Lactamase_B domain-containing protein

Overview
NameLactamase_B domain-containing protein
Smed IDSMED30011577
Length (bp)754
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lactamase_B domain-containing protein (SMED30011577) t-SNE clustered cells

Violin plots show distribution of expression levels for Lactamase_B domain-containing protein (SMED30011577) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lactamase_B domain-containing protein (SMED30011577) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lactamase_B domain-containing protein (SMED30011577) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011577

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30011577h1SMcG0005471 Contig42162uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011577h1SMcG0005471 Contig42162newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior sideSMED30011577h1SMcG0005471 dd_Smed_v4_1825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30011577h1SMcG0005471 dd_Smed_v4_1825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lactamase_B domain-containing protein vs. Ensembl Human
Match: MBLAC1 (metallo-beta-lactamase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:22180])

HSP 1 Score: 124.405 bits (311), Expect = 7.272e-34
Identity = 87/229 (37.99%), Postives = 120/229 (52.40%), Query Frame = 1
Query:   85 DPYSVVVLRDGVSE---VCDGKMTAFCSIVLV----KGPKN-----------------------ILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDIN-NKGKYVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            DPYSVVVL  G +E   V D  + A  S+ LV    +GP +                       ILVD G  W ++ +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D     G+Y+ H      P  +   + V ATPGH  + D+S++V     LG VV+AGD+F  ERD  D + W+  S D   Q +SR++++ +ADV++PGHGP F V +
Sbjct:   17 DPYSVVVLLQGYAEPEGVGD-AVRADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAP-GDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGT-ALGTVVVAGDVF--ERD-GDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPPFRVLR 239          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Match: swip-10 (SWimming Induced Paralysis [Source:UniProtKB/TrEMBL;Acc:Q20700])

HSP 1 Score: 123.25 bits (308), Expect = 1.279e-32
Identity = 79/204 (38.73%), Postives = 115/204 (56.37%), Query Frame = 1
Query:   97 VVVLRDGVSE-VCDGKMTAFCSIVLVK-GPKNILVDPGSAWD---KDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHR--FDLNIPYEID-----EQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVT 672
            V VLR+G +E   DG+ T   SI LVK G K+ILVD G   +   +  ++  LE H LS   D+D V+ TH H DH+G ++ FP+A+H  G+       Y H R  F+L   +E D     E + ++   GH+ +DI ++V+ V   G+V+++GD+F  E DI    +W+  S D   Q  SRR+   + D I+PGHG MF VT
Sbjct:  217 VHVLRNGSAEQTIDGQYTFIASITLVKDGDKSILVDTGLGTNINARTELIKSLEMHGLSP-ADVDIVVSTHGHPDHVGGVHDFPDALHYHGW-------YSHQRTKFNLTALFENDTMNLSENVMLVKCRGHTSDDIGVVVRGVKRRGDVLVSGDLFMREEDIDHPMMWQPLSADVIAQRDSRRRYGCIVDWIVPGHGSMFQVT 412          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Match: C03F11.2 (pep chromosome:WBcel235:X:5394508:5397400:-1 gene:WBGene00015388.1 transcript:C03F11.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C03F11.2)

HSP 1 Score: 97.8265 bits (242), Expect = 1.355e-23
Identity = 60/185 (32.43%), Postives = 99/185 (53.51%), Query Frame = 1
Query:  142 MTAFCSIVLVKGPKNILVDPGSAWD---KDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISD-SNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHK 684
            +TA  S+V   G   I+VD  SA D   K+L+L  +    +    +I YV+ TH H DH G  N FPNA H  G    +   ++          ++ + + +  TPGH+  D++++V NV   G + +AGD+F +E D ++ + +W +++ +      SR K+I  AD +IPGHG +F +T+  K
Sbjct:    3 LTASVSMVY-DGGHYIVVDSPSATDVHSKELMLKGIASRNIVP-GEIQYVVTTHGHPDHFGQGNFFPNARHFFGSYEYSDTNFISTELHTKDIMQLTKNVQLWNTPGHTAQDVTVMVHNVSCCGIIAVAGDLFYNEEDANEAAGIWFQEAWNPIIGKISRNKVICYADYVIPGHGKLFRITQEMK 185          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Match: C23H3.9 (pep chromosome:WBcel235:II:71672:77814:-1 gene:WBGene00016022.1 transcript:C23H3.9d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C23H3.9)

