DNA_pol_B_2 domain-containing protein

Overview
NameDNA_pol_B_2 domain-containing protein
Smed IDSMED30011549
Length (bp)2030
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA_pol_B_2 domain-containing protein (SMED30011549) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA_pol_B_2 domain-containing protein (SMED30011549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA_pol_B_2 domain-containing protein (SMED30011549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA_pol_B_2 domain-containing protein (SMED30011549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Match: ZC53.4 (pep chromosome:WBcel235:X:1925750:1937689:1 gene:WBGene00022511.1 transcript:ZC53.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC53.4)

HSP 1 Score: 142.124 bits (357), Expect = 1.059e-34
Identity = 127/478 (26.57%), Postives = 210/478 (43.93%), Query Frame = 1
Query:  679 HITPPFVIYADFESVL---------PPDDRHHQIHMPIAAG--LLLINNYT----NTKSYYYFYGLDCIPDFLKKIEEIATEIV-IPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHIL------KYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGL-------TFVNKHHVASSEDTE----LLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFLPY---------GYTMEVDINIPERVHQYLNDFPLAPE 1986
             +   ++IYADFES++         P +     +   +A+   +++++++T    N KSY    G +   +F K I +I+ EI+ +P    +         F++ ++   C+  Y  +      VRDH H+TG Y G  C  CNI RR    +P+ FHNL+GYD H I+      KY  +      ++ I ++TEKFIS                                   + +  Q  ++  KG++PY +  S +  + T +LP       +  YD+       + C+                +AD F+ FRA ++    L+P  ++  PG++W + L      ++ L D+EM+   E GIRGG+       + VN  +  +  + +    LLY+D NNLYGWA+ Q LP GDF +   +L  +L+       +   Y         G   EVD+  P+ +H   ND PL PE
Sbjct:  871 RVKHRYIIYADFESIIWKFSNAHYKPNESWTMDVGEHVASRFCVVVVDSFTKKIHNMKSYI---GYNATLEFNKYIIKISQEIMSLPSVRMKKLTQDEWTEFNKNQECPHCQVQYNTEDMKTTKVRDHDHWTGEYRGPFCGSCNILRRKNNFIPVFFHNLKGYDSHLIVGCLESTKYLNEH--EIEIEKISSNTEKFISF----------------------------------SYNPHQFQLMRKKGVYPYEYMDSFKRFDKT-KLPN-----RDKFYDK----LNNKKCKRKG-------------IADVFENFRALSLRVYQLDPCWYFTSPGLAWDAMLKKTKVELDKLHDVEMYLMIEKGIRGGIVNAVKRYSKVNNKYTKNFNEKQLTNFLLYLDANNLYGWAMCQMLPTGDFKFETQSLISILNGEAEVKSDLKDYINYLKKLDRGCIFEVDLEYPKEIHSRHNDSPLCPE 1286          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A267DRN2 (DNA_pol_B_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020163g6 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 3.544e-81
Identity = 187/585 (31.97%), Postives = 287/585 (49.06%), Query Frame = 1
Query:  439 ENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKN--LEFLNYSKHITPPFVIYADFESVLPP--DDRHHQI-------HMPIAAGLLLINNYTNT--------KSYYYFYGLD---CIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVR---DHCHFTGNYLGAACRKCNIARRIYR-LLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHIN-------------KLAVRFIDSMQFVNCSLAKAVKTLTSLP------LTSSVF---QGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEG---------VSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVA------------SSED------------TELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFL-PYGYTMEVDINIPER 1947
            E+    H+ AV++IN L+N           R +WC  CL  F  D AF  H     +         LP+ +N  L F ++ K I+PPFV+YADFE++  P  +D    I       H+ +AAG ++++    T             F   D   CI DFL+ +E++A E+    +++E  +     +    RQF+    C  C            DH H +G + GAAC  CN+  R+ R  LP+VFHN +GYDLH ++   L     W + +IP + E+F+S+ +                   ++FIDS QF+N SL++ +K L          L SS F      ++  KG+FPY++  + +VL+    + P  E           +  +Y+ AQ  W +     L++YML YL+LD+  LAD F+ FR  ++  +GL+P++F   PG+S+ASAL ++   IELL D +M++ +E GIRGG++FVN H V             S+ED            TELL +D NNLYG AL+ NLP G F W+ D+   + +E     ++   P  Y  +VD+  P+R
