFA-----RDC-LTTATGKKKLSHTYCGSYAYAAPEILKGIAYD------ATLADVWSMGVILYTMLCGRLPFDDSNLRSLLQQVHKRVTFSSRVKLSDAAKAIIHKMLTWNLPERITVEQL 304          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 73.9442 bits (180), Expect = 2.112e-14
Identity = 63/227 (27.75%), Postives = 108/227 (47.58%), Query Frame = 1
Query:  193 IAQGGYGTVYKAHSFHK--QYALKKLCVNNED------KLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYP-----MRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMA-DLYYDGGEHVIGRKADIWALGVLMYNICFFSLPF 831
            + +G +G V +A       ++A+K   VN E       KLL   RE+ I++ ++ E+++H  +  IY+T   ++ V  L +      +  +  M    + FTE +   ++  +  AVA LH      I+HRDLK+EN+L+ +P     +   + DFG + +K     D   Q      S   T  Y +PE+  DL Y        ++ D+W++GV+MY +     PF
Sbjct:   33 LGRGSFGVVNEAKHIETGTRWAIK--AVNKEKAGSSAVKLLE--REVMIMKKIYHEHLIHLEE--IYETSKRMYLVMELCD------AGGLDKMLERKKRFTEKETWTVIKQLVSAVAYLHDL---DIVHRDLKLENILLSHPTGNELLNVKITDFGLSIVKGGVGSDSMMQ------SVCGTPMYMAPEVIDDLGYS-------QQCDVWSIGVIMYTLFTGRPPF 231          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Match: bmp2k (BMP2 inducible kinase [Source:NCBI gene;Acc:101161412])

HSP 1 Score: 229.95 bits (585), Expect = 1.632e-65
Identity = 137/336 (40.77%), Postives = 198/336 (58.93%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHK-QYALKKLCVNNEDKLLNCIREIFILRNVHC-EYILHFVDSIIYQTDSDIFEVFILTNF-YPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            V +++ +A+GG+  V+ A +    + ALK++ VNN   L  C REI I++ +   + I+ ++DS I     +++EV IL  F     +  +M    +    F+E++VL I  +  EAVA LH    TPIIHRDLKVEN+L+     YVLCDFGSAT K + P       ++DEI ++TTL+YR+PEM +LY   G   I  KADIWALG L+Y +CFF+LPFG+S ++I  G F VPD+  +S  L  ++ Y+L P+ E RP+IYQ++   F +  + NPV N   S  P   +L  P+  SE        + + + S +PT   ETSI PR RPK
Sbjct:   38 VTVEELVAEGGFSVVFMARTHSGVRCALKRMYVNNVQDLNVCKREITIMKELSGHKNIVTYLDSTISSFSDNVWEVLILMEFCKAGQVVKQMNQRLNVG--FSEAEVLHIFCDTCEAVARLHQ-CKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGVTAVEDEIKKYTTLSYRAPEMINLYAGTG---ITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFIVPDNSKFSCRLHCLIRYMLEPDLEKRPDIYQVSHFAFKLAGRENPVPNLCSSAIP--TSLPEPLTASEVAAKKNLTKARITDSVVPT---ETSIAPRQRPK 362          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 232.261 bits (591), Expect = 7.560e-65
Identity = 145/344 (42.15%), Postives = 209/344 (60.76%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ IA+GG+  V+  + H  H+  ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+E++VL I  +  EAVA LHH   TPIIHRDLKVEN+L+     YVLCDFGSAT +   P +     +++EI ++TTL+YR+PEM +LY  GGE  I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ Y+L P P+ RP+IYQ++   F +  +  PV N   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   46 VTVEEIIAEGGFAIVFLVRTHQGHR-CALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSEAEVLQIFCDTCEAVARLHH-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLY--GGE-AITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIP--AKLPEPIRASE-AVAKKSQTKARLTDPVPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 232.261 bits (591), Expect = 7.560e-65