HSP 1 Score: 87.8113 bits (216), Expect = 9.588e-20
Identity = 66/212 (31.13%), Postives = 113/212 (53.30%), Query Frame = 1
Query:   70 AVMKPDPY-SVVVLRDG-VSEVCDGKMTAFCSIVLVKGPKNI-LVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPY-EIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSN--LWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKE 687
            +  +P  Y +V VL+ G V  + DG++ A  +I LV     I L+D G++ D + +L+ L K  ++ +  ID V+ TH    H+GN+N F     ++   +   G++V        PY ++   + V  TPGH+++D+S+LV NV   G + I GD+  SE  +S+    + +E   D   + ++   I+ MAD I+PGHG  F V   +++
Sbjct:  205 STAEPKSYVNVTVLQAGSVRPLRDGQVEAVGAITLVNDNGYIVLIDTGASSDTERLLHSLAKESVT-LDQIDSVVITHASPGHMGNMNFFAQK-PILYHSMEYIGRHVTPTELKERPYRKLSGNVEVWKTPGHTQHDLSVLVHNVAGYGTMAIVGDLIPSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCMADWIVPGHGQPFRVLPNYRQ 414          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Match: C23H3.9 (pep chromosome:WBcel235:II:71672:79266:-1 gene:WBGene00016022.1 transcript:C23H3.9d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C23H3.9)

HSP 1 Score: 87.8113 bits (216), Expect = 9.588e-20
Identity = 66/212 (31.13%), Postives = 113/212 (53.30%), Query Frame = 1
Query:   70 AVMKPDPY-SVVVLRDG-VSEVCDGKMTAFCSIVLVKGPKNI-LVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPY-EIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSN--LWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKE 687
            +  +P  Y +V VL+ G V  + DG++ A  +I LV     I L+D G++ D + +L+ L K  ++ +  ID V+ TH    H+GN+N F     ++   +   G++V        PY ++   + V  TPGH+++D+S+LV NV   G + I GD+  SE  +S+    + +E   D   + ++   I+ MAD I+PGHG  F V   +++
Sbjct:  205 STAEPKSYVNVTVLQAGSVRPLRDGQVEAVGAITLVNDNGYIVLIDTGASSDTERLLHSLAKESVT-LDQIDSVVITHASPGHMGNMNFFAQK-PILYHSMEYIGRHVTPTELKERPYRKLSGNVEVWKTPGHTQHDLSVLVHNVAGYGTMAIVGDLIPSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCMADWIVPGHGQPFRVLPNYRQ 414          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Match: C23H3.9 (pep chromosome:WBcel235:II:71672:77814:-1 gene:WBGene00016022.1 transcript:C23H3.9b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C23H3.9)

HSP 1 Score: 87.4261 bits (215), Expect = 1.656e-19
Identity = 66/212 (31.13%), Postives = 113/212 (53.30%), Query Frame = 1
Query:   70 AVMKPDPY-SVVVLRDG-VSEVCDGKMTAFCSIVLVKGPKNI-LVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPY-EIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSN--LWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKE 687
            +  +P  Y +V VL+ G V  + DG++ A  +I LV     I L+D G++ D + +L+ L K  ++ +  ID V+ TH    H+GN+N F     ++   +   G++V        PY ++   + V  TPGH+++D+S+LV NV   G + I GD+  SE  +S+    + +E   D   + ++   I+ MAD I+PGHG  F V   +++
Sbjct:  262 STAEPKSYVNVTVLQAGSVRPLRDGQVEAVGAITLVNDNGYIVLIDTGASSDTERLLHSLAKESVT-LDQIDSVVITHASPGHMGNMNFFAQK-PILYHSMEYIGRHVTPTELKERPYRKLSGNVEVWKTPGHTQHDLSVLVHNVAGYGTMAIVGDLIPSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCMADWIVPGHGQPFRVLPNYRQ 471          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Fly
Match: CG9117 (gene:FBgn0031766 transcript:FBtr0079222)

HSP 1 Score: 122.479 bits (306), Expect = 9.077e-34
Identity = 76/204 (37.25%), Postives = 114/204 (55.88%), Query Frame = 1
Query:   97 VVVLRDGVSEVCDGKMTAF-----CSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNA-IHLVGFDINNKGKYVHHRF----DLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQ-SNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            V VL+ G S   +G  +A      C++V  +   NI+VD  +AWD D + + L +  L  + DI  V+ +H HSDHIG   LF  A +HLVG   ++   Y+ H      D  +  + + ++ V  +PGH+ + +S+LV+N    G V I GD+FE   DI D N+W +  S +E  Q + R K+  + + IIPGHGPMFSVT+
Sbjct:   12 VTVLQVGYSRQEEGDESAMRANCTCTLVRCRDGTNIIVDTLTAWDGDHLRSLLGQQGLG-VDDIHVVVCSHGHSDHIGCNYLFQKARMHLVGACASHHDLYMDHLGSGNPDEQLALDSNAEVVVRRSPGHTLSCVSVLVENSQLGGRVGITGDLFERREDIDDENIWMDAGSENEKVQREERSKMAQLCEFIIPGHGPMFSVTQ 214          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Zebrafish
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111102-2])