Sbjct:   16 EDEASGHWCAVSSINRLLNSKAALH-----RRKWCERCLLPFHSDAAFEEHSRAPCQPGVINVKEELPDERNNILRFSSWEKTISPPFVVYADFEALNAPCQEDSIAGIATKKLTEHIAVAAGYIVLHREGMTGLAPRGADDKVSTFVSDDPNKCISDFLQSLEKLAREVY--GWNTEFSRQAAIRTEMAGRQFREATACCYCGSEFTEGSNKHWDHDHLSGEFRGAACADCNMKARLKRSFLPVVFHNFKGYDLHLMMSSALGLMEGWKISVIPLNPEQFLSMKIEFKIGEYESEGKIKPLNFTIQFIDSNQFLNASLSQLIKNLPEAECRITSRLRSSRFPLLSSEVLFSKGVFPYDYLKNSDVLKDA--VLPSQESFYNALTKSHCTNSDYEHAQRAWREFQVSNLKEYMLCYLELDIRQLADIFENFRKISMQEDGLDPVHFISTPGLSFASALKSIKSGIELLTDAQMYSLFERGIRGGMSFVNIHKVQATSAAGASTGVDSNEDVDGGTPTIHAGLTELLAVDANNLYGQALTMNLPVGGFRWLDDDELLLWTEDRIRGLKLTDPLAYLFDVDLEYPQR 591          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: V5G0G1 (Putative DNA polymerase (Fragment) OS=Anoplophora glabripennis OX=217634 GN=DPOM PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.322e-79
Identity = 184/534 (34.46%), Postives = 270/534 (50.56%), Query Frame = 1
Query:  541 CPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDD-------RHHQIHMPIAAGLLLINNYTNTKSYYYFY-GLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVR---QFKSCRTCYLCKKPIVH---PVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHI--NKLAVRFIDSMQFVNCSLAKAVKTLTS--LPLTSSVFQG------SIVDCKGIFPYNFAVSEEVLETTYELPPIW--------EGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLT-FVNKHHVASSE----------DTELLYIDINNLYGWALSQNLPYGDFVWVHDNLN-DVLSECVNANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQK 2010
            C  CLN FR     + H   CA+    T   + PE+K L F N+      PF++Y DFE++L P D         +Q H   A G     +Y  + S+Y  Y GLDC+  F++++E I   +       E  KL+ P+ +S +    QFK   TC++C KP      PVRDH H  G + G     CN+  +   ++P+VFHNL GYD H ++K      P   + ++  + E++IS   HI  + +  RFIDS +F+  SL K    L    L +  + F        +++  KG FPY++  S +VL+ T  LP           E +SED+Y+ AQ +W+      L++Y  +YLK DV LLAD F+ FR + +   GL+P ++Y +PG +W   L      +E LQD++M  F E  IRGG++   N++  A+++             LLY D+N LY WA+SQ LPYG+F WV D  N DV      +NI     GY +EVD+  P  +H    D PL PE  + P  K
Sbjct:   51 CDRCLNYFRHQAQLDKHEVECAR--VNTCKISFPEDKYLFFKNFKYKEPAPFIVYCDFEALLKPLDDISGSKTERYQKHEAFAVGYYFNCSYDKSLSHYKSYVGLDCVQWFVRELENIGKFV------DEKLKLVVPIEYSSIEAQNQFKKT-TCHICTKPFNEEDKPVRDHSHLDGKFRGWCHSNCNLNYKNTFIVPVVFHNLTGYDSHVMIKDVAQLCPG-RITLLAKNKEQYISFTKHIPNSSIKFRFIDSFRFLTSSLDKLASILRKEDLKILKTEFSHLNGESFNLITRKGTFPYDYINSMQVLKET-SLPSSTDFYNKLNDEDISEDDYNHAQKVWSVFKIGNLQEYTQLYLKTDVLLLADIFENFRERCLNTYGLDPAHYYTLPGYTWDCMLKHTNIKLEYLQDVDMLLFLERAIRGGVSQCCNRYAKANNKYMPNYDPNNPSNYLLYFDVNGLYAWAMSQYLPYGEFQWVEDVENFDVRLVADESNI-----GYILEVDLGYPNNLHDLHRDLPLCPEHRIPPNSK 568          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A224XH84 (Putative dna polymerase type b (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 6.861e-77
Identity = 199/579 (34.37%), Postives = 297/579 (51.30%), Query Frame = 1
Query:  427 LLLLENNDR-YHYTAVTNINWLMNCHQNPDCNIQIRCRWC--PHCL-NGFRLDNAFNTHVALCAKNQTGTTLYTLPENKN-LEFLNYSKHITPPFVIYADFESVLPPDDR-----------HHQ-----IHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPM---SFSEVRQFKSCRTCYLCKKPIVH---PVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILK-YGLDRFPSWNLDIIPTSTEKFISLIVHINK-LAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVF---QGSIVDCKGIFPYNFAVSEEVLETTYELPP--------IWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASS-----------EDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQK 2010