Identity = 145/344 (42.15%), Postives = 209/344 (60.76%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ IA+GG+  V+  + H  H+  ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+E++VL I  +  EAVA LHH   TPIIHRDLKVEN+L+     YVLCDFGSAT +   P +     +++EI ++TTL+YR+PEM +LY  GGE  I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ Y+L P P+ RP+IYQ++   F +  +  PV N   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   46 VTVEEIIAEGGFAIVFLVRTHQGHR-CALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSEAEVLQIFCDTCEAVARLHH-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLY--GGE-AITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIP--AKLPEPIRASE-AVAKKSQTKARLTDPVPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 233.417 bits (594), Expect = 1.399e-64
Identity = 145/344 (42.15%), Postives = 209/344 (60.76%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ IA+GG+  V+  + H  H+  ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+E++VL I  +  EAVA LHH   TPIIHRDLKVEN+L+     YVLCDFGSAT +   P +     +++EI ++TTL+YR+PEM +LY  GGE  I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ Y+L P P+ RP+IYQ++   F +  +  PV N   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   46 VTVEEIIAEGGFAIVFLVRTHQGHR-CALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSEAEVLQIFCDTCEAVARLHH-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLY--GGE-AITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIP--AKLPEPIRASE-AVAKKSQTKARLTDPVPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 233.417 bits (594), Expect = 1.751e-64
Identity = 145/344 (42.15%), Postives = 209/344 (60.76%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVY--KAHSFHKQYALKKLCVNNEDKLLNCIREIFILRN-VHCEYILHFVDSIIYQTDS-DIFEVFILTNFYPDN-----LSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPG 1179
            V +++ IA+GG+  V+  + H  H+  ALK++ VNNE  L  C  EI I+R+ V  + I+ F+DS I    S D++EV IL +F         ++  ++T       F+E++VL I  +  EAVA LHH   TPIIHRDLKVEN+L+     YVLCDFGSAT +   P +     +++EI ++TTL+YR+PEM +LY  GGE  I  KADIWALG L+Y +CFF+LPFG+S ++I  G FT+PD+  YS ++  ++ Y+L P P+ RP+IYQ++   F +  +  PV N   S  P    L  P++ SE  ++  ++ K      +PT   ETSI PR RPK G
Sbjct:   46 VTVEEIIAEGGFAIVFLVRTHQGHR-CALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMNQRLQT------GFSEAEVLQIFCDTCEAVARLHH-CKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLY--GGE-AITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPDNSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIP--AKLPEPIRASE-AVAKKSQTKARLTDPVPT--TETSIAPRQRPKAG 373          
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Match: SMESG000051989.1 (SMESG000051989.1)

HSP 1 Score: 1150.96 bits (2976), Expect = 0.000e+0
Identity = 605/607 (99.67%), Postives = 606/607 (99.84%), Query Frame = 1
Query:   61 MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPGGKLQNYNNCHNTVQKPXXXXXXXXXXXXXXPDLLDFESQLEIESNNFETANQFSKTKSVDKLEFENANQTNLMDFSSPIDDKIKQLINTPKSHSLSKNFGTHGSKEHYNVYEMISHSYQNVSSXXXXXXXXXXXXXXXXXXXXPFMNNCSIXXXXXXXXXXHCNVLNFGTPQNFNTVGPTVHRRNVSDPSQWFQSPNVPNQVSNTASSNILQPQKLPMKMKPTNVLDEFDPLTK 1881
            MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSI LKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNAL+LPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPGGKLQNYNNCHNTVQKPNISEEKSNNINSQNPDLLDFESQLEIESNNFETANQFSKTKSVDKLEFENANQTNLMDFSSPIDDKIKQLINTPKSHSLSKNFGTHGSKEHYNVYEMISHSYQNVSSAQQFRYNNYNYNNNQFNAARPFMNNCSIPNNNPFFMNNHCNVLNFGTPQNFNTVGPTVHRRNVSDPSQWFQSPNVPNQVSNTASSNILQPQKLPMKMKPTNVLDEFDPLTK
