SMED30011554

Overview
NameSMED30011554
Smed IDSMED30011554
Length (bp)2416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011554 (SMED30011554) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011554 (SMED30011554) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30011554 (SMED30011554) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30011554 (SMED30011554) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30011554 vs. Ensembl Celegans
Match: K09F6.5 (pep chromosome:WBcel235:II:2272062:2273384:-1 gene:WBGene00019588.1 transcript:K09F6.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K09F6.5)

HSP 1 Score: 56.9954 bits (136), Expect = 3.511e-8
Identity = 40/150 (26.67%), Postives = 70/150 (46.67%), Query Frame = 1
Query: 1732 EFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVI-------PNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDD-----RKKWIK--GSKLFTMCSSLQLDFMDQPKYLLPGVNVHI 2139
            EF +  S   YL+L  T L     + D++   +  P+ +        P N + H++ K+  L  N+      +S Y +KA  E  + Y  + KN+ LT  GY  +D+      K ++   G+    + +++ LD M+QP+ LL   NV +
Sbjct:   50 EFVLGNSSRSYLNLKRTYLVYTFNITDQNGAIVNIPNPITKDSLVYAPINNIAHSIVKNFSLHINSRLAYHNSSNYAYKAYFENALMYGKEIKNSTLTAAGYFHEDEIGSPTSKGFLNRCGTGTTQVAANISLDLMNQPRVLLNSCNVKL 199          
BLAST of SMED30011554 vs. Ensembl Celegans
Match: F54H12.2 (pep chromosome:WBcel235:III:7964581:7965840:1 gene:WBGene00018842.1 transcript:F54H12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F54H12.2)

HSP 1 Score: 55.4546 bits (132), Expect = 8.844e-8
Identity = 39/150 (26.00%), Postives = 70/150 (46.67%), Query Frame = 1
Query: 1732 EFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVI-------PNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDD-----RKKWIK--GSKLFTMCSSLQLDFMDQPKYLLPGVNVHI 2139
            EF +  +   YL+L  T L     + D++   +  P+ +        P N + H++ K+  L  N+      +S Y +KA  E  + Y  + KN+ LT  GY  +D+      K ++   G+    + +++ LD M+QP+ LL   NV +
Sbjct:   29 EFVLGNNSRSYLNLKRTYLVYTFNITDQNGAIVNIPNPITKDSLVYAPINNIAHSIVKNFSLHINSQLAYHNSSNYAYKAYFENALMYGKEIKNSTLTAAGYFHEDEIGTPTSKGFLNRCGTGTTQVAANISLDLMNQPRVLLNSCNVKL 178          
BLAST of SMED30011554 vs. Ensembl Celegans
Match: Y57G11C.20 (pep chromosome:WBcel235:IV:14843362:14845311:1 gene:WBGene00013315.1 transcript:Y57G11C.20.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.20)

HSP 1 Score: 50.447 bits (119), Expect = 5.344e-6
Identity = 46/136 (33.82%), Postives = 72/136 (52.94%), Query Frame = 1
Query:  850 KDGICKFS-LNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKL 1254
            KDG      L++NI    F+K+ A  LG      R S+    K         +++Y +I+DPIIVGDS   LL SV   K    E+++  I +P YLP+  S I++I+I +  +  + I F+  + T + LHF+K+
Sbjct:  516 KDGRVSIDFLDSNILFEEFEKSCAYFLGFHDTIVRESSLAPSKIDYFGNVSTIYLYCDIVDPIIVGDSKNSLL-SVIPCKGKYGEMIHHTIPHPRYLPIMNSTIDSIKIELLSEFAEPINFNWGS-TVIVLHFKKI 649          
BLAST of SMED30011554 vs. UniProt/SwissProt
Match: sp|P34456|YMD2_CAEEL (Uncharacterized protein F54H12.2 OS=Caenorhabditis elegans OX=6239 GN=F54H12.2 PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.125e-6
Identity = 39/150 (26.00%), Postives = 70/150 (46.67%), Query Frame = 1
Query: 1732 EFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVI-------PNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDD-----RKKWIK--GSKLFTMCSSLQLDFMDQPKYLLPGVNVHI 2139
            EF +  +   YL+L  T L     + D++   +  P+ +        P N + H++ K+  L  N+      +S Y +KA  E  + Y  + KN+ LT  GY  +D+      K ++   G+    + +++ LD M+QP+ LL   NV +
Sbjct:   29 EFVLGNNSRSYLNLKRTYLVYTFNITDQNGAIVNIPNPITKDSLVYAPINNIAHSIVKNFSLHINSQLAYHNSSNYAYKAYFENALMYGKEIKNSTLTAAGYFHEDEIGTPTSKGFLNRCGTGTTQVAANISLDLMNQPRVLLNSCNVKL 178          
BLAST of SMED30011554 vs. TrEMBL
Match: A0A3C1P7N7 (Uncharacterized protein (Fragment) OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02400 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.084e-44
Identity = 87/189 (46.03%), Postives = 120/189 (63.49%), Query Frame = 1
Query: 1612 ICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGY-GSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLT 2175
            + GK+EL +FD   PQ VIE G FEDV+P  +     T IEF +  S  +YLDLNDTLL++Q+KVV  D   L +    +P+++  H+LF D  L  N+  IEGG+  Y +KA+IE+ +N+NS+TK T L   G+  +   RK W+  SK+  M   L+LDF++QPKYLLPGV V I L ++ S  SLT
Sbjct:    1 MSGKTELKIFDDHPPQVVIEAGYFEDVYPKAAT--ESTTIEFEVPSSNVDYLDLNDTLLSLQVKVVKADGTALTDKDKPVPSDYFMHSLFSDVSLALNDTTIEGGSGIYPYKAVIESELNFNSETKQTQLAMAGHEPAVLKRKAWVALSKVLEMIGPLRLDFLNQPKYLLPGVKVRIILTKANSNFSLT 187          
BLAST of SMED30011554 vs. TrEMBL
Match: W4ZG02 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.246e-29
Identity = 85/230 (36.96%), Postives = 125/230 (54.35%), Query Frame = 1
Query: 1615 CGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGY-----GSDDD---------------RKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSL-TSVTTAPI-LQLVDAKLLVRRVR 2238
            C KSE  LF  P  Q  +E G + + FP+ +I D+ T I+F++ GS  EY DL+ TL+ +Q+KVV+ D  PL E + V P N   H+LF D  L  N+  I    +TY ++A +ET++ Y  + K + LT   +     G  DD               R ++IKGSK   M   L LD + Q K LL GV++ ++L RS+++ SL +SV  A   + +  A L VRRV+
Sbjct:   11 CSKSETDLFSIPPTQTTVEKGKWVEFFPLTNISDT-TPIQFHLQGSTEEYTDLSQTLIHLQVKVVNGDGTPLAEDAQVGPTNMFLHSLFSDVDLMLNDRLITPSTNTYAYRAALETLLTYGPEAKESQLTSALFYKDTPGHMDDGNPLREDAGNMGLKERHRFIKGSKTVDMVGLLHLDMVFQDKLLLGGVDIKLKLNRSKNSFSLMSSVQNAEYKVIITSASLHVRRVK 239          
BLAST of SMED30011554 vs. TrEMBL
Match: W4YCC1 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.618e-27
Identity = 80/230 (34.78%), Postives = 125/230 (54.35%), Query Frame = 1
Query: 1615 CGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGY-----GSDDD---------------RKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSL-TSVTTAPILQLV-DAKLLVRRVR 2238
            C KSE+ LF  P  Q  +E G + + FP+ +I D+   I+F++ GS  EY DL+ +L+ +Q KVV+ D  PL + + V P N   H+LF D  L  N+  I    +TY ++A +ET++ Y ++ K + L+   +     G  DD               R ++IKGS +  M   L LD + Q + LL GV++ ++L RS+++ SL +SV  A    L+  A L VRRV+
Sbjct:   11 CSKSEIDLFSIPPTQTTVEKGKWVEFFPLTNISDT-APIQFHLQGSTEEYTDLSQSLIHLQAKVVNGDGTPLADDAQVGPTNMFLHSLFSDVDLMLNDRLITPSTNTYAYRAALETLLTYGAEAKESQLSSALFYKDTAGHMDDGNPLRNDDGNMGLKERHRFIKGSNIVDMVGVLHLDMVFQDRLLLGGVDIKLKLNRSKNSFSLMSSVENANYKVLITSASLHVRRVK 239          
BLAST of SMED30011554 vs. TrEMBL
Match: A0A4Y2TVH4 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_94531_1 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.050e-27
Identity = 75/227 (33.04%), Postives = 114/227 (50.22%), Query Frame = 1
Query: 1612 ICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDD-----------------DRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPI-LQLVDAKLLVRRVR 2238
            IC KSEL LF  PS QA IE G F + FP+++I D  + +EF+I+GS  EYLDL D+ + V+ K+   D  PL +   V P N   H+LF    +  N+  I   ++TY ++A +ET++NY  D K + L+   +  DD                  R + +  S+   M   L  D   Q + +L  V + I++ RS+    L S   +   + L  A L VR+V+
Sbjct:   11 ICVKSELDLFSIPSTQAAIEFGKFVEYFPLSNIRDG-SPVEFHISGSGDEYLDLADSYIHVKAKITKSDGAPLPDNEPVAPVNLFLHSLFSQVGVSLNDRIISSASNTYPYRAYLETLLNYGEDAKKSLLSCEAFFKDDKPYQVDPVSEEACESLKKRYQLMANSRTLDMIGQLHCDIFQQNRLMLNLVEMKIKMIRSKPNFCLLSTNNSEYNVVLEHASLFVRKVK 236          
BLAST of SMED30011554 vs. TrEMBL
Match: A0A4Y2UAH2 (Uncharacterized protein F54H12.2 OS=Araneus ventricosus OX=182803 GN=F54H12.2_85 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 8.559e-27
Identity = 76/227 (33.48%), Postives = 117/227 (51.54%), Query Frame = 1
Query: 1612 ICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDD-----------------RKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPI-LQLVDAKLLVRRVR 2238
            IC KSEL LF  PS QA IE G F + FP+++I D  + +EF+I+GS  EYLDL D+ + V+ K+   DR PL +   V P N   H+LF    +  N+  I   ++TY ++A +ET++NY  D K + L+   +  DD+                 R + +  S+   M   L  D   Q + +L  V++ I++ RS+    L S   +   + L  A L VR+V+
Sbjct:   11 ICVKSELDLFSIPSTQAAIEFGKFVEYFPLSNIRDG-SPVEFHISGSGDEYLDLADSYIHVKAKITKSDRAPLPDNEPVAPVNLFLHSLFSRVDVSLNDRIISSASNTYPYRAYLETLLNYGEDAKKSLLSCEAFFKDDNPYQVDPVSEEACESLKKRYQLMANSRTLDMIGQLHCDIFQQNRLMLNLVDMKIKMIRSKPNFCLLSTNNSEYNVVLEHASLFVRKVK 236          
BLAST of SMED30011554 vs. Ensembl Nematostella
Match: EDO39053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB46])

HSP 1 Score: 55.0694 bits (131), Expect = 8.076e-8
Identity = 52/230 (22.61%), Postives = 89/230 (38.70%), Query Frame = 1
Query: 1612 ICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCL--------TPMGYGSDD------------DRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLLVRRVRS 2241
            +C    + LF  P+    + MG +    P  +I  +R  I FYI     +Y+ L  T L   +++   D   LG    V   NF    L K   L  N   +     T  ++  +  + +Y    ++T L        TP    S D            +R  +      F +   L  +     +YL  GV++ ++L  +  A  L S     I+++VDA+L +  V++
Sbjct:    9 VCANQGIDLFSVPNTDRTLAMGKWNHYAPAETI--TRDKILFYIPAGG-DYIALEKTQLHFTVQIRKPDGTTLGADQKVGFVNFPLAALIKQVTLHLNGTLVCSQTDTSAYRGYVGALTSYTQQAQDTALSAGLWARDTPGAMESYDVMTATGPNRGFVERATYTPLWVNFGLHGVLHTELFQSDRYLPDGVSIKLKLDLNPDAFVLMSENQNEIVRIVDAQLSLFHVKA 235          
BLAST of SMED30011554 vs. Planmine SMEST
Match: SMESG000017989.1 (SMESG000017989.1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 335/351 (95.44%), Postives = 342/351 (97.44%), Query Frame = 1
Query:  196 MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFR 1248
            M WISK +MDI KR +K++FY ILPSN+CP IHP+NQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKI +KKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVD HDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHF 
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKISYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDTHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFH 351          

HSP 2 Score: 297.745 bits (761), Expect = 1.593e-85
Identity = 159/179 (88.83%), Postives = 160/179 (89.39%), Query Frame = 1
Query: 1756 TEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLLVRRVRSLFQ*P*KCLMSHGLCLN 2292
            T +  LNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSES LSLTS TT PILQLVDAKLLVRRVR         L  H L LN
Sbjct:  347 TLHFHLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESTLSLTSATTTPILQLVDAKLLVRRVRVELS----VLAGHQLGLN 521          
BLAST of SMED30011554 vs. Planmine SMEST
Match: SMESG000048922.1 (SMESG000048922.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 331/353 (93.77%), Postives = 344/353 (97.45%), Query Frame = 1
Query:  196 MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKL 1254
            M WISK +MDI KR +K++FY ILPSN+CP IHP+NQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIG+KKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKF+SIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTI+NIKIS+SYINEVE+TFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDG+CKFSLNNNICE+TFDKNLANTLGLDKQTYR SAFGV KPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFR L
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFKSIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIKNIKISLSYINEVEETFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGLCKFSLNNNICEITFDKNLANTLGLDKQTYRTSAFGVHKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRWL 353          

HSP 2 Score: 432.18 bits (1110), Expect = 0.000e+0
Identity = 209/213 (98.12%), Postives = 211/213 (99.06%), Query Frame = 1
Query: 1588 TWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLLV 2226
            TWNYISKMICGKSELCLFDRPSPQAVIEMG FE+VFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRS+SALSLTS TTAPILQLVDAKLLV
Sbjct:  428 TWNYISKMICGKSELCLFDRPSPQAVIEMGVFEEVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSDSALSLTSATTAPILQLVDAKLLV 640          

HSP 3 Score: 125.946 bits (315), Expect = 0.000e+0
Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 2
Query: 1346 WLRTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 1525
            WLRTIGRFALPILKRLGSFGMKT+KDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ
Sbjct:  352 WLRTIGRFALPILKRLGSFGMKTSKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 411          
BLAST of SMED30011554 vs. Planmine SMEST
Match: SMESG000076652.1 (SMESG000076652.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 319/358 (89.11%), Postives = 331/358 (92.46%), Query Frame = 1
Query:  196 MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKLDGQ*R 1269
            M WISK +MDI KR +K++FY ILPSN+CP IHP+NQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFY+HCKI +KKRVPKTCSGIFSINNFERYCHIPNQILDEN GMFFKDGLN                DAKRMGCDKLSIVVPGT+YLIRFKTFDEKSVTIENIKISVSYINEVE+TFTFTN+LYIETLEELHKYIS NCLHIFKTIEF+KDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKLDG  R
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYNHCKISYKKRVPKTCSGIFSINNFERYCHIPNQILDENSGMFFKDGLN----------------DAKRMGCDKLSIVVPGTDYLIRFKTFDEKSVTIENIKISVSYINEVEETFTFTNELYIETLEELHKYISLNCLHIFKTIEFLKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKLDGWLR 342          

HSP 2 Score: 436.417 bits (1121), Expect = 0.000e+0
Identity = 218/237 (91.98%), Postives = 219/237 (92.41%), Query Frame = 1
Query: 1582 ERTWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLLVRRVRSLFQ*P*KCLMSHGLCLN 2292
            ER WNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRK LGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLL  VNVHIRLKRS+SALSLTS TTAPILQLVDAKLLVRRVR         L  H L LN
Sbjct:  417 ERAWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKLLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLLCVNVHIRLKRSDSALSLTSATTAPILQLVDAKLLVRRVRV----EPSVLAGHQLGLN 649          

HSP 3 Score: 131.724 bits (330), Expect = 0.000e+0
Identity = 64/67 (95.52%), Postives = 65/67 (97.01%), Query Frame = 2
Query: 1343 GWLRTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQEPAPAQ 1543
            GWLRTIGRFALPILKR+GSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQK E APAQ
Sbjct:  339 GWLRTIGRFALPILKRIGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKPE-APAQ 404          
BLAST of SMED30011554 vs. Planmine SMEST
Match: SMESG000048922.1 (SMESG000048922.1)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 312/333 (93.69%), Postives = 325/333 (97.60%), Query Frame = 1
Query:  196 MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG 1194
            M WISK +MDI KR +K++FY ILPSN+CP IHP+NQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIG+KKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKF+SIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTI+NIKIS+SYINEVE+TFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDG+CKFSLNNNICE+TFDKNLANTLGLDKQTYR SAFGV KPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFKSIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIKNIKISLSYINEVEETFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGLCKFSLNNNICEITFDKNLANTLGLDKQTYRTSAFGVHKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG 333          

HSP 2 Score: 431.024 bits (1107), Expect = 1.189e-152
Identity = 209/216 (96.76%), Postives = 213/216 (98.61%), Query Frame = 1
Query: 1579 NERTWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLLV 2226
            ++ TWNYISKMICGKSELCLFDRPSPQAVIEMG FE+VFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRS+SALSLTS TTAPILQLVDAKLLV
Sbjct:  407 SKTTWNYISKMICGKSELCLFDRPSPQAVIEMGVFEEVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSDSALSLTSATTAPILQLVDAKLLV 622          

HSP 3 Score: 129.798 bits (325), Expect = 1.189e-152
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 2
Query: 1340 SGWLRTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 1525
            SGWLRTIGRFALPILKRLGSFGMKT+KDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ
Sbjct:  332 SGWLRTIGRFALPILKRLGSFGMKTSKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 393          
BLAST of SMED30011554 vs. Planmine SMEST
Match: SMESG000057427.1 (SMESG000057427.1)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 306/333 (91.89%), Postives = 319/333 (95.80%), Query Frame = 1
Query:  196 MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG 1194
            M WISK +MDI KR +K++FY ILP N+CP IHP+NQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIG+KKRVPKTCSGIF+INNFERYCHIPNQILDEN GMFFKDGL VSCD+SPFTIKFESIEDAKR+  DKL+IVVPGTEYLIRFK FDEKSVTIENIKISVSYINEVEDTF FTNDLYIETLEELHKYISFNCLHIFKTIEF+KDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGV KPKIIKLH+QMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPINSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIFTINNFERYCHIPNQILDENSGMFFKDGLIVSCDFSPFTIKFESIEDAKRIDSDKLNIVVPGTEYLIRFKKFDEKSVTIENIKISVSYINEVEDTFKFTNDLYIETLEELHKYISFNCLHIFKTIEFLKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAFGVLKPKIIKLHKQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSG 333          

HSP 2 Score: 323.553 bits (828), Expect = 7.110e-94
Identity = 158/163 (96.93%), Postives = 160/163 (98.16%), Query Frame = 1
Query: 1735 FYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLVDAKLL 2223
            FYINGSQTEYLDLND LLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSD DRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRS+SALSLTS +TAPILQLVDAKLL
Sbjct:  407 FYINGSQTEYLDLNDKLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDGDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSDSALSLTSTSTAPILQLVDAKLL 569          

HSP 3 Score: 140.584 bits (353), Expect = 1.082e-33
Identity = 66/68 (97.06%), Postives = 67/68 (98.53%), Query Frame = 2
Query: 1340 SGWLRTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQEPAPAQ 1543
            SGWL+TIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVA MFQKQEPAPAQ
Sbjct:  332 SGWLKTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVADMFQKQEPAPAQ 399          
The following BLAST results are available for this feature:
BLAST of SMED30011554 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
K09F6.53.511e-826.67pep chromosome:WBcel235:II:2272062:2273384:-1 gene... [more]
F54H12.28.844e-826.00pep chromosome:WBcel235:III:7964581:7965840:1 gene... [more]
Y57G11C.205.344e-633.82pep chromosome:WBcel235:IV:14843362:14845311:1 gen... [more]
back to top
BLAST of SMED30011554 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P34456|YMD2_CAEEL1.125e-626.00Uncharacterized protein F54H12.2 OS=Caenorhabditis... [more]
back to top
BLAST of SMED30011554 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3C1P7N78.084e-4446.03Uncharacterized protein (Fragment) OS=Planktothrix... [more]
W4ZG021.246e-2936.96Uncharacterized protein OS=Strongylocentrotus purp... [more]
W4YCC11.618e-2734.78Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A4Y2TVH45.050e-2733.04Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2UAH28.559e-2733.48Uncharacterized protein F54H12.2 OS=Araneus ventri... [more]
back to top
BLAST of SMED30011554 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO390538.076e-822.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30011554 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011554 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017989.11.593e-8595.44SMESG000017989.1[more]
SMESG000048922.10.000e+093.77SMESG000048922.1[more]
SMESG000076652.10.000e+089.11SMESG000076652.1[more]
SMESG000048922.11.189e-15293.69SMESG000048922.1[more]
SMESG000057427.17.110e-9491.89SMESG000057427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011554 ID=SMED30011554|Name=SMED30011554|organism=Schmidtea mediterranea sexual|type=transcript|length=2416bp
TTGATACAAATTGGAGTGACAAAGTCTTTATCATTTCAAAATAAATGTTA
AACAAAGTCCAGTCATGTACGTCATTAAAGATTATGCTAATAATGAATTA
GGTGGTAAATTTTATGAACAAGAATTACAAGTATTTAGAATTCACAAAAT
ATTGAAAACTAAAATGATCGGTAAGGATAAATAATACTATGTCAAATGGT
TTGGATATCAAAACCCATCATGGATATCAGGAAAAGATCTAATAAAATAA
ATTTCTATATAATTTTACCTAGTAATACTTGTCCGACAATACATCCAGAT
AATCAAGCAAGTAAATTCATGGTTGACCTTCAAAATCCAATTTATTTACA
TGGAAATTGGGAAGTTGCTTTGCAAGACTTTACATTTGTGTACAATACAT
TCCCATTTTATAGTCATTGTAAAATCGGATTCAAGAAACGTGTACCCAAA
ACCTGTAGTGGTATTTTCTCAATCAATAATTTTGAACGATATTGTCATAT
TCCGAATCAGATTTTAGATGAAAATTGTGGCATGTTTTTCAAAGATGGAT
TGAATGTTAGTTGTGATTATAGTCCATTTACAATAAAGTTTGAAAGTATT
GAGGATGCCAAGCGAATGGGTTGTGATAAGCTTAGCATTGTTGTTCCTGG
TACTGAATACCTAATACGTTTCAAAACATTTGATGAGAAAAGTGTAACAA
TCGAAAACATCAAAATATCTGTATCATATATTAATGAGGTGGAAGATACA
TTTACATTTACTAATGATTTATATATTGAAACACTTGAAGAATTACATAA
ATATATTTCATTCAATTGTTTACATATATTTAAAACTATTGAATTTGTTA
AAGATGGAATATGTAAATTCAGTCTGAATAATAACATTTGTGAAGTTACA
TTTGATAAAAATTTGGCTAATACATTGGGATTAGATAAGCAAACATATAG
GGCAAGTGCTTTTGGTGTACGCAAACCAAAAATAATAAAACTTCATAGGC
AAATGTTCATATATACTAACATCATCGATCCTATAATTGTTGGTGATTCT
TTGGTTCCTCTATTGAAATCTGTTTGGGTTGATAAACATGACCAGGATGA
AGTTGTCAATATAAATATCGATAATCCCATGTACTTACCGGTATCAACAT
CATGTATAAACAATATAGAAATAAATATTCGTGATGATAGCGGTAAATTT
ATTGAATTTAGTAAAGATACAAAAACTCATTTGACATTACATTTTCGTAA
ATTAGATGGCCAATAACGATATTATTAGTATGTATAGTGGTAGCCAAAGT
GGTGGCGAATTACCATATTTTATTGGTAAACAGTATGGATCAGGTTGGTT
GAGAACAATTGGTAGATTTGCACTTCCTATTCTTAAACGCCTTGGTAGTT
TTGGTATGAAAACTGCTAAAGATGTGATAATGAATGAGCAGAAAATATTA
CCATCTCTGAAATCAAATGCATTATCCGAGTTAGGGAAAGTTCTACCAAG
TGTGGCAGGTATGTTTCAAAAACAAGAACCTGCACCGGCTCAAAAACGTA
AAAGACATCATAAACATATAAACAAACGAATGAAAGGACATGGAACTATA
TTTCAAAAATGATTTGTGGTAAATCTGAATTGTGTTTATTTGATAGACCA
TCTCCCCAAGCAGTAATTGAAATGGGGGCCTTTGAAGATGTATTCCCGAT
GAATTCTATTATGGATAGTAGAACTGATATTGAATTTTATATTAATGGTT
CCCAAACTGAATATCTAGATTTGAACGATACATTGTTAACTGTTCAGATC
AAAGTTGTAGATAAAGATAGAAAACCGTTGGGTGAACCTAGTGATGTAAT
ACCAAACAATTTCTTGTTTCATACACTTTTTAAAGATGCAGTTCTCGGAT
TTAATAATATCAAGATTGAGGGTGGTAACAGTACATATATTCACAAAGCT
CTAATAGAAACTATTATAAATTACAATAGCGATACTAAAAATACATGTTT
AACTCCTATGGGTTATGGTAGTGATGACGATAGGAAAAAGTGGATTAAGG
GTTCGAAATTATTTACCATGTGCTCATCATTACAACTCGATTTTATGGAT
CAACCGAAATATTTACTCCCAGGTGTTAATGTACACATTAGATTGAAAAG
ATCAGAGTCGGCATTATCACTAACAAGTGTTACCACAGCACCAATTCTTC
AATTAGTTGATGCAAAATTATTGGTGAGAAGAGTTCGGTCTTTGTTTCAA
TGACCTTGAAAGTGTTTGATGAGTCATGGTCTTTGTTTAAATTACCTTTA
CCAGCTGTTGATGACTCATTGTCTTTGTTACAATGACCTTGAATGAGTCA
TAGTCTTTCTTTAAATGACCTTGAAAATTTGACGAGTCATACAATGACCT
TGAATGAGTCATGGGC
back to top

protein sequence of SMED30011554-orf-1

>SMED30011554-orf-1 ID=SMED30011554-orf-1|Name=SMED30011554-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MVWISKPIMDIRKRSNKINFYIILPSNTCPTIHPDNQASKFMVDLQNPIY
LHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGIFSINNFERYC
HIPNQILDENCGMFFKDGLNVSCDYSPFTIKFESIEDAKRMGCDKLSIVV
PGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEEL
HKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQT
YRASAFGVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQ
DEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHF
RKLDGQ*
back to top

protein sequence of SMED30011554-orf-2

>SMED30011554-orf-2 ID=SMED30011554-orf-2|Name=SMED30011554-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MANNDIISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKRLGSFG
MKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQEPAPAQKRKR
HHKHINKRMKGHGTIFQK*
back to top

protein sequence of SMED30011554-orf-3

>SMED30011554-orf-3 ID=SMED30011554-orf-3|Name=SMED30011554-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQT
EYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNN
IKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSK
LFTMCSSLQLDFMDQPKYLLPGVNVHIRLKRSESALSLTSVTTAPILQLV
DAKLLVRRVRSLFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