HSP 1 Score: 165.236 bits (417), Expect = 3.840e-50
Identity = 89/197 (45.18%), Postives = 124/197 (62.94%), Query Frame = 1
Query:   88 PYSVVVLRDGVSEVCD-GKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            PYSV VL++G     D G   A  +I L+ GP  ILVD G  WD+D ++  L++  L+    +D V+GTH HSDH+GNL LFP A  +VG DI+ + KY+ ++     PY ID+ +S+I TPGH   D+S+LVK   E G+V++AGD+FE      D + WKE S +   Q  +R+  + MADVIIPGHGP+F V +
Sbjct:   42 PYSVSVLKEGYCTAEDDGAFRADGTITLITGPNIILVDTGGPWDRDFLVAKLKEKGLTP-DSVDIVVGTHGHSDHVGNLGLFPEAKIIVGSDISVRDKYLPNQLAEGQPYTIDDFVSIIFTPGHMGRDVSVLVKGTSE-GSVLVAGDLFER---CHDEDSWKELSENPQIQEANRQMALQMADVIIPGHGPLFRVQR 233          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Zebrafish
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111102-2])

HSP 1 Score: 80.4925 bits (197), Expect = 5.705e-19
Identity = 40/89 (44.94%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  409 PYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            P++   ++S+I TPGH   D+S+LVK   E G+V++AGD+FE      D + WKE S +   Q  +R+  + MADVIIPGHGP+F V +
Sbjct:   21 PFQ-QRKVSIIFTPGHMGRDVSVLVKGTSE-GSVLVAGDLFER---CHDEDSWKELSENPQIQEANRQMALQMADVIIPGHGPLFRVQR 104          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Xenopus
Match: tgm1 (transglutaminase 1 [Source:Xenbase;Acc:XB-GENE-1013422])

HSP 1 Score: 158.303 bits (399), Expect = 2.140e-47
Identity = 88/199 (44.22%), Postives = 117/199 (58.79%), Query Frame = 1
Query:   88 PYSVVVLRDGVSEVCDGKM-TAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEI--DEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            P+SV VL +G      G +  A  S+ L++GP  +LVD    W +D +L  L  H ++  TD+ +VI TH HSDH+GNLNLFP A  +V +D+   G YV H F    PY +   E + V+ATPGH+ +D S+LV     LG VV+AGD+FE E    D + W   S D   Q  SR  ++ +ADVIIPGHGP F V K
Sbjct:   28 PHSVHVLMEGYCRDAGGDLFQADGSVTLIRGPLTVLVDTAGPWSRDALLQSLRDHGVAP-TDVTHVICTHGHSDHVGNLNLFPRAEIVVSYDLWRGGYYVAHDFRGGAPYMLPGGEGLKVVATPGHTGSDTSLLVPGT-SLGTVVVAGDLFERE---GDEDSWCPLSEDPQRQEASRAAMLKLADVIIPGHGPPFRVIK 221          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Mouse
Match: Mblac1 (metallo-beta-lactamase domain containing 1 [Source:MGI Symbol;Acc:MGI:2679717])

HSP 1 Score: 126.716 bits (317), Expect = 5.756e-35
Identity = 70/171 (40.94%), Postives = 99/171 (57.89%), Query Frame = 1
Query:  169 VKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDIN-NKGKYVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            V+GP  ILVD G  W +  +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D    +G Y+ H      P  +   + V ATPGH  + D+S++V+    LG VV+AGD+FE    + D + W+  S D   Q +SR +I+++ADV++PGHG  F V +
Sbjct:   80 VRGP--ILVDTGGPWARGALLEALATQGVAP-EDVTLVVGTHGHSDHIGNLGLFPEAALLVSHDFCLPEGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVSVVVEGT-SLGTVVVAGDVFER---LGDEDSWQALSEDPVAQQRSRERILSVADVVVPGHGAPFRVVR 243          
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Match: sp|Q498J9|MBLC1_XENLA (Metallo-beta-lactamase domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=mblac1 PE=2 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 7.572e-47
Identity = 89/199 (44.72%), Postives = 122/199 (61.31%), Query Frame = 1
Query:   88 PYSVVVLRDGVSEVCDGKM-TAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEI--DEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            P+SV VL +G S+   G +  A  S+ L++GP  +LVD    W +D +L  L+   ++   D+ +VI TH HSDH+GNLNLF +A  LV +D+   G YV H F   +PY +   E + V+ATPGH+ +DIS+LV     LG VV+AGD+FE E    D + W+  S D + Q  SR  I+ +ADVIIPGHGP F V K
Sbjct:   28 PHSVHVLLEGYSKDVGGDLFQADGSVTLIQGPLTVLVDTAGPWSRDSLLQSLQNQGVAP-ADVTHVICTHGHSDHVGNLNLFSHAEILVSYDLWRNGYYVAHDFRAGVPYVLPGGEGLEVVATPGHTGSDISLLVPGT-SLGTVVVAGDLFERE---GDGDSWQPLSEDPERQEDSRAAILKVADVIIPGHGPPFRVIK 221          
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AYD1|MBLC1_RAT (Metallo-beta-lactamase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Mblac1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.615e-34
Identity = 70/171 (40.94%), Postives = 99/171 (57.89%), Query Frame = 1
Query:  169 VKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGK-YVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            V+GP  ILVD G  W +D +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D    G  Y+ H      P  +   + V ATPGH  + D+S++V+    LG VV+ GD+FE    + D + W++ S D   Q +SR +I+++ADV++PGHG  F V +
Sbjct:   80 VRGP--ILVDTGGPWTRDALLEALATQGVAP-GDVTLVVGTHGHSDHIGNLGLFPQAALLVSHDFCLPGGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVSVVVEGT-SLGTVVVVGDVFER---LGDEDSWQDLSEDPVAQQRSRERILSVADVVVPGHGAPFRVVR 243          
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BWY4|MBLC1_MOUSE (Metallo-beta-lactamase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mblac1 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.026e-34
Identity = 70/171 (40.94%), Postives = 99/171 (57.89%), Query Frame = 1
Query:  169 VKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDIN-NKGKYVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            V+GP  ILVD G  W +  +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D    +G Y+ H      P  +   + V ATPGH  + D+S++V+    LG VV+AGD+FE    + D + W+  S D   Q +SR +I+++ADV++PGHG  F V +
Sbjct:   80 VRGP--ILVDTGGPWARGALLEALATQGVAP-EDVTLVVGTHGHSDHIGNLGLFPEAALLVSHDFCLPEGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVSVVVEGT-SLGTVVVAGDVFER---LGDEDSWQALSEDPVAQQRSRERILSVADVVVPGHGAPFRVVR 243          
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2HJB0|MBLC1_BOVIN (Metallo-beta-lactamase domain-containing protein 1 OS=Bos taurus OX=9913 GN=MBLAC1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 8.631e-34
Identity = 85/229 (37.12%), Postives = 113/229 (49.34%), Query Frame = 1
Query:   85 DPYSVVVLRDGVSE---VCDGKMTAFCSIVLV---------------------------KGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDIN-NKGKYVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            DPYSVVVL  G +E   V D  + A  S+ LV                           +GP  ILVD    W ++ +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D     G+Y+ H      P  +   + V ATPGH  + D+S+LV     LG V++ GD+F  ERD  D   W+  S D   Q  SR++I+  ADV++PGHG  F V +
Sbjct:   21 DPYSVVVLLQGYAEPEGVGD-AVRADGSVTLVLPQAWGPASSHREPQPYEAKTALEEAARGP--ILVDTAGPWAREALLGALAGQGVAP-GDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEERPLRLGPGLEVWATPGHGGQRDVSVLVAGT-ALGTVMVVGDVF--ERD-GDEGSWQALSEDPVAQKHSRKRILGTADVVVPGHGAPFRVIR 241          
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Match: sp|A4D2B0|MBLC1_HUMAN (Metallo-beta-lactamase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MBLAC1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.492e-33
Identity = 87/229 (37.99%), Postives = 120/229 (52.40%), Query Frame = 1
Query:   85 DPYSVVVLRDGVSE---VCDGKMTAFCSIVLV----KGPKN-----------------------ILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDIN-NKGKYVHHRFDLNIPYEIDEQISVIATPGH-SENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            DPYSVVVL  G +E   V D  + A  S+ LV    +GP +                       ILVD G  W ++ +L  L    ++   D+  V+GTH HSDHIGNL LFP A  LV  D     G+Y+ H      P  +   + V ATPGH  + D+S++V     LG VV+AGD+F  ERD  D + W+  S D   Q +SR++++ +ADV++PGHGP F V +
Sbjct:   17 DPYSVVVLLQGYAEPEGVGD-AVRADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAP-GDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGT-ALGTVVVAGDVF--ERD-GDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPPFRVLR 239          
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Match: A0A1S3HCJ1 (metallo-beta-lactamase domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106153470 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.302e-60
Identity = 103/216 (47.69%), Postives = 143/216 (66.20%), Query Frame = 1
Query:   82 PDPYSVVVLRDGVS--EVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDE-QISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKEMIAFKKNFQFD 720
            P  Y V+VL+DG S  +   G   A CSI LVKGP N++VDPG+AWDK+ VLN L++H L+  +DI+Y++ TH H DH+GNLNLF  A H++G +IN +  Y  H F   IPYEID+  + VI+TPGH+  D+S++V+   + G VVIAGD+FE   D+ +  LW+E S +   Q +SR  ++ +AD I+PGHGPMF V + +K  I    N Q D
Sbjct:    5 PPKYRVIVLKDGYSYQDNTTGLYKADCSITLVKGPHNVIVDPGNAWDKEFVLNALQQHCLTP-SDINYLVATHGHGDHVGNLNLFTKATHIIGTEINKEDAYTFHHFKRGIPYEIDDNHLEVISTPGHTGIDVSLVVRGTDQ-GTVVIAGDLFERAEDLDNPVLWQEGSENPRLQEQSRIDVLEIADYIVPGHGPMFKVPEDYKHGIQVVMNPQSD 218          
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Match: A0A0P4VUS7 (Lactamase_B domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.972e-60
Identity = 100/197 (50.76%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   91 YSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDE--DTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            YSV VL DG S + DG M A C+  LVKGP  ++VD  +AWDKD++L  L K   S   D+ Y IGTH HSDH+GNLNLF  A H+VG+ ++ K ++  H F+   PY+ID+ + VI TPGH+  D+S++V+   + G VVIAGD+FE E DISDS+LW+  +  E  +TQ K R ++I +AD I+PGHGPMF VT+
Sbjct:    3 YSVHVLHDGYSYLKDGVMRANCTCTLVKGPNPLIVDTMTAWDKDVLLEGLAKENTS-CADVKYAIGTHGHSDHLGNLNLFTAATHIVGYTVSYKDQFFIHPFETGEPYKIDDSLQVIPTPGHTTADVSVVVRTAHQ-GTVVIAGDLFEREEDISDSSLWRYTAGSENPETQEKHRNEVILLADHIVPGHGPMFRVTE 197          
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Match: A0A068Y678 (Metallo beta lactamase domain containing protein OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.218e-58
Identity = 97/195 (49.74%), Postives = 130/195 (66.67%), Query Frame = 1
Query:   88 PYSVVVLRDG-VSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSV 669
            PY V+V RDG   ++ +G   A C+I L+ G  NIL DPG  WD+DLVL  L K+ L +  DID+ I +H H DHIGNLN FPNA  ++G +I   G  V H F  + P+ IDE + VI TPGH+ ND+S++V+ VP LG VV++GDIFE++ D  + NLW++ S + + Q +SRR I + AD IIPGHG MF V
Sbjct:    3 PYQVIVCRDGFCGQIENGVFRAACTISLICGTFNILFDPGGPWDRDLVLFILAKYGLKS-EDIDFAICSHGHVDHIGNLNYFPNATIIIGTEIMRHGGVVKHHFSESNPFAIDENVRVIYTPGHTTNDVSLVVEGVPSLGTVVVSGDIFENQCDRENPNLWRDNSLNPELQERSRRLIASFADYIIPGHGSMFKV 196          
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Match: A0A1S3HCH9 (metallo-beta-lactamase domain-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106153461 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.495e-57
Identity = 95/192 (49.48%), Postives = 131/192 (68.23%), Query Frame = 1
Query:  148 AFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDE-QISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKEMIAFKKNFQFD 720
            A CSI LVKGP N++VDPG+AWDK+ VLN L++H L+  +DIDY++ TH H DH+GNLNLF  A H++G +IN +  Y  H F   IPYEID+  + VI+TPGH+  D+S++V+   + G VVIAGD+FE   D+ +  LW+E S +   Q +SR  ++ +AD I+PGHGPMF V + +K  I    N Q D
Sbjct:   11 ADCSITLVKGPHNVIVDPGNAWDKEFVLNALQQHCLTP-SDIDYLVATHGHGDHVGNLNLFTKATHIIGTEINKEDAYTFHHFKRGIPYEIDDNHLEVISTPGHTGIDVSVVVRGTDQ-GTVVIAGDLFERAEDLDNPVLWQEGSENPRLQEQSRIDVLEIADYIVPGHGPMFKVPEDYKHGIQVVMNPQSD 200          
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Match: T1JM42 (Lactamase_B domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.782e-57
Identity = 94/200 (47.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   91 YSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDED--TQMKSRRKIINMADVIIPGHGPMFSVTKVHK 684
            Y V VL++G S + +G + A  +  L+KGPKNILVD  S WDKD+++  L+KH+L    DI YV+ TH H+DHIGNLNLF  A H++G+ + ++ +Y  H F++N+PY ID+Q+ VI TPGH+ +D++++V+    LG V + GD+FE E D+ D  LW+E +  E+   Q K+R  I+  A  IIPGHGPMF VT+  K
Sbjct:    3 YQVAVLKEGYSRIVNGTVLARGTSTLIKGPKNILVDTLSPWDKDVLIKALQKHEL-KCEDIAYVVCTHGHTDHIGNLNLFTKATHIIGYSVCHEDQYYIHPFEMNMPYVIDDQVEVIPTPGHTGSDVTVIVQT-DALGIVAVVGDLFEREDDLDDPALWREIAGSENPKLQEKNRNMILRKAQYIIPGHGPMFKVTEEMK 200          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Cavefish
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:NCBI gene;Acc:103033811])

HSP 1 Score: 170.244 bits (430), Expect = 1.876e-52
Identity = 89/199 (44.72%), Postives = 125/199 (62.81%), Query Frame = 1
Query:   85 DPYSVVVLRDG-VSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKV 678
            +PYSV VL++G  +   DG   A  +I L+ GP+ +LVD G  WD++L++  LE+  LS   D+  V+GTH HSDHIGNLNLFP A  +V  DI+    Y+ ++     PY ID+ +SVI TPGH+  D+S+LVK     G V++AGD+FE      D + WK+ S + + Q   R+K +  ADVIIPGHGP+F V + 
Sbjct:   22 EPYSVSVLKEGYCTAQPDGTFRADGTISLITGPRTVLVDTGGPWDRELLIRRLEERSLSP-ADVSVVVGTHGHSDHIGNLNLFPEATVVVSCDISRGDTYLPNQLAEGQPYIIDDHLSVIPTPGHTGRDVSVLVKGT-SAGTVLVAGDLFEC---CDDEDSWKDLSENPELQEIGRQKALQEADVIIPGHGPLFRVHRT 215          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Sea Lamprey
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111102-2])

HSP 1 Score: 129.798 bits (325), Expect = 7.779e-37
Identity = 70/176 (39.77%), Postives = 102/176 (57.95%), Query Frame = 1
Query:  172 KGPKNILVDPGSAWDKDLVLNYLEKHKLSNITD----------IDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSV 669
            + P  ILVD G  W K+ ++  L++     +            +  V+ TH HSDH+GN+ LFP+A  ++GFD++    Y  H       Y I+  + VI TPGH+ +D+S++V++   +G VV+AGD+FE   D  D   WKE S+D  TQ  SR K+ ++ADVIIPGHGP F V
Sbjct:   82 RTPCAILVDTGGPWAKEELITSLQRTVQGCVQQSLAPSDVLQLVHTVVCTHGHSDHVGNVGLFPHARIIMGFDVSQGDLYETHGLAEGKAYVINPYVQVIPTPGHTCSDVSVVVRDT-SVGTVVVAGDVFEWSNDDDD---WKEHSHDPVTQQVSRSKVASLADVIIPGHGPPFRV 253          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Sea Lamprey
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111102-2])

HSP 1 Score: 128.642 bits (322), Expect = 1.413e-36
Identity = 70/174 (40.23%), Postives = 101/174 (58.05%), Query Frame = 1
Query:  178 PKNILVDPGSAWDKDLVLNYLEKHKLSNITD----------IDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSV 669
            P  ILVD G  W K+ ++  L++     +            +  V+ TH HSDH+GN+ LFP+A  ++GFD++    Y  H       Y I+  + VI TPGH+ +D+S++V++   +G VV+AGD+FE   D  D   WKE S+D  TQ  SR K+ ++ADVIIPGHGP F V
Sbjct:   66 PCAILVDTGGPWAKEELITSLQRTVQGCVQQSLAPSDVLQLVHTVVCTHGHSDHVGNVGLFPHARIIMGFDVSQGDLYETHGLAEGKAYVINPYVQVIPTPGHTCSDVSVVVRDT-SVGTVVVAGDVFEWSNDDDD---WKEHSHDPVTQQVSRSKVASLADVIIPGHGPPFRV 235          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Nematostella
Match: EDO49728 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFI5])

HSP 1 Score: 126.716 bits (317), Expect = 3.939e-36
Identity = 80/184 (43.48%), Postives = 111/184 (60.33%), Query Frame = 1
Query:  136 GKMTAFCSIVLVKGPK-NILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDI-NNKGKYVHHRFDLNIPYEIDE-QISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKV 678
            G+  A  +  LV+    NI+VD GS  DK  +L+ L+   L+   DID+V+ TH H DH GNLNLFPNA+H++  DI  N   Y    F     Y I+  Q+ V  TPGH+  D+S++V N  + G VVI+GD+FE  RD  D  +W+  S   + Q+ SR +++ MAD I+PGHGP+F V KV
Sbjct:   27 GRYRANGTATLVRTTNHNIMVDTGSPRDKQKILDGLQNLGLTP-EDIDHVVSTHGHVDHAGNLNLFPNAVHIMCRDICENDDIYKDDPFKEGHKYSIETGQVEVFPTPGHTLGDVSVIVYNT-KYGAVVISGDLFEC-RD--DCGVWQGNSECVEKQIVSRDRVLKMADWIVPGHGPIFQVEKV 205          
BLAST of Lactamase_B domain-containing protein vs. Ensembl Medaka
Match: mblac1 (metallo-beta-lactamase domain containing 1 [Source:NCBI gene;Acc:101162789])

HSP 1 Score: 158.688 bits (400), Expect = 6.753e-48
Identity = 84/196 (42.86%), Postives = 118/196 (60.20%), Query Frame = 1
Query:   91 YSVVVLRDGVS-EVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK 675
            YSV VL+ G      DG   A  +I L++GPK +LVD G +WD+D +L  L+   L    D+  V+GTH HSDHIGNL+LFP A+ +VG+D++    Y          + +DEQ+SV+ TPGH+  D+S+ V      G V+IAGD+FES    SD   W++ S +   Q  SR++ +  AD+IIPGHGP F V +
Sbjct:   29 YSVSVLKVGYCVPQSDGTFKADGTISLIRGPKTVLVDTGGSWDRDFLLRALKDRGL-RPEDVQVVVGTHGHSDHIGNLSLFPAALTIVGYDVSEGDTYQPSGLAEGRVHLMDEQVSVVPTPGHTGQDVSVQVTGT-SAGTVLIAGDLFES---CSDEETWRKLSLNPAMQEASRQRALQSADIIIPGHGPPFRVMR 219          
BLAST of Lactamase_B domain-containing protein vs. Planmine SMEST
Match: SMESG000017976.1 (SMESG000017976.1)

HSP 1 Score: 440.654 bits (1132), Expect = 3.378e-159
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 1
Query:   76 MKPDPYSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKEMIAFKKNFQFD 720
            MKPDPYSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKEMIAFKKNFQFD
Sbjct:    1 MKPDPYSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDLVLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKGKYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGDIFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTKVHKEMIAFKKNFQFD 215          
The following BLAST results are available for this feature:
BLAST of Lactamase_B domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MBLAC17.272e-3437.99metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swip-101.279e-3238.73SWimming Induced Paralysis [Source:UniProtKB/TrEM... [more]
C03F11.21.355e-2332.43pep chromosome:WBcel235:X:5394508:5397400:-1 gene:... [more]
C23H3.99.588e-2031.13pep chromosome:WBcel235:II:71672:77814:-1 gene:WBG... [more]
C23H3.99.588e-2031.13pep chromosome:WBcel235:II:71672:79266:-1 gene:WBG... [more]
C23H3.91.656e-1931.13pep chromosome:WBcel235:II:71672:77814:-1 gene:WBG... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG91179.077e-3437.25gene:FBgn0031766 transcript:FBtr0079222[more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mblac13.840e-5045.18metallo-beta-lactamase domain containing 1 [Source... [more]
mblac15.705e-1944.94metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tgm12.140e-4744.22transglutaminase 1 [Source:Xenbase;Acc:XB-GENE-101... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mblac15.756e-3540.94metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q498J9|MBLC1_XENLA7.572e-4744.72Metallo-beta-lactamase domain-containing protein 1... [more]
sp|Q6AYD1|MBLC1_RAT2.615e-3440.94Metallo-beta-lactamase domain-containing protein 1... [more]
sp|Q8BWY4|MBLC1_MOUSE4.026e-3440.94Metallo-beta-lactamase domain-containing protein 1... [more]
sp|Q2HJB0|MBLC1_BOVIN8.631e-3437.12Metallo-beta-lactamase domain-containing protein 1... [more]
sp|A4D2B0|MBLC1_HUMAN3.492e-3337.99Metallo-beta-lactamase domain-containing protein 1... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HCJ11.302e-6047.69metallo-beta-lactamase domain-containing protein 1... [more]
A0A0P4VUS71.972e-6050.76Lactamase_B domain-containing protein OS=Scylla ol... [more]
A0A068Y6783.218e-5849.74Metallo beta lactamase domain containing protein O... [more]
A0A1S3HCH91.495e-5749.48metallo-beta-lactamase domain-containing protein 1... [more]
T1JM422.782e-5747.00Lactamase_B domain-containing protein OS=Strigamia... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mblac11.876e-5244.72metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mblac17.779e-3739.77metallo-beta-lactamase domain containing 1 [Source... [more]
mblac11.413e-3640.23metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO497283.939e-3643.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mblac16.753e-4842.86metallo-beta-lactamase domain containing 1 [Source... [more]
back to top
BLAST of Lactamase_B domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017976.13.378e-159100.00SMESG000017976.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011577 ID=SMED30011577|Name=Lactamase_B domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=754bp
TAAAGTTTGATTGTTTATTTACTTAAAATAACTGAGACAATTCAAATAAT
AATTCTGGTGTAAATTTTAGCGGTAATGAAACCTGACCCTTATTCTGTAG
TAGTGCTTCGAGATGGAGTGAGTGAAGTTTGTGATGGAAAAATGACGGCA
TTTTGTTCTATAGTTCTTGTGAAAGGCCCAAAAAATATTTTAGTAGATCC
AGGCAGTGCATGGGATAAAGATCTTGTTTTAAATTACTTAGAAAAACATA
AACTTTCCAATATAACGGATATTGATTATGTAATTGGAACGCATTGCCAT
TCGGATCACATTGGAAATCTTAATCTATTCCCTAATGCAATACATCTCGT
AGGGTTTGATATAAATAATAAAGGCAAATATGTTCATCATAGATTTGATT
TAAATATTCCTTATGAGATTGATGAACAAATTTCAGTTATTGCTACTCCA
GGTCACAGTGAAAATGATATTTCAATTTTGGTAAAGAACGTTCCAGAACT
CGGTAATGTTGTGATTGCAGGAGACATTTTTGAAAGTGAAAGAGATATAA
GTGATTCAAATTTATGGAAAGAACAGAGCAATGATGAAGATACTCAAATG
AAGTCTCGACGTAAAATAATCAATATGGCTGACGTTATCATTCCAGGACA
TGGGCCGATGTTTAGTGTGACAAAGGTACATAAAGAAATGATTGCTTTTA
AGAAAAATTTCCAATTTGACTAAAAAAGAACATTTTAATTGATGTGTATT
TTCT
back to top

protein sequence of SMED30011577-orf-1

>SMED30011577-orf-1 ID=SMED30011577-orf-1|Name=SMED30011577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MKPDPYSVVVLRDGVSEVCDGKMTAFCSIVLVKGPKNILVDPGSAWDKDL
VLNYLEKHKLSNITDIDYVIGTHCHSDHIGNLNLFPNAIHLVGFDINNKG
KYVHHRFDLNIPYEIDEQISVIATPGHSENDISILVKNVPELGNVVIAGD
IFESERDISDSNLWKEQSNDEDTQMKSRRKIINMADVIIPGHGPMFSVTK
VHKEMIAFKKNFQFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036866RibonucZ/Hydroxyglut_hydro
IPR039344MBLAC1
IPR000299FERM_domain
IPR001279Metallo-B-lactamas
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001279Metallo-beta-lactamaseSMARTSM00849Lactamase_B_5acoord: 26..192
e-value: 4.2E-14
score: 62.9
IPR001279Metallo-beta-lactamasePFAMPF00753Lactamase_Bcoord: 28..94
e-value: 3.1E-11
score: 43.7
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeGENE3DG3DSA:3.60.15.10coord: 1..200
e-value: 1.3E-59
score: 203.4
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeSUPERFAMILYSSF56281Metallo-hydrolase/oxidoreductasecoord: 12..198
IPR039344Metallo-beta-lactamase domain-containing protein 1PANTHERPTHR23200UNCHARACTERIZEDcoord: 3..204
NoneNo IPR availablePANTHERPTHR23200:SF48METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROTEIN 1coord: 3..204
NoneNo IPR availableCDDcd07711MBLAC1-like_MBL-foldcoord: 7..196
e-value: 1.38378E-75
score: 224.002