Sbjct:    1 MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSIALKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALNLPMKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPKPGGKLQNYNNCHNTVQKPNISEEKSNNINSQNPDLLDFESQLEIESNNFETANQFSKTKSVDKLEFENANQTNLMDFSSPIDDKIKQLINTPKSHSLSKNFGTHGSKEHYNVYEMISHSYQNVSSAQQFRYNNYNYNNNQFNAARPFMNNCSIPNNNPFFMNNHCNVLNFGTPQNFNTVGPTVHRRNVSDPSQWFQSPNVPNQVSNTASSNILQPQKLPMKMKPTNVLDEFDPLTK 607          
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Match: SMESG000071701.1 (SMESG000071701.1)

HSP 1 Score: 270.781 bits (691), Expect = 7.812e-81
Identity = 150/353 (42.49%), Postives = 219/353 (62.04%), Query Frame = 1
Query:  175 VVIDDKIAQGGYGTVYKAHSFHKQ-YALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPD-HCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALSLP------------------MKESEFKMSNTNRQKKNSKSSMPTQPVETSIIPRNRPK 1173
            VV+++ IA+GG+G V+K  S     +ALK+LCVNN   L  C REI I+ ++  + IL  +DS I +  +DIFEV +L  + P N++  MK+    +Q  +E+ ++ I+ +I EAVA LH +  TP+IHRDLKVEN+LI     YVLCDFGSAT +++ P +      ++EIS++TTLAYRSPEM  L    G  +I  K+DIWALG L+Y +C+F+LPF D VL+I SG+FT+P     YSD +LK++ Y+LT  P  RP+IYQ++ + FSM +  NP+QN +K + P  + L LP                    E+   + ++N  K  S S+  ++ + TSI PR RP+
Sbjct:   65 VVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLH-YCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL----GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLSSNANKVKSVSNQ-SKSISTSINPRIRPR 411          
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Match: SMESG000036159.1 (SMESG000036159.1)

HSP 1 Score: 168.318 bits (425), Expect = 8.857e-49
Identity = 86/120 (71.67%), Postives = 92/120 (76.67%), Query Frame = 1
Query:   61 MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYP 420
            MNRTIY VIE EDI RN+                  ESVV+DDKIAQGG GTV+KAHSFH+QYAL KLCVNNEDKLLNCIR+IFI RNV CEYILH VDSII QTDSDIFE FI+TNFYP
Sbjct:    1 MNRTIYGVIEKEDICRNID-----------------ESVVMDDKIAQGGCGTVFKAHSFHEQYALTKLCVNNEDKLLNCIRKIFIHRNVRCEYILHLVDSIIDQTDSDIFEAFIMTNFYP 103          
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Match: SMESG000062682.1 (SMESG000062682.1)

HSP 1 Score: 167.162 bits (422), Expect = 1.968e-48
Identity = 84/120 (70.00%), Postives = 92/120 (76.67%), Query Frame = 1
Query:   61 MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYP 420
            MNR  Y VIENEDI RN+                  ESVV+D+KI QGG GTV+KAHSFH+QYAL KLCVNNEDKLLNCIR+IFILRNVHCEYILH VDSII QTDSD+FE FI+TNFYP
Sbjct:    1 MNRKTYGVIENEDICRNID-----------------ESVVMDNKITQGGCGTVFKAHSFHEQYALTKLCVNNEDKLLNCIRKIFILRNVHCEYILHLVDSIIDQTDSDVFESFIMTNFYP 103          
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Match: SMESG000004784.1 (SMESG000004784.1)

HSP 1 Score: 166.007 bits (419), Expect = 7.976e-48
Identity = 85/120 (70.83%), Postives = 92/120 (76.67%), Query Frame = 1
Query:   61 MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGYGTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYP 420
            MNRTIY VIENEDI RN+                  ESVV+DDKIAQGG GTV+KAHSFH+QYAL KL VNNE+KLLNCIR+IFI RNV CEYILH VDSII QTDSDIFE FI+TNFYP
Sbjct:    1 MNRTIYGVIENEDICRNID-----------------ESVVMDDKIAQGGCGTVFKAHSFHQQYALTKLFVNNEEKLLNCIRKIFICRNVRCEYILHLVDSIIDQTDSDIFEAFIMTNFYP 103          
The following BLAST results are available for this feature:
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AAK19.256e-6840.99AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
AAK11.417e-6641.09AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
AAK16.984e-6641.09AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
BMP2K3.385e-6439.88BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC... [more]
BMP2K5.553e-6239.88BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-58.017e-4937.08Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
sel-58.866e-4837.08Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
sel-58.866e-4837.08Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
gakh-18.844e-2430.66GAK Homolog [Source:UniProtKB/TrEMBL;Acc:Q20483][more]
unc-821.413e-1226.03pep chromosome:WBcel235:IV:7425729:7444660:1 gene:... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nak4.078e-7441.71gene:FBgn0015772 transcript:FBtr0081189[more]
Nak5.309e-7441.71gene:FBgn0015772 transcript:FBtr0340326[more]
Nak2.998e-7141.71gene:FBgn0015772 transcript:FBtr0081187[more]
Nak2.998e-7141.71gene:FBgn0015772 transcript:FBtr0340325[more]
CG12277.798e-3026.33gene:FBgn0037491 transcript:FBtr0339736[more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak1b9.235e-6939.89AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
aak1a4.317e-6739.94AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
aak1a3.668e-6540.52AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
bmp2k9.176e-6140.18BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
bmp2k1.246e-6040.18BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak12.358e-7040.79AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak17.001e-7040.79AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak12.772e-6840.79AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak11.824e-6740.79AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak14.878e-6740.39AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aak18.516e-6740.80AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI... [more]
Aak11.857e-6641.38AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI... [more]
Bmp2k1.760e-6440.06BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2... [more]
Bmp2k4.676e-6240.06BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2... [more]
Gak5.548e-2832.03cyclin G associated kinase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1SPM8|AAK1_PIG8.862e-6641.67AP2-associated protein kinase 1 OS=Sus scrofa OX=9... [more]
sp|Q3UHJ0|AAK1_MOUSE1.299e-6541.38AP2-associated protein kinase 1 OS=Mus musculus OX... [more]
sp|F1MH24|AAK1_BOVIN1.547e-6540.96AP2-associated protein kinase 1 OS=Bos taurus OX=9... [more]
sp|Q2M2I8|AAK1_HUMAN3.354e-6541.09AP2-associated protein kinase 1 OS=Homo sapiens OX... [more]
sp|P0C1X8|AAK1_RAT1.249e-6441.09AP2-associated protein kinase 1 OS=Rattus norvegic... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P1N62.189e-7841.34BMP-2-inducible protein kinase (Fragment) OS=Schis... [more]
A0A139WLH01.315e-7739.56AP2-associated protein kinase 1-like Protein OS=Tr... [more]
A0A023G4X84.999e-7743.19Putative ark protein kinase family (Fragment) OS=A... [more]
A0A4S2L7X91.034e-7542.20Protein kinase domain-containing protein OS=Opisth... [more]
A0A3R7H2D91.896e-7542.49AP2-associated protein kinase 1 OS=Clonorchis sine... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak1b3.222e-7240.23AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSAMXT00000003200.28.562e-6740.67AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
ENSAMXT00000054610.11.516e-6640.67AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
ENSAMXT00000051497.11.948e-6640.67AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
ENSAMXT00000042526.12.113e-6640.67AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006448.12.717e-6942.69pep scaffold:Pmarinus_7.0:GL476771:264361:311032:-... [more]
ENSPMAT00000007073.11.015e-6743.12pep scaffold:Pmarinus_7.0:GL477321:233302:247915:1... [more]
stk163.988e-1825.68serine/threonine kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
phkg1b3.512e-1529.31phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
NIM1K1.189e-1331.89NIM1 serine/threonine protein kinase [Source:HGNC ... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARK15.516e-3732.62Serine/threonine protein kinase; involved in regul... [more]
PRK13.553e-3333.44Protein serine/threonine kinase; regulates the org... [more]
AKL18.874e-2632.52Ser-Thr protein kinase; member (with Ark1p and Prk... [more]
PSK22.078e-1432.24PAS-domain containing serine/threonine protein kin... [more]
KIC13.299e-1426.76Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397864.931e-7038.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439266.344e-3534.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336257.380e-1627.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379516.336e-1526.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407032.112e-1427.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp2k1.632e-6540.77BMP2 inducible kinase [Source:NCBI gene;Acc:101161... [more]
aak1a7.560e-6542.15AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a7.560e-6542.15AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a1.399e-6442.15AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a1.751e-6442.15AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
back to top
BLAST of AP2-associated protein kinase 1-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051989.10.000e+099.67SMESG000051989.1[more]
SMESG000071701.17.812e-8142.49SMESG000071701.1[more]
SMESG000036159.18.857e-4971.67SMESG000036159.1[more]
SMESG000062682.11.968e-4870.00SMESG000062682.1[more]
SMESG000004784.17.976e-4870.83SMESG000004784.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011581 ID=SMED30011581|Name=AP2-associated protein kinase 1-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2311bp
TGAAATTATTTTACAATTAAGTTTAATTCGATAAAAATTGACTTTATTTC
TCTCAATATAATGAATAGAACAATCTATAGAGTGATTGAAAATGAAGATA
TTTACAGAAATGTAGGTTATTACAATTGTACTGTTAGTAAGCAAAGTAAA
TCAATCACATTAAAATATGAATCAGTTGTTATTGATGATAAAATTGCCCA
AGGTGGTTACGGAACCGTCTACAAAGCACATTCGTTTCATAAGCAATATG
CATTAAAAAAGCTGTGTGTCAACAATGAAGACAAACTATTGAATTGCATC
CGGGAAATATTTATACTTAGAAATGTTCACTGTGAATATATCCTACATTT
TGTAGATTCAATTATTTATCAAACTGACTCGGATATTTTTGAAGTTTTCA
TCCTGACTAACTTTTATCCAGACAATTTGTCATCGGAAATGAAAACTATG
TGCTCATCCAGTCAGTGTTTCACTGAATCCGACGTACTGTTGATAATGAC
CAATATTTCCGAAGCTGTTGCTTGTCTTCATCATTTTACTTCAACTCCTA
TCATTCACAGAGATTTAAAAGTAGAAAATGTATTAATTGGTTATCCAATG
AGATATGTTCTCTGTGATTTCGGCAGCGCAACCCTCAAGGAAGTCCGTCC
GTGCGATGTAAATAGACAAGATTTACAAGATGAAATATCTCAATTTACCA
CATTAGCCTATAGATCTCCAGAAATGGCTGACTTATATTATGATGGAGGC
GAGCATGTAATAGGTAGAAAAGCAGACATTTGGGCTCTGGGAGTACTAAT
GTATAATATTTGCTTTTTCTCATTGCCTTTCGGGGACAGTGTTTTGTCTA
TTTTATCCGGACAGTTCACAGTTCCCGATCATTGTCCATATTCAGATGAT
CTTTTAAAAGTGTTAAATTATATTTTGACACCGGAACCAGAATCACGACC
AAACATTTATCAATTAGCGTCAGTATTATTTTCAATGACATCCAAATCTA
ACCCAGTGCAAAACTGTGAGAAATCCCGTGAACCAGATTTGAATGCATTA
AGTTTACCAATGAAAGAATCCGAATTCAAAATGTCGAATACAAATAGACA
GAAAAAAAATTCTAAGAGTTCCATGCCAACCCAGCCAGTTGAAACGTCAA
TTATTCCAAGAAATAGGCCAAAGCCTGGCGGGAAACTTCAAAATTATAAC
AATTGTCATAATACAGTGCAAAAGCCAAATATTAGTGAGGAGAAAAGCAA
TAACATAAATTCGCAGAATCCTGATTTATTGGACTTCGAGTCTCAGTTAG
AAATCGAAAGCAATAATTTTGAAACTGCAAATCAGTTCAGTAAAACAAAA
TCCGTTGATAAATTAGAATTCGAAAATGCAAATCAAACTAATTTAATGGA
TTTCTCATCGCCGATTGACGATAAAATAAAACAGTTAATAAATACTCCTA
AATCTCACTCGCTTAGTAAGAATTTCGGTACTCATGGTTCAAAAGAACAT
TACAACGTCTATGAAATGATCTCTCATTCATATCAAAATGTTTCCTCCGC
CCAGCAATTCAGATATAATAATTATAATTATAATAATAATCAGTTCAATG
CAGCAAGGCCGTTCATGAATAATTGCAGTATTCCCAATAACAATCCATTC
TTTATGAACAACCATTGTAATGTTCTGAATTTTGGTACTCCGCAAAATTT
TAATACAGTTGGACCTACCGTTCATAGGAGAAATGTGAGTGACCCTTCTC
AATGGTTTCAGTCTCCAAATGTCCCTAATCAAGTTTCCAATACGGCTTCT
TCAAATATTCTACAGCCGCAAAAACTACCAATGAAAATGAAGCCTACAAA
TGTGCTTGATGAGTTTGATCCTTTGACAAAATGAATCCAATGGTCTGATA
GCTGCTGCTCAATGGTTAAAAGTTGACGTATCAAAAATGAAAATGCAGTT
TTGTTTGTATGTAATCTCAGAATGAAGCGAAGTCCATTTCAATCATTTCT
TCAGTTGATTTGTACATAGTATGAGCTTTGTATGACCAAATGTATTATTA
GCTGTACATAATAATAAATGTTTGGAGCACAGCAATGATCCATTATGACA
ATTTTGTGATAAATTATTCAGCTTTTATTTGAATAACTTTGACGTTATCT
TTAAATGAGCTTTTTTTTATTTTCACTCTTTTGTCAACTTGTGGTGGCCA
TGTATTGTAGAATTGCACTGATTTAGATTGCATTATTTATGTTTTATTAA
TTTTCCAGCTATTTGTTTTTGTAATAGGGGTTCTGGATGTGACTTTGTTT
CCGGAGATCGG
back to top

protein sequence of SMED30011581-orf-1

>SMED30011581-orf-1 ID=SMED30011581-orf-1|Name=SMED30011581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=608bp
MNRTIYRVIENEDIYRNVGYYNCTVSKQSKSITLKYESVVIDDKIAQGGY
GTVYKAHSFHKQYALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDS
IIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNIS
EAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDV
NRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNI
CFFSLPFGDSVLSILSGQFTVPDHCPYSDDLLKVLNYILTPEPESRPNIY
QLASVLFSMTSKSNPVQNCEKSREPDLNALSLPMKESEFKMSNTNRQKKN
SKSSMPTQPVETSIIPRNRPKPGGKLQNYNNCHNTVQKPNISEEKSNNIN
SQNPDLLDFESQLEIESNNFETANQFSKTKSVDKLEFENANQTNLMDFSS
PIDDKIKQLINTPKSHSLSKNFGTHGSKEHYNVYEMISHSYQNVSSAQQF
RYNNYNYNNNQFNAARPFMNNCSIPNNNPFFMNNHCNVLNFGTPQNFNTV
GPTVHRRNVSDPSQWFQSPNVPNQVSNTASSNILQPQKLPMKMKPTNVLD
EFDPLTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 39..307
e-value: 3.3E-34
score: 129.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 42..303
e-value: 3.5E-33
score: 115.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 39..308
score: 29.743
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 23..327
e-value: 4.0E-70
score: 238.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..375
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 337..364
NoneNo IPR availablePANTHERPTHR22967SERINE/THREONINE PROTEIN KINASEcoord: 27..587
NoneNo IPR availablePANTHERPTHR22967:SF57NUMB-ASSOCIATED KINASE, ISOFORM Acoord: 27..587
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 164..176
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 26..307