            LL++ N +  +H+  + N   L++     D    I C+ C   +C+ NG   +     H+ LC +N+       LP  K  LEF N  + I   FV+YADFES+L P  +            H+      ++     +  +++   TK Y Y  G +    F+K I+ IA E+   Y      KL  PM   S +E   F S  TCY+C K        V DHCH TG + GAA  KCN+  ++  +LP++ HNL GYD H I+K  G D   +  +D+IP + EK+IS    INK ++VRF+D+ +F+  SL   VK L  L      +   +  +V  KG+FPY+F  S + LE T  LP             +S+++Y  AQ +W+  NC+TL DY   YL+LD  LLAD F+ FR+  +  + L+P ++Y +PG+SW + L      +ELLQD E   F E GIRGGL  V+  +  ++           E T + Y D NNLYG+++++ LPYG+F W+     ++  E  + N E   YGY +EVDI+ P+++H+  N  P  PE  V   Q+
Sbjct:  164 LLIINNKEGLHHFVYIHNFERLVHNQLTSDTKNLITCKRCFTHYCVRNGG--EERMAKHLQLCNRNKPARI--ELPTEKTCLEFENVERGIRINFVVYADFESILHPIKKGLVDKFSIPFQKHEAMSFCTYVKFTDDMEEMSSNLPTKPYIY-RGKNAPAHFMKFIKNIAEEVSKIY------KLKTPMIPLSENEKIAFDSATTCYMCNKTFFKNDKKVHDHCHITGKFRGAAHNKCNLRYQVPSVLPVLIHNLSGYDSHFIIKELGYD---NKRIDVIPHTEEKYISFSKQINKDISVRFLDTFRFMPTSLNNLVKNLPQLIEVKKFYNFEEVKLVTRKGVFPYDFVTSWDRLEVT-SLPSREDFYNRLTGASISDEDYLHAQKVWSAFNCQTLGDYSDHYLQLDTLLLADCFEHFRSITLNTHQLDPCHYYTLPGLSWDAMLKFTGVRLELLQDYEQIMFIESGIRGGLCQVSHRYCKANNQYLADYNPNLETTYISYQDCNNLYGFSMTKCLPYGEFTWISS--EELNLETADDNGE---YGYILEVDIDYPKKLHRLHNSLPFLPETLVVNKQR 722          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A5N3ZYJ5 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 GN=PPYR_15562 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.900e-76
Identity = 185/548 (33.76%), Postives = 282/548 (51.46%), Query Frame = 1
Query:  439 ENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALC-AKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRH--HQIHMPIAAGLLLINNYTNTKSYYYFY-GLDCIPDFLKKI----EEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCK---KPIVHPVRDHCHF--TGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHIN--KLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPP--IWEGVSEDE------YDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFV---------NKH---HVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFLPYGYTMEVDINIPERVHQYLNDFPL 1977
            E   ++HY  + N++ L++   +     +++   C  CL+ F   +    H   C  KN T T + T  E K L+F N+   I  PFV+YAD ESVL P  +   +Q H+P A G     +Y  + S+Y  Y G DC+  F  ++    E+++T  + PY           M+  +  +F++   C++C+   K     VRDH H     N+ GAAC  CN+  +    +P+VFHNL GYD H ++     R     +D++P + EK+IS   HIN  ++  RFIDS +F+  SL K    LT+ P             KGI PY++  S +  +    LPP   +    ED+      Y RAQ +W++ NC  L  Y+ +Y+K D+ LLAD F+QFR+  I    L+P +++ +PG +W + L    + +ELL D +MF F E GIRGGL+ V         NK+   + ++  D  L+Y DINN YGW++SQ LPYG F WV  N+ D+ +   +A+      GY +EVD+  P+ +H    D P 
Sbjct:   85 EQPSKFHYVWIKNLSRLVSMQLSKK---KVQKHICDRCLHYFNSKDKLIKHTVDCLQKNDTATKMPT-DEKKMLKFKNFKNKIKAPFVVYADLESVLKPSTKKTAYQQHIPAAVGYYFKCSYDESLSFYNSYRGEDCMRWFADEMNKLAEDVSTVFLCPY--------KMHMTPQQELEFQAATHCHICEQSFKSGQKKVRDHNHLIPENNFRGAACEGCNVNYQDTHTIPVVFHNLSGYDAHFVVTDIATRMDG-KIDLLPITKEKYISFTKHINESRICFRFIDSFRFMASSLDKLSSALTNFPK------------KGIMPYDYFDSFDRFDELC-LPPQDAFYNKLEDKPCPRRMYRRAQEVWSRFNCSNLGQYVDLYMKTDILLLADVFEQFRSSCISTYDLDPAHYFTLPGFTWDAMLKYTRQELELLTDQDMFLFVERGIRGGLSQVCSKRRAHANNKYMSKYDSTKPDVYLMYNDINNQYGWSMSQYLPYGGFEWVDSNI-DITTIPDDAD-----EGYILEVDLEYPQHLHDAHTDLPF 600          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A087TB85 (Protein NYNRIN (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_21590 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.183e-75
Identity = 186/585 (31.79%), Postives = 297/585 (50.77%), Query Frame = 1
Query:  388 IHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLM-NCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKN-LEFLNYSKHITPPFVIYADFESVLPPDDRHHQI-----------HMPIAAGLLLIN-NYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEV--RQFKSCRTCYLCKKPIVHP-VRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFIS--LIVHINKLAVRFIDSMQFVNCSLAKAVKTLT--SLPLTSSVF---QGSIVDCKGIFPYNFAVSEEVLETTYELPPIW--------EGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNK-----------HHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQKL 2013
            +H +  T+ + + LLL+   DR HY  + N++ L+ N +++  C+       C  CL+ F+ +     H+  C+++     +  L E +N L F N       PF++YADFES++ P D   Q            H P     +LI  N T  K    + G +    F++ + ++  E+V           + PM F+E   + F S   CY+CK  +    VRD CH TG Y GA    CN+  ++ + +P++FH L+ YD HHIL+ GL       + +I TS EK+IS  L    +K++++F+DS QF+N SL K V  +   + P+ +  F   +  ++  K ++PY +  S +  E T  LPP          E +S+++Y  A  +W      TL DY  +Y+K DV LLAD F+ FR   +    L+  +    P ++W + L      +ELL D++M  F E GIRGG++ ++            H+  S   + ++Y+D NNLYGWA+SQ LPYG F WV  +  D+  E + ++ E    GY +EVD+  P+ +H   N++PLAPEKC    ++L
Sbjct:   60 LHVSKHTNEDCVNLLLISEEDRQHYCLIRNMSRLLGNVNKHNGCH-----HICYRCLHRFQKEETLKEHLKYCSEHSI-QHVKMLEEGENILSFTNIQFQHRVPFIVYADFESLIVPMDSAQQCENISFTNKIAQHQPCGYAYVLIGPNSTVMKPVTVYRGDNAAEHFVQSLIQVKKELVGQLTH------VAPMIFTEKDEQNFLSATQCYICKNALGKDRVRDPCHITGQYRGALHSVCNLQYKLKKCIPVIFHTLKNYDAHHILQ-GLKTVKDHEVKVIATSMEKYISFSLANREDKVSLQFVDSFQFLNTSLEKLVNNMKEENFPILTKHFGKEECELLCRKDLYPYEYMSSFKKFEETC-LPPKEAFYSVLGEEHISDEDYSHAIKVWETFKLHTLGDYHDLYVKSDVMLLADVFENFRNLCMKNYELDCAHVMTSPRLAWQACLKMNGIELELLTDLDMHLFIERGIRGGISMISHRWAEANNKYLPHYDPSKPSSYIIYLDANNLYGWAMSQPLPYGGFQWVSPSAIDI--EAILSSPEDGAVGYILEVDLEYPQELHDLHNEYPLAPEKCCITTEEL 628          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 229.18 bits (583), Expect = 1.299e-63
Identity = 172/596 (28.86%), Postives = 272/596 (45.64%), Query Frame = 1
Query:  415 NPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQT----------GTTLYTLPENKNLEFLNYSKHITPPFVIYADFES------VLPPDD-----RHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSF-SEVR-------QFKSCRTCYLCKKPIVH-PVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILK-YGLDRFPSWNLDIIPTSTEKFISLIVHIN--------------KLAVRFIDSMQFVNCSLAKAVKTL-----TSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWE--------GVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSE-----------DTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVNANIEFLPYGY---TMEVDINIPERVHQYLNDFPLAPE 1986
            N I LLL+ N +  HY  + ++  L++   +   + +     C  CLN FR   A   H   C+KN++          G  LYT        F+N+++ +  PFV+YADFES         PD+     + +Q H P     L+  +  +       +    +   ++   E   ++ +   +S+  ++     F  EV         + +   C++C   +    V DHCH TG Y GAA   CN+  R  +  P++FHNL GYD H  +K  G        ++ IP + EK+IS    +               K  +RFIDS +F++ SL   VK L      +L +     Q  ++  KG+FPY++  + + L+   +LPP            +SE++Y  AQ +W      T+RDY  +YL+ DV LLAD F+ FR   +   GL+P  +Y  PG++W +AL      +ELL D +M   +E GIRGG++ ++  H  ++               + Y+D NNLYGWA+S+ LP   F W+ D              E   +G     +EVD+  P  +H   +D+PLAPE
Sbjct:  719 NAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCKKALEKHYEYCSKNESVRIEMPMDKDGKPLYT-------RFVNFNRKMRVPFVVYADFESFTENIDTCSPDESRSFTKQYQKHKPSGFCYLIKCSIDDG-----VFSPKLVQRTVQGSAEDVAQLFVESLESDIKEIYNKFKFPKEVEMTREDEMNYDNATHCHICGGELGEDKVLDHCHLTGKYRGAAHNACNLRFRAPKFFPVLFHNLSGYDSHLFVKNLGTS---EGKINCIPNNEEKYISFTKQVVVDRFTNKEGKQVDVKRDIRFIDSFKFMSASLDSLVKNLPRESFKNLTIHYKGEQLQLLLRKGVFPYDWFCNFDQLDAI-QLPPKEAFYSTLNDTDISEEDYQHAQKVWETFKMSTMRDYHDLYLESDVLLLADVFENFRDVCLENYGLDPAWYYTAPGLAWDAALKITRVELELLTDCDMLLMFEEGIRGGVSMISTRHSKANNPYMREYDPNLPTKYITYLDANNLYGWAMSKPLPTHGFRWMTDQ-------------ELKEWGRHPCVVEVDMAYPRHLHDSHDDYPLAPE 1282          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO33317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSJ9])

HSP 1 Score: 59.3066 bits (142), Expect = 3.480e-9
Identity = 47/166 (28.31%), Postives = 70/166 (42.17%), Query Frame = 1
Query:  376 HLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKN---LEFLNYSKHITPPFVIYADFESVL------PPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPD 846
             +S  H+ +V     I LLL+ N++  HY  V N + L++   N   N Q    +C  CLN F+   +   H+  C KN+       + E+ +     F NY + +  PFV+YADFESV        PD++                 Y   K   Y Y + C  D
Sbjct:  278 RISKKHKAHV-----INLLLMSNDETNHYCWVKNTSRLLSSQVN---NHQHTSIFCCRCLNSFQSKTSLEKHLEYCTKNEEVKIDMPVDEDGDPLHAYFKNYIREMRAPFVVYADFESVTENIDTCSPDEKRS-----------FTKQYQKHKQSGYCYLIKCFDD 424          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO34977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS5])

HSP 1 Score: 56.225 bits (134), Expect = 3.121e-8
Identity = 38/132 (28.79%), Postives = 64/132 (48.48%), Query Frame = 1
Query:  415 NPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKN-----LEFLNYSKHITPPFVIYADFESVLP------PDD-----RHHQIHMP 762
            N I LLL+ N +  HY  + ++  L++   +   + +     C  CLN FR + A   H   C+KN++      +P +K+       F+N+++ +  PFV+YADFES         PD+     + +Q H P
Sbjct:  292 NAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCEMALEKHYEYCSKNES--VRIEMPMDKDGKPLYTRFVNFNRKMRVPFVVYADFESFTENIDTCSPDESRSFTKQYQKHKP 418          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ0])

HSP 1 Score: 54.299 bits (129), Expect = 7.697e-8
Identity = 39/139 (28.06%), Postives = 62/139 (44.60%), Query Frame = 1
Query:  409 DGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQT----------GTTLYTLPENKNLEFLNYSKHITPPFVIYADFE------SVLPPDD-----RHHQIHMP 762
            D   I LLL+ +++  HY  + N++ L++       + Q    +CP CLN F    A   H   C+KN+           G  LYT       +F ++++ +  PFV+YADFE          PD+     + +Q H P
Sbjct:  140 DTRTINLLLISDDETNHYCWIKNMSRLLSSQIG---DHQHASEFCPRCLNSFWCKEALERHSEYCSKNEEVKIEMPRDIDGNPLYT-------KFRSFNRKMRVPFVVYADFECFTENIDTCSPDESKSFTKQYQKHKP 268          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO48021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP4])

HSP 1 Score: 54.6842 bits (130), Expect = 8.397e-8
Identity = 39/129 (30.23%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  421 IYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQT-GTTLYTLPENKNL---EFLNYSKHITPPFVIYADFESVLP------PDD-----RHHQIHMP 762
            I LLL+ N++  HY  + +++ L++   N   N Q    +CP CLN F    A   H   C  ++     +  + ++ NL   +F NY++ +  PFV+YADFES         PD+     + +Q H P
Sbjct:  340 INLLLISNDETNHYCWIKDMSRLLSSQIN---NHQHATEFCPRCLNPFWCKKALEKHSEYCDNHEAVRIEMPKIDKDGNLPHIKFKNYNRKMRVPFVVYADFESFTENIDTCSPDESKSFTKQYQEHKP 465          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000026530.1 (SMESG000026530.1)

HSP 1 Score: 1077 bits (2784), Expect = 0.000e+0
Identity = 522/595 (87.73%), Postives = 539/595 (90.59%), Query Frame = 1
Query:  238 P*NFATFQSLKRKTLLLNLAISVFSCTPTVIIDDNEVPDNYVFHHPHLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVN-ANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQKLRS 2019
            P         ++K   L LAI+VFS TPTVIID  EVPDNYVFHHPHLSLIHR+ VTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYL                     AACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKH++A+SEDTELLYIDINNLYGWALSQ+LPY DF WV+D L+DVL+EC N  +IE LPYGYTMEVDI IP+ +H +LNDFP+ PEK   P  K+  
Sbjct:  484 PMKLINIPKFEKKNSTLKLAINVFSYTPTVIID--EVPDNYVFHHPHLSLIHRSKVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLW--------------------AACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDDVLNECANVVDIEILPYGYTMEVDIEIPDNLHDFLNDFPIGPEKMCPPNSKVEK 1056          

HSP 2 Score: 64.6994 bits (156), Expect = 2.322e-10
Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 3
Query:  195 EFLDELEYDDVTDCPMKLCNIPKFEKKNSTFKLS 296
            EFLDELEYD++TDCPMKL NIPKFEKKNST KL+
Sbjct:  470 EFLDELEYDEITDCPMKLINIPKFEKKNSTLKLA 503          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053372.1 (SMESG000053372.1)

HSP 1 Score: 1072.38 bits (2772), Expect = 0.000e+0
Identity = 514/587 (87.56%), Postives = 534/587 (90.97%), Query Frame = 1
Query:  262 SLKRKTLLLNLAISVFSCTPTVIIDDNEVPDNYVFHHPHLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVN-ANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQKLRS 2019
              ++K   L LAI+VFS TPTVIID  EVPDNYVFHHPHLSLIHR+ VTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIV+PVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRF SWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYD+AQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPG                        FYEGGIRGGLTFVNKH++A+SEDTELLYIDINNLYGWALSQ+LPY DF WV+D L++VL+EC N  +IE LPYGYTMEVDI IP+ +H +LNDFP+ PEK   P  K+  
Sbjct:  902 KFEKKNSTLKLAINVFSYTPTVIID--EVPDNYVFHHPHLSLIHRSKVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVNPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFLSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDKAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGHG-------------------NVQFYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDEVLNECANVVDIEILPYGYTMEVDIEIPDNLHDFLNDFPIGPEKMCPPNSKVEK 1467          

HSP 2 Score: 59.3066 bits (142), Expect = 1.095e-8
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3
Query:  204 DELEYDDVTDCPMKLCNIPKFEKKNSTFKLS 296
            DELEYD++TDCPMKL NIPKFEKKNST KL+
Sbjct:  883 DELEYDEITDCPMKLINIPKFEKKNSTLKLA 913          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040848.1 (SMESG000040848.1)

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 493/597 (82.58%), Postives = 517/597 (86.60%), Query Frame = 1
Query:  238 P*NFATFQSLKRKTLLLNLAISVFSCTPTVIIDDNEVPDNYVFHHPHLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVN-ANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRP---IQKLR 2016
            P        +++K   L LAI+V S TPTVIID  +VPDNYVFHH HLSLIHR+ VTDGNP YLLLLENNDRYHYTAVTNI  LMNCHQ PDCNIQIR RWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSK ITPPFVIYADFESVLPPDDRHHQIH PIAAGLLLINNYTNT+SYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKL                TCYLCKKPIVHPV+DHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSV+QGSIVDCK                  ELPPIWEGVS+DEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKH++A+ EDTELLY DINNLYGWALSQ+LPY DF WV+D L++ LSEC N  +IE LPYGY MEVDI IP+ +H +LNDFP+ PEK   P   ++KLR
Sbjct:  128 PMKLINIPKVEKKNSTLKLAINVSSYTPTVIID--KVPDNYVFHHSHLSLIHRSKVTDGNPFYLLLLENNDRYHYTAVTNIERLMNCHQTPDCNIQIRYRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKDITPPFVIYADFESVLPPDDRHHQIHKPIAAGLLLINNYTNTESYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKL----------------TCYLCKKPIVHPVKDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVYQGSIVDCK------------------ELPPIWEGVSKDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAALEDTELLYKDINNLYGWALSQSLPYADFTWVYDCLDEFLSECANVVDIEILPYGYIMEVDIEIPDYLHDFLNDFPIEPEKMCPPNSKVEKLR 688          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040848.1 (SMESG000040848.1)

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 493/597 (82.58%), Postives = 517/597 (86.60%), Query Frame = 1
Query:  238 P*NFATFQSLKRKTLLLNLAISVFSCTPTVIIDDNEVPDNYVFHHPHLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVN-ANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRP---IQKLR 2016
            P        +++K   L LAI+V S TPTVIID  +VPDNYVFHH HLSLIHR+ VTDGNP YLLLLENNDRYHYTAVTNI  LMNCHQ PDCNIQIR RWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSK ITPPFVIYADFESVLPPDDRHHQIH PIAAGLLLINNYTNT+SYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKL                TCYLCKKPIVHPV+DHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSV+QGSIVDCK                  ELPPIWEGVS+DEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKH++A+ EDTELLY DINNLYGWALSQ+LPY DF WV+D L++ LSEC N  +IE LPYGY MEVDI IP+ +H +LNDFP+ PEK   P   ++KLR
Sbjct:  132 PMKLINIPKVEKKNSTLKLAINVSSYTPTVIID--KVPDNYVFHHSHLSLIHRSKVTDGNPFYLLLLENNDRYHYTAVTNIERLMNCHQTPDCNIQIRYRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKDITPPFVIYADFESVLPPDDRHHQIHKPIAAGLLLINNYTNTESYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKL----------------TCYLCKKPIVHPVKDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVYQGSIVDCK------------------ELPPIWEGVSKDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAALEDTELLYKDINNLYGWALSQSLPYADFTWVYDCLDEFLSECANVVDIEILPYGYIMEVDIEIPDYLHDFLNDFPIEPEKMCPPNSKVEKLR 692          

HSP 2 Score: 52.373 bits (124), Expect = 1.079e-6
Identity = 23/30 (76.67%), Postives = 27/30 (90.00%), Query Frame = 3
Query:  207 ELEYDDVTDCPMKLCNIPKFEKKNSTFKLS 296
            +LEYD++TDCPMKL NIPK EKKNST KL+
Sbjct:  122 DLEYDEITDCPMKLINIPKVEKKNSTLKLA 151          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000006220.1 (SMESG000006220.1)

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 486/595 (81.68%), Postives = 508/595 (85.38%), Query Frame = 1
Query:  238 P*NFATFQSLKRKTLLLNLAISVFSCTPTVIIDDNEVPDNYVFHHPHLSLIHRTNVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFVWVHDNLNDVLSECVN-ANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEKCVRPIQKLRS 2019
            P         ++K   L LAI+VFS TPTVIID  EVPDNYVFHHPHLSLIHR+ VTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIG            C +       +V PV     +  N LG+   KCNIARRIYRLLPIVFHNLR                    DIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKH++A+SEDTELLYIDINNLYGWALSQ+LPY DF WV+D L++VL+EC N  +IE LPYGYTMEVDI IP+ +H +LNDFP+ PEK   P  K+  
Sbjct:  546 PMKLINIPKFEKKNSTLKLAINVFSYTPTVIID--EVPDNYVFHHPHLSLIHRSKVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIG-----------LCLSVRFDSLNLVEPVI----YVKNRLGS-LPKCNIARRIYRLLPIVFHNLR--------------------DIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDEVLNECANVVDIEILPYGYTMEVDIEIPDNLHDFLNDFPIGPEKMCPPNSKVEK 1102          

HSP 2 Score: 64.6994 bits (156), Expect = 2.311e-10
Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 3
Query:  195 EFLDELEYDDVTDCPMKLCNIPKFEKKNSTFKLS 296
            EFLDELEYD++TDCPMKL NIPKFEKKNST KL+
Sbjct:  532 EFLDELEYDEITDCPMKLINIPKFEKKNSTLKLA 565          
The following BLAST results are available for this feature:
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZC53.41.059e-3426.57pep chromosome:WBcel235:X:1925750:1937689:1 gene:W... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DRN23.544e-8131.97DNA_pol_B_2 domain-containing protein OS=Macrostom... [more]
V5G0G11.322e-7934.46Putative DNA polymerase (Fragment) OS=Anoplophora ... [more]
A0A224XH846.861e-7734.37Putative dna polymerase type b (Fragment) OS=Panst... [more]
A0A5N3ZYJ54.900e-7633.76Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A087TB851.183e-7531.79Protein NYNRIN (Fragment) OS=Stegodyphus mimosarum... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461091.299e-6328.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333173.480e-928.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349773.121e-828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441107.697e-828.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480218.397e-830.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026530.12.322e-1087.73SMESG000026530.1[more]
SMESG000053372.11.095e-887.56SMESG000053372.1[more]
SMESG000040848.10.000e+082.58SMESG000040848.1[more]
SMESG000040848.11.079e-682.58SMESG000040848.1[more]
SMESG000006220.12.311e-1081.68SMESG000006220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011549 ID=SMED30011549|Name=DNA_pol_B_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2030bp
AAACTCAAAGAAAGGAAAAAGAAAGTAACATTCACTTGAAATAAATTCGT
CAATTAGGGTTTTACGCTAAATTTTAAAAGTCTTTGTAAACTTTAACCAT
TCAATGTTTTTAGAAATTAAAAAAATTCAAAGATCAATTATGATCAAATT
ATCCCTGGTCTGTTATTTACGAAAATAAAGAGTTTACAAATATAGAGTTT
TTAGACGAGTTAGAATATGATGATGTCACGGATTGCCCCATGAAACTTTG
CAACATTCCAAAGTTTGAAAAGAAAAACTCTACTTTTAAACTTAGCAATT
AGTGTGTTTTCATGCACACCAACTGTGATAATTGATGACAATGAGGTTCC
AGATAATTATGTCTTTCACCATCCTCATTTAAGTTTAATACACAGAACCA
ATGTCACTGACGGAAACCCTATTTATTTATTATTACTTGAAAATAATGAT
AGATATCATTATACCGCTGTGACCAATATCAACTGGTTAATGAATTGCCA
TCAAAACCCTGACTGTAACATTCAAATTAGATGTCGTTGGTGTCCACATT
GCCTTAATGGGTTTAGATTAGATAATGCATTCAATACACATGTTGCATTA
TGCGCCAAAAATCAGACTGGCACAACCCTATACACGCTCCCCGAAAATAA
AAATTTAGAATTCCTAAATTATTCTAAACATATCACCCCACCTTTTGTGA
TTTATGCCGATTTTGAATCGGTTTTACCTCCTGATGATAGACATCATCAA
ATTCATATGCCTATTGCAGCAGGCCTTTTATTAATTAATAATTATACTAA
CACAAAATCATATTATTACTTTTACGGACTTGATTGCATTCCTGATTTTC
TTAAGAAAATTGAGGAAATTGCAACTGAAATTGTTATTCCGTACTATGAT
TCGGAAGGTGATAAATTGATAGGGCCTATGTCTTTCAGTGAGGTTCGACA
GTTTAAATCTTGTCGAACCTGTTATTTATGTAAAAAACCGATTGTACATC
CGGTTAGAGATCATTGCCATTTTACTGGTAATTATCTAGGGGCAGCTTGC
CGAAAATGTAATATAGCTCGTAGGATTTATCGATTACTACCTATAGTCTT
TCATAATTTAAGAGGGTATGACCTTCACCATATTTTAAAATATGGTCTCG
ATCGCTTTCCTTCATGGAATTTAGATATCATACCGACCTCTACAGAAAAA
TTTATTTCATTAATTGTTCACATTAACAAATTGGCTGTTCGCTTTATCGA
CAGTATGCAATTTGTTAATTGTTCGTTAGCTAAGGCTGTGAAAACGCTAA
CTTCTCTTCCATTGACTTCGTCTGTCTTTCAAGGTTCTATAGTCGACTGT
AAAGGTATTTTTCCGTATAATTTTGCTGTTTCGGAGGAAGTTCTTGAGAC
TACTTATGAGTTGCCTCCAATTTGGGAGGGCGTAAGTGAAGATGAGTACG
ATAGGGCACAACTAATCTGGACