PR domain zinc finger protein 5

Overview
NamePR domain zinc finger protein 5
Smed IDSMED30011575
Length (bp)2879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PR domain zinc finger protein 5 (SMED30011575) t-SNE clustered cells

Violin plots show distribution of expression levels for PR domain zinc finger protein 5 (SMED30011575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PR domain zinc finger protein 5 (SMED30011575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PR domain zinc finger protein 5 (SMED30011575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 62.3882 bits (150), Expect = 4.602e-9
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G      EQ + +  P +        +  + + ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF    + PH  +A
Sbjct:   76 IPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVG------EQRSNLKDPSYGWE-----ILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMA 200          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 62.3882 bits (150), Expect = 4.632e-9
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G      EQ + +  P +        +  + + ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF    + PH  +A
Sbjct:   76 IPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVG------EQRSNLKDPSYGWE-----ILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMA 200          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 59.6918 bits (143), Expect = 2.640e-8
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query: 1392 NCNGNELEHIQNNLPHMFQLKESENSD--IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAF---KSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
              +G      + +LP     K + NS+  IGV +K+ + +GT  GP +G+I  N       ++ YF R  S+    G+LH     F   KSNW+R V    +  + NL   Q    I+F  I+ I ++ ELL++
Sbjct:   34 GADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSR----GELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVW 163          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 59.6918 bits (143), Expect = 2.640e-8
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query: 1392 NCNGNELEHIQNNLPHMFQLKESENSD--IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAF---KSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
              +G      + +LP     K + NS+  IGV +K+ + +GT  GP +G+I  N       ++ YF R  S+    G+LH     F   KSNW+R V    +  + NL   Q    I+F  I+ I ++ ELL++
Sbjct:   34 GADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSR----GELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVW 163          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 59.6918 bits (143), Expect = 2.640e-8
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query: 1392 NCNGNELEHIQNNLPHMFQLKESENSD--IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAF---KSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
              +G      + +LP     K + NS+  IGV +K+ + +GT  GP +G+I  N       ++ YF R  S+    G+LH     F   KSNW+R V    +  + NL   Q    I+F  I+ I ++ ELL++
Sbjct:   34 GADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSR----GELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVW 163          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Celegans
Match: set-17 (SET (Trithorax/polycomb) domain containing [Source:UniProtKB/TrEMBL;Acc:A0A168H266])

HSP 1 Score: 55.0694 bits (131), Expect = 8.262e-8
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCL---QFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            EN  ++C  CN+     C  HP+  IP+  +                R+ES   S+           Q  LP +F+++ES+  N+ +GV  +  +  G V GPY G+  +           ++  G +    +GD         A +SNWLR +      D+ N+  +Q + KIF++ I+ I  + ELL++
Sbjct:   74 ENLDIHCDKCNKFYRPYCRLHPLFKIPDRVLK---------------RDESSNLSFS----------QQTLPILFRIEESKLPNAGLGVIAEVFIPVGMVFGPYKGRRCQKKTD-------FYKDGYAWLIKSGDKRFYIDGSDAERSNWLRYINSPRFEDEQNMLAFQTNGKIFYRVIKPIRINQELLVW 232          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Celegans
Match: set-17 (SET (Trithorax/polycomb) domain containing [Source:UniProtKB/TrEMBL;Acc:A0A168H266])

HSP 1 Score: 54.299 bits (129), Expect = 1.381e-7
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCL---QFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            EN  ++C  CN+     C  HP+  IP+  +                R+ES   S+           Q  LP +F+++ES+  N+ +GV  +  +  G V GPY G+  +           ++  G +    +GD         A +SNWLR +      D+ N+  +Q + KIF++ I+ I  + ELL++
Sbjct:   86 ENLDIHCDKCNKFYRPYCRLHPLFKIPDRVLK---------------RDESSNLSFS----------QQTLPILFRIEESKLPNAGLGVIAEVFIPVGMVFGPYKGRRCQKKTD-------FYKDGYAWLIKSGDKRFYIDGSDAERSNWLRYINSPRFEDEQNMLAFQTNGKIFYRVIKPIRINQELLVW 244          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Fly
Match: CG43347 (gene:FBgn0263072 transcript:FBtr0307022)

HSP 1 Score: 51.2174 bits (121), Expect = 6.204e-6
Identity = 29/119 (24.37%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1428 NLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNE 1784
            ++P  F+L   E +  GV+ +  +   T +GP +G+ ++  E        +    C        L C      SNWLR VR   +Y++ N+ +   D + +F + +D+ +  ELL +++
Sbjct: 1030 SVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSD 1148          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Fly
Match: CG43347 (gene:FBgn0263072 transcript:FBtr0332390)

HSP 1 Score: 51.2174 bits (121), Expect = 6.631e-6
Identity = 29/119 (24.37%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1428 NLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNE 1784
            ++P  F+L   E +  GV+ +  +   T +GP +G+ ++  E        +    C        L C      SNWLR VR   +Y++ N+ +   D + +F + +D+ +  ELL +++
Sbjct: 1030 SVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSD 1148          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Fly
Match: CG43347 (gene:FBgn0263072 transcript:FBtr0307021)

HSP 1 Score: 50.8322 bits (120), Expect = 7.594e-6
Identity = 29/119 (24.37%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1428 NLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNE 1784
            ++P  F+L   E +  GV+ +  +   T +GP +G+ ++  E        +    C        L C      SNWLR VR   +Y++ N+ +   D + +F + +D+ +  ELL +++
Sbjct: 1030 SVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSD 1148          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Xenopus
Match: ENSXETT00000026109.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:100486384])

HSP 1 Score: 54.299 bits (129), Expect = 1.106e-6
Identity = 35/124 (28.23%), Postives = 57/124 (45.97%), Query Frame = 3
Query: 1428 NLPHMFQLKESENSDIGVW-TKQLLLQGTVIGPYLGKIIENSEQENLMS------KPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            +LP    +KE      GVW T  ++ +G + GPY G +I +     + S        YF    S               KS+W+R V      ++ NL ++QY  KI+++A Q I + +ELL++
Sbjct:   55 SLPEGLVVKERPQGGFGVWCTIPVIPRGCIFGPYEGDVIMDRSDCTVYSWAVRENGSYFYIDASDDS------------KSSWMRYVACASTEEEHNLTVFQYRGKIYYRASQVIPTGTELLVW 166          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 58.9214 bits (141), Expect = 2.925e-8
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G+     ++ +L    Y         +  +   ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF     +PH  +A
Sbjct:   13 IPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGE-----QRSDLKDSSYGWE------ILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMA 137          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 58.9214 bits (141), Expect = 3.025e-8
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 1431 LPHMFQLKES--ENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G+     ++ +L    Y         +  +   ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF     +PH  +A
Sbjct:   78 IPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGE-----QRSDLKDSSYGWE------ILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMA 202          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 58.9214 bits (141), Expect = 3.070e-8
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 1431 LPHMFQLKES--ENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G+     ++ +L    Y         +  +   ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF     +PH  +A
Sbjct:   78 IPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGE-----QRSDLKDSSYGWE------ILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMA 202          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Match: Prdm4 (PR domain containing 4 [Source:MGI Symbol;Acc:MGI:1920093])

HSP 1 Score: 55.8398 bits (133), Expect = 2.715e-7
Identity = 49/191 (25.65%), Postives = 85/191 (44.50%), Query Frame = 3
Query: 1233 LYCLVCNQSNNTACCNH-PVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKES-ENSDIGVWTKQLLLQGTVIGPYLGK------IIENSEQE-NLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            ++C +C+++  + C +H PV ++P+  I                  ES+ +               +LP    L++S   +D+GVWT + +   T  GP +G+      + E +++  N + K Y T       +T D +      + NW+  VR   N ++ NL  Y +D KI+F   QDI   SELL +
Sbjct:  371 IWCTLCDRAYPSDCPDHGPVTFVPDTPI------------------ESRARL--------------SLPKQLVLRQSIVGTDVGVWTAETIPVRTCFGPLIGQQSHSLEVAEWTDKAVNHVWKIYHTGVLEFCIITTDEN------ECNWMMFVRKARNREEQNLVAYPHDGKIYFCTSQDIPPESELLFY 523          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 52.373 bits (124), Expect = 3.132e-6
Identity = 37/135 (27.41%), Postives = 62/135 (45.93%), Query Frame = 3
Query: 1392 NCNGNELEHIQNNLPHMFQLKESENSD---IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAF---KSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
              +G      + +LP     K + N+    IGV +K+ + +GT  GP +G++  N       ++ YF R  S+     + H     F   KSNW+R V    +  + NL   Q    I+F  I+ I ++ ELL++
Sbjct:   83 GADGGTSVQAEASLPRNLLFKYAANNSKEVIGVVSKEYIPKGTRFGPLIGEVYTNDTVPKNANRKYFWRIYSRE----EFHHFIDGFNEEKSNWMRYVNPAHSAREQNLAACQNGMNIYFYTIKPIPANQELLVW 213          
BLAST of PR domain zinc finger protein 5 vs. UniProt/SwissProt
Match: sp|Q03112|MECOM_HUMAN (Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 2.225e-8
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G      EQ + +  P +        +  + + ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF    + PH  +A
Sbjct:   76 IPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVG------EQRSNLKDPSYGWE-----ILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMA 200          
BLAST of PR domain zinc finger protein 5 vs. UniProt/SwissProt
Match: sp|O75626|PRDM1_HUMAN (PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 1.325e-7
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query: 1392 NCNGNELEHIQNNLPHMFQLKESENSD--IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAF---KSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
              +G      + +LP     K + NS+  IGV +K+ + +GT  GP +G+I  N       ++ YF R  S+    G+LH     F   KSNW+R V    +  + NL   Q    I+F  I+ I ++ ELL++
Sbjct:   70 GADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSR----GELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVW 199          
BLAST of PR domain zinc finger protein 5 vs. UniProt/SwissProt
Match: sp|P14404|MECOM_MOUSE (Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.825e-7
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 1431 LPHMFQLKES--ENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSN------WLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF----NEPHLRIA 1802
            +P  F+L+ES    + +G+WTK+ +  G   GPY+G+     ++ +L    Y         +  +   ++F   ++      WL+ +RF   YD+ NL   Q + +IF++ + DI+   ELLLF     +PH  +A
Sbjct:   78 IPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGE-----QRSDLKDSSYGWE------ILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMA 202          
BLAST of PR domain zinc finger protein 5 vs. UniProt/SwissProt
Match: sp|A0A163UT06|SET17_CAEEL (Histone-lysine N-methyltransferase set-17 OS=Caenorhabditis elegans OX=6239 GN=set-17 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.756e-6
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCL---QFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            EN  ++C  CN+     C  HP+  IP+  +                R+ES   S+           Q  LP +F+++ES+  N+ +GV  +  +  G V GPY G+  +           ++  G +    +GD         A +SNWLR +      D+ N+  +Q + KIF++ I+ I  + ELL++
Sbjct:   86 ENLDIHCDKCNKFYRPYCRLHPLFKIPDRVLK---------------RDESSNLSFS----------QQTLPILFRIEESKLPNAGLGVIAEVFIPVGMVFGPYKGRRCQKKTD-------FYKDGYAWLIKSGDKRFYIDGSDAERSNWLRYINSPRFEDEQNMLAFQTNGKIFYRVIKPIRINQELLVW 244          
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Match: A0A5J4NNW7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0000926 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.099e-10
Identity = 59/217 (27.19%), Postives = 93/217 (42.86%), Query Frame = 3
Query: 1173 RKSSLSAANKTNHNSI----END-ILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQL---KESENSDIGVWTKQLLLQGTVIGPYLGKIIENSE-------QENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            R+  L   N  N+++I    E+D +LYC VCN S    C  HP++W+ N  +         D + D   +   +  +C C      H     P  + L        +  GVW  + +  GT  GPY G ++   E       + +     +  R  +  G+   L   +   +SNWLR V      ++ NL   QY  KI+++A QDI+  SELL +
Sbjct:  147 RRYPLREKNAANYSTIAQTPEDDRLLYCYVCNVSVIDGCREHPIEWVENTPVT------ACDGATD--HDVYFQMKHCVCGSPYYLHASRTAPRDWVLVFKSGIRRAGFGVWANKNIKCGTTFGPYDGVVVNLDEIGDDEFARRSRGGYAWLVRN-NLEGVKSHLVDARNPLRSNWLRFVNCARYDEEQNLVTIQYRGKIYYRACQDIARGSELLTY 354          
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Match: A0A4S2LHT2 (SET domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008528 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.084e-9
Identity = 54/194 (27.84%), Postives = 87/194 (44.85%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPH--MFQLKES-ENSDIGVWTKQLLLQGTVIGPYLGKII--ENSEQENLMSKPYFTRGCSQ-------SGLTGDLHCLQFAFKSNWLR---CVRFTDNYDKANLKIYQYDAKIFFQAIQDISS 1757
            ++  LYC  C+ S    C  HPV+W+ N  +       V +++  K R+   +K  C C      H     P   ++  K     +  GVWT + + +GT  GPY GK++  +   +E L+ +   +RG           G+   L   +   +SNWLR   C RF    ++ NL   QY  KI+++A Q  S+
Sbjct:  180 DDRFLYCYDCDSSVLDGCLIHPVEWVENKPLS------VCEEA--KGRDVQFQKEKCVCGIAYYLHTARTAPRDWIYIYKSGIPGAGFGVWTNREIKRGTTFGPYAGKVVYLDEMREEELVRR---SRGGYAWLVRQNLQGMKSHLVDARNPLQSNWLRFVNCARFD---EEQNLVTIQYRGKIYYRACQVCST 359          
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Match: A0A5K3FJG2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.450e-9
Identity = 48/196 (24.49%), Postives = 86/196 (43.88%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAH-IDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMF---QLKESENSDIGVWTKQLLLQGTVIGPYLGKIIE----NSEQENLMSKPYFTRGCSQSGLTGDLHCLQFA--FKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            ++  LYC  C++     C  HP+ WI +   ++C  V+             S     C C  +E  H +   P  F        + + +GVW ++ +  G+V GPY G+++     + E+    S+  +     ++ +    H +      KSNWLR V    + ++ NL   QY  KI+++A ++I    ELL +
Sbjct:  187 DDRYLYCYECDKLYEDPCPTHPIMWIRSVRPLNCDAVK-------------SGNARDCCCGSDERNHAKRTAPEAFVTVGRSSIKGAGLGVWAEKTIPIGSVFGPYGGEVVPLDGLSEEEFKRRSRCGYAWLVRENLMGTKSHLIDAVKPVKSNWLRFVNCARHEEEQNLVTIQYRGKIYYRACKNIDPDYELLTY 369          
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Match: A0A5K3FK73 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.181e-8
Identity = 48/196 (24.49%), Postives = 86/196 (43.88%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAH-IDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMF---QLKESENSDIGVWTKQLLLQGTVIGPYLGKIIE----NSEQENLMSKPYFTRGCSQSGLTGDLHCLQFA--FKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            ++  LYC  C++     C  HP+ WI +   ++C  V+             S     C C  +E  H +   P  F        + + +GVW ++ +  G+V GPY G+++     + E+    S+  +     ++ +    H +      KSNWLR V    + ++ NL   QY  KI+++A ++I    ELL +
Sbjct:  133 DDRYLYCYECDKLYEDPCPTHPIMWIRSVRPLNCDAVK-------------SGNARDCCCGSDERNHAKRTAPEAFVTVGRSSIKGAGLGVWAEKTIPIGSVFGPYGGEVVPLDGLSEEEFKRRSRCGYAWLVRENLMGTKSHLIDAVKPVKSNWLRFVNCARHEEEQNLVTIQYRGKIYYRACKNIDPDYELLTY 315          
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Match: G7YGS2 (Histone-lysine N-methyltransferase PRDM9 OS=Clonorchis sinensis OX=79923 GN=Prdm9 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.522e-8
Identity = 52/190 (27.37%), Postives = 86/190 (45.26%), Query Frame = 3
Query: 1221 ENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPH--MFQLKES-ENSDIGVWTKQLLLQGTVIGPYLGKII--ENSEQENLMSKPYFTRGCSQ-------SGLTGDLHCLQFAFKSNWLR---CVRFTDNYDKANLKIYQYDAKIFFQAIQ 1745
            ++  LYC  C+ S+   C  HPV+W+ N  +       V +++  K R+   ++  C C      H     P   ++  K     +  GVWT + + +GT  GPY GK++  +   +E L+ +   +RG           G+   L   +   +SNWLR   C RF    ++ NL   QY  KI+++A Q
Sbjct:   31 DDRFLYCYECDSSHLDGCLIHPVEWVENKPLS------VCEEA--KGRDVEFQREKCVCGIAYYLHTARTAPRDWIYIYKSGIPGAGFGVWTNREIKRGTTFGPYAGKVVYLDEMREEELVRR---SRGGYAWLVRQNLQGMKSHLVDARNPLQSNWLRFVNCARFD---EEQNLVTIQYRGKIYYRACQ 206          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Cavefish
Match: PRDM15 (PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:13999])

HSP 1 Score: 53.9138 bits (128), Expect = 9.712e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query: 1410 LEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFK--SNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            L   +++LP+  Q++++E+   GV+  Q L++ T  GP+  K + N   E +     F + CS       + C   + +   NW+  VR   ++   NL  YQ D +++F   +D+    EL ++
Sbjct:   38 LSRARSSLPNSLQIRQAEDGIEGVYVLQRLVKRTRFGPFEAKRVHNLNTEGVFPLKIFQKDCS-------VVCFDTSNEDDCNWMMLVRPATDHKHQNLTAYQQDDELYFNTSEDVLPGVELRVW 155          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Cavefish
Match: PRDM15 (PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:13999])

HSP 1 Score: 53.1434 bits (126), Expect = 1.418e-6
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query: 1410 LEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFK--SNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            L   +++LP+  Q++++E+   GV+  Q L++ T  GP+  K + N   E +     F + CS       + C   + +   NW+  VR   ++   NL  YQ D +++F   +D+    EL ++
Sbjct:   38 LSRARSSLPNSLQIRQAEDGIEGVYVLQRLVKRTRFGPFEAKRVHNLNTEGVFPLKIFQKDCS-------VVCFDTSNEDDCNWMMLVRPATDHKHQNLTAYQQDDELYFNTSEDVLPGVELRVW 155          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Nematostella
Match: EDO48955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI18])

HSP 1 Score: 65.0846 bits (157), Expect = 3.151e-11
Identity = 37/118 (31.36%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            +P   ++KES   N+  GV+ K ++ +    GPY+G+I+   E +     PY        G    L   + A +SNWLR V  +   D+ NL+  QYD  I++ A ++I+   ELL +
Sbjct:  123 VPPGLEVKESNIPNAGRGVFAKCIIPKHEFFGPYIGRIVTRKEAKTYKESPYVWEVFDDYGKLTHLIDGRDALQSNWLRYVNCSKGLDEQNLRAVQYDKNIYYMATKEIAIGEELLTY 240          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 50.0618 bits (118), Expect = 3.501e-6
Identity = 32/118 (27.12%), Postives = 62/118 (52.54%), Query Frame = 3
Query: 1431 LPHMFQLKESE--NSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            LPH  ++K S   N+ +GV++K  + +  + GPY G  ++ S+ E + +   +    S+ G            +SNW+R V  +    + NL  +QY  +IF+++ +D+   +ELL++
Sbjct:   53 LPHCLEIKTSSIPNAGLGVFSKSRIAKRVMFGPYKGTKVKLSD-EQMENDTSYMWEISRDGNFNHFIDGHDEEQSNWMRFVNCSRCEKEQNLVTFQYRGQIFYRSYKDVHPGTELLVW 169          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Nematostella
Match: EDO36495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIE4])

HSP 1 Score: 48.521 bits (114), Expect = 4.616e-6
Identity = 25/102 (24.51%), Postives = 51/102 (50.00%), Query Frame = 3
Query: 1473 IGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            +GV++   + +GT +GPY G+I++  +    +         ++ G        +     NW+  V    N  + NL+++QY   I+++AI+D+    ELL++
Sbjct:   22 LGVFSTCWIKEGTQMGPYTGRIVKPDQVNYEIDNNLMWEVLNEDGSVSHFLDAKEENPRNWMGFVNCARNEQEQNLEVFQYGGNIYYRAIKDVPPDQELLVW 123          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Medaka
Match: PRDM15 (PR/SET domain 15 [Source:NCBI gene;Acc:101175186])

HSP 1 Score: 51.9878 bits (123), Expect = 3.554e-6
Identity = 31/125 (24.80%), Postives = 60/125 (48.00%), Query Frame = 3
Query: 1410 LEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKS--NWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            L   +++LP+  +++E  N + GV+  + L++ T  GP+  K + + E+E       F +        G + C   + +   NW+  VR   ++   NL  YQ D  ++F   QD+   +EL ++
Sbjct:   43 LSRARSSLPNSLEIREVANGEEGVFVLRRLVKRTRFGPFEAKRVSSVEKEGAFPLKVFLK-------EGMVLCFDCSSEEDCNWMMLVRPATDHRHQNLTAYQQDDDVYFNTSQDVLPGTELRVW 160          
BLAST of PR domain zinc finger protein 5 vs. Ensembl Medaka
Match: PRDM15 (PR/SET domain 15 [Source:NCBI gene;Acc:101175186])

HSP 1 Score: 51.2174 bits (121), Expect = 6.668e-6
Identity = 31/125 (24.80%), Postives = 60/125 (48.00%), Query Frame = 3
Query: 1410 LEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKS--NWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLF 1778
            L   +++LP+  +++E  N + GV+  + L++ T  GP+  K + + E+E       F +        G + C   + +   NW+  VR   ++   NL  YQ D  ++F   QD+   +EL ++
Sbjct:   33 LSRARSSLPNSLEIREVANGEEGVFVLRRLVKRTRFGPFEAKRVSSVEKEGAFPLKVFLK-------EGMVLCFDCSSEEDCNWMMLVRPATDHRHQNLTAYQQDDDVYFNTSQDVLPGTELRVW 150          
BLAST of PR domain zinc finger protein 5 vs. Planmine SMEST
Match: SMESG000053925.1 (SMESG000053925.1)

HSP 1 Score: 1540.4 bits (3987), Expect = 0.000e+0
Identity = 832/867 (95.96%), Postives = 838/867 (96.66%), Query Frame = 3
Query:   54 MMXXXXXXANCSKIDNNKPVETGKISELFPIKPVVCKFFKPKLKGSNHSYMGGGNRSSKIQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFXXXXXXXXXXXXXISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKXXXXXXXXXXXXCCRSCNNKITVXXXXXXXXXXXXXXXXXXXFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNKLNLDRSASLKKSSLGLPVHGNXXXXXXXXXXXXXXXXXPVHGKKSNLDLSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYLENSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSXXXXXXXXXXXXXXXXDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY 2654
            MMLLLDDD NC+KIDNNK VET KISELFPIKPVVCKFFKPKLKGSNHS+M GGNRSS IQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFSSTDSSSFSNLPSISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKNEETNLSNLSNECCRSCNNKITVTKKSKRKKSHLSKRKSKTKFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNK NLD SASLKKSSLGLPVHG                      KKSNL+LSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIEND+LYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRC+RFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYL+NSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSINRLIRIRGLRPLLGIDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY
Sbjct:    1 MMLLLDDDVNCAKIDNNKLVETSKISELFPIKPVVCKFFKPKLKGSNHSHMAGGNRSSTIQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFSSTDSSSFSNLPSISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKNEETNLSNLSNECCRSCNNKITVTKKSKRKKSHLSKRKSKTKFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNKSNLDLSASLKKSSLGLPVHG----------------------KKSNLNLSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIENDVLYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCIRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYLDNSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSINRLIRIRGLRPLLGIDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY 845          
BLAST of PR domain zinc finger protein 5 vs. Planmine SMEST
Match: SMESG000053925.1 (SMESG000053925.1)

HSP 1 Score: 1537.32 bits (3979), Expect = 0.000e+0
Identity = 824/859 (95.93%), Postives = 830/859 (96.62%), Query Frame = 3
Query:   78 ANCSKIDNNKPVETGKISELFPIKPVVCKFFKPKLKGSNHSYMGGGNRSSKIQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFXXXXXXXXXXXXXISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKXXXXXXXXXXXXCCRSCNNKITVXXXXXXXXXXXXXXXXXXXFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNKLNLDRSASLKKSSLGLPVHGNXXXXXXXXXXXXXXXXXPVHGKKSNLDLSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIENDILYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYLENSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSXXXXXXXXXXXXXXXXDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY 2654
             NC+KIDNNK VET KISELFPIKPVVCKFFKPKLKGSNHS+M GGNRSS IQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFSSTDSSSFSNLPSISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKNEETNLSNLSNECCRSCNNKITVTKKSKRKKSHLSKRKSKTKFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNK NLD SASLKKSSLGLPVHG                      KKSNL+LSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIEND+LYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRC+RFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYL+NSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSINRLIRIRGLRPLLGIDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY
Sbjct:    8 VNCAKIDNNKLVETSKISELFPIKPVVCKFFKPKLKGSNHSHMAGGNRSSTIQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFSSTDSSSFSNLPSISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRTNQSKNEETNLSNLSNECCRSCNNKITVTKKSKRKKSHLSKRKSKTKFIEKFSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPVHGNKSNLDLSASLKKSSLGLPVHG----------------------KKSNLNLSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKSLVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIENDVLYCLVCNQSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNGNELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSEQENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCIRFTDNYDKANLKIYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQNVSFEDRANQDALIMKIRKLYLDNSRLTVVDIIGLLRCEHPDLNDLNENELAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKRFPNVPRLSKDSINRLIRIRGLRPLLGIDDKADLETVQSIVSMVTRDTALSVKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQEVLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIKVKPPQFQSAKGIKPIIY 844          
The following BLAST results are available for this feature:
BLAST of PR domain zinc finger protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MECOM4.602e-928.68MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
MECOM4.632e-928.68MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
PRDM12.640e-830.60PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM12.640e-830.60PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM12.640e-830.60PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
set-178.262e-825.65SET (Trithorax/polycomb) domain containing [Sourc... [more]
set-171.381e-725.65SET (Trithorax/polycomb) domain containing [Sourc... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG433476.204e-624.37gene:FBgn0263072 transcript:FBtr0307022[more]
CG433476.631e-624.37gene:FBgn0263072 transcript:FBtr0332390[more]
CG433477.594e-624.37gene:FBgn0263072 transcript:FBtr0307021[more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000026109.11.106e-628.23zinc finger BED domain-containing protein 1-like [... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mecom2.925e-827.94MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom3.025e-827.94MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom3.070e-827.94MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Prdm42.715e-725.65PR domain containing 4 [Source:MGI Symbol;Acc:MGI:... [more]
Prdm13.132e-627.41PR domain containing 1, with ZNF domain [Source:MG... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q03112|MECOM_HUMAN2.225e-828.68Histone-lysine N-methyltransferase MECOM OS=Homo s... [more]
sp|O75626|PRDM1_HUMAN1.325e-730.60PR domain zinc finger protein 1 OS=Homo sapiens OX... [more]
sp|P14404|MECOM_MOUSE1.825e-727.94Histone-lysine N-methyltransferase MECOM OS=Mus mu... [more]
sp|A0A163UT06|SET17_CAEEL1.756e-625.65Histone-lysine N-methyltransferase set-17 OS=Caeno... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NNW76.099e-1027.19Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2LHT25.084e-927.84SET domain-containing protein OS=Opisthorchis feli... [more]
A0A5K3FJG28.450e-924.49Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FK731.181e-824.49Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G7YGS21.522e-827.37Histone-lysine N-methyltransferase PRDM9 OS=Clonor... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PRDM159.712e-725.60PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:1399... [more]
PRDM151.418e-625.60PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:1399... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO489553.151e-1131.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384193.501e-627.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364954.616e-624.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PRDM153.554e-624.80PR/SET domain 15 [Source:NCBI gene;Acc:101175186][more]
PRDM156.668e-624.80PR/SET domain 15 [Source:NCBI gene;Acc:101175186][more]
back to top
BLAST of PR domain zinc finger protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000053925.10.000e+095.96SMESG000053925.1[more]
SMESG000053925.10.000e+095.93SMESG000053925.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011575 ID=SMED30011575|Name=PR domain zinc finger protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2879bp
TATTTGTATTGAAATAATAACATAAAATCATATATTTTAAGCTGTCATCG
TTTATGATGCTATTACTTGATGATGACGCGAATTGTTCTAAAATTGATAA
TAACAAACCGGTTGAAACCGGCAAAATTTCTGAATTGTTTCCAATTAAAC
CAGTAGTTTGTAAATTCTTCAAGCCAAAACTTAAAGGATCAAATCATTCT
TACATGGGTGGAGGAAACAGAAGCAGTAAAATCCAACTCGAGGAAATATG
TATTACAAGTAAACATCCCAAATCTCAATCAAGATCTCAACAGAATTTTA
TGAACGGCGAAGGTTTAATGCAAACCGAAATTCCTTATCAGTATTTTTCA
TCGACAGATTCGTCTTCGTTTTCCAATCTTCCGAGTATCAGTGTAGAATG
TTCTAAAACCTCTGAATCCTTTTCTGATTCCGATAATCAAGACCCCGATG
AAAGCGGAGTCACCACATTAATTGTAAAAAATGTATATTCATTGTGCAGA
ACAAACCAATCTAAAAATGAGGAAACAAATTTATCAAATCTATCGAACGA
ATGCTGCAGAAGTTGTAACAATAAGATAACTGTTACAAAGAAATCAAAAC
GAAAAAAGTCACACCTTTCTAAAAGAAAATCTAAAACTAAGTTTATCGAA
AAGTTTAGTTTACTAGTTGAAGATAAAGAAAAACCTGATCTAAACGTATC
AGATTCAGAACTGAGTGACACTCCAACAGAAGCAATGACCCTCGATATTA
ATGATTTTGATCTGCCAACCCACGGAAATAAATCGAACCTTGAACAACCA
GTCCACGGAAATAAATTAAACCTCGATCGTTCAGCCAGCCTAAAAAAATC
GAGCCTTGGTCTGCCAGTCCACGGAAATAAATCAAACCTCGACCTATCAG
CCAGCCTAAAAAAATCGAGTCTTGGTCTGCCAGTCCACGGAAAAAAATCA
AACCTAGACCTATCAGCGTACGGAAATAAATTGAACCTTGATCTAATGCA
ACCAGTAGTGTTGTTAGATCGGTTTGAACCCGAAAGAATTGCTCCCCATC
TCTTCCCTGATCATGAAACACTTCGCCTAACTATCAATTTAAAATCTAAA
TCGCTTGTTGCTAGATCAACCGAAAAAAGTAGTTCCTTCCTTCCAAATTC
CAATGAGACAACCATTAAAATTCGGAAATCCTCTTTGTCGGCCGCAAATA
AAACCAATCATAATTCGATCGAGAACGATATTCTTTACTGTTTAGTTTGT
AACCAATCAAATAATACCGCGTGTTGCAACCATCCAGTCAAATGGATTCC
CAATGCACATATTGATTGTCCTCATGTAGAATATGTAGTTGATAAAAGTT
TTGACAAGTATCGCAATGAATCCCAGGAGAAATCGTATTGCAATTGCAAT
GGGAATGAACTCGAACACATTCAGAATAACTTACCGCACATGTTTCAATT
GAAAGAATCAGAAAATTCAGATATTGGAGTTTGGACGAAGCAACTATTAT
TACAGGGCACGGTCATTGGCCCATATCTCGGGAAGATTATTGAAAATTCT
GAACAGGAAAACCTTATGTCCAAGCCATATTTTACGCGCGGCTGTTCCCA
ATCTGGTTTAACTGGCGATCTTCACTGTCTTCAATTTGCATTTAAATCCA
ATTGGTTACGATGCGTCCGCTTTACGGATAACTATGATAAAGCTAATCTC
AAAATTTACCAATATGATGCGAAAATATTTTTTCAGGCCATTCAAGATAT
CAGCTCACATTCAGAATTATTACTCTTCAATGAACCTCATTTGCGCATTG
CTAGTACTGCAAACGGGTTTCCTAGCCTATTATTCCCCACTCTCGACATC
CAAAACGTGTCATTCGAGGATCGGGCCAATCAGGACGCATTAATTATGAA
AATTAGAAAACTCTACTTGGAGAACAGTCGCCTAACTGTAGTGGATATTA
TCGGGCTTCTGAGATGCGAGCATCCAGACCTGAATGATCTCAATGAGAAT
GAATTGGCAGAAATGATCGACCAATTGAGGCCGGGCTCCGCTTCCCGAGA
CCGTACAAAGATTGATGATAAAATAACCGAATTCATCACCAAGCTGCTGC
GCGATTGCCCGCAGATCACATCCACTGAAATCATTCCTTTGATTGAGAAG
CGATTTCCCAACGTTCCAAGGCTTAGCAAGGACAGTATCAATAGGCTAAT
TCGTATCCGTGGACTGCGGCCTCTGTTGGGAATCGATGATAAAGCTGACC
TGGAGACCGTTCAATCAATTGTCAGCATGGTTACCAGGGATACGGCATTG
TCGGTGAAAGATGTCCAGCAGATGTTACAGGCGCAATTTCCATCGAAACC
TGAACTCGACTGCAAATCGATTGAAAATGTCATCAAGATCAATTTCTGTC
GACTCCACGGCTCGAAATTCAGACAGGGATCTAAACGTCAAGTGGATCAA
GAAGTTCTGAAAGAAATCAGAAAACTAGTCTACCGCTACGACTGTACTAT
AACGAGACTGGAAATACTCGAGAAACTCAAAGAGCAATTACCGGAAAACC
GGAACATTAACATCGACTACATCAGATATTTGATGAGAAAATTTGGAATT
AAAGTGAAACCGCCACAGTTCCAAAGTGCAAAAGGGATCAAACCGATAAT
TTATTGATTGCGCATCCATAATCGATAGAGTGCCACTCAACAGATCAGTA
GCCTTCTGAAATCGATAAAGTCCAACAAACCATCAATTTGTCTGCAAGCG
GTATCAAATCTAATTCGATATTGCACGTTGCCTAAGATCGTGAATTTTAA
ATGTCTCCGTATTTTTTGCCCTTTGTTATGTTTATATTTACTATTTATTT
GAATATAAATTGACTGCATTTAAAAAAAA
back to top

protein sequence of SMED30011575-orf-1

>SMED30011575-orf-1 ID=SMED30011575-orf-1|Name=SMED30011575-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=868bp
MMLLLDDDANCSKIDNNKPVETGKISELFPIKPVVCKFFKPKLKGSNHSY
MGGGNRSSKIQLEEICITSKHPKSQSRSQQNFMNGEGLMQTEIPYQYFSS
TDSSSFSNLPSISVECSKTSESFSDSDNQDPDESGVTTLIVKNVYSLCRT
NQSKNEETNLSNLSNECCRSCNNKITVTKKSKRKKSHLSKRKSKTKFIEK
FSLLVEDKEKPDLNVSDSELSDTPTEAMTLDINDFDLPTHGNKSNLEQPV
HGNKLNLDRSASLKKSSLGLPVHGNKSNLDLSASLKKSSLGLPVHGKKSN
LDLSAYGNKLNLDLMQPVVLLDRFEPERIAPHLFPDHETLRLTINLKSKS
LVARSTEKSSSFLPNSNETTIKIRKSSLSAANKTNHNSIENDILYCLVCN
QSNNTACCNHPVKWIPNAHIDCPHVEYVVDKSFDKYRNESQEKSYCNCNG
NELEHIQNNLPHMFQLKESENSDIGVWTKQLLLQGTVIGPYLGKIIENSE
QENLMSKPYFTRGCSQSGLTGDLHCLQFAFKSNWLRCVRFTDNYDKANLK
IYQYDAKIFFQAIQDISSHSELLLFNEPHLRIASTANGFPSLLFPTLDIQ
NVSFEDRANQDALIMKIRKLYLENSRLTVVDIIGLLRCEHPDLNDLNENE
LAEMIDQLRPGSASRDRTKIDDKITEFITKLLRDCPQITSTEIIPLIEKR
FPNVPRLSKDSINRLIRIRGLRPLLGIDDKADLETVQSIVSMVTRDTALS
VKDVQQMLQAQFPSKPELDCKSIENVIKINFCRLHGSKFRQGSKRQVDQE
VLKEIRKLVYRYDCTITRLEILEKLKEQLPENRNINIDYIRYLMRKFGIK
VKPPQFQSAKGIKPIIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001701in utero embryonic development
GO:0001763morphogenesis of a branching structure
GO:0001892embryonic placenta development
GO:0001893maternal placenta development
GO:0002250adaptive immune response
GO:0002376immune system process
GO:0003170heart valve development
GO:0003279cardiac septum development
GO:0003281ventricular septum development
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007281germ cell development
GO:0009791post-embryonic development
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0030889negative regulation of B cell proliferation
GO:0031665negative regulation of lipopolysaccharide-mediated signaling pathway
GO:0032259methylation
GO:0032823regulation of natural killer cell differentiation
GO:0033082regulation of extrathymic T cell differentiation
GO:0035904aorta development
GO:0042127regulation of cell proliferation
GO:0042462eye photoreceptor cell development
GO:0045087innate immune response
GO:0045165cell fate commitment
GO:0045579positive regulation of B cell differentiation
GO:0048844artery morphogenesis
GO:0048869cellular developmental process
GO:0051136regulation of NK T cell differentiation
GO:0060576intestinal epithelial cell development
GO:0060707trophoblast giant cell differentiation
GO:0060976coronary vasculature development
GO:1990654sebum secreting cell proliferation
Vocabulary: molecular function
TermDefinition
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0042826histone deacetylase binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
GO:1990841promoter-specific chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 365..561
e-value: 9.4E-26
score: 92.5
NoneNo IPR availablePANTHERPTHR16515:SF38SET (TRITHORAX/POLYCOMB) DOMAIN CONTAININGcoord: 327..553
NoneNo IPR availablePANTHERPTHR16515FAMILY NOT NAMEDcoord: 327..553
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 372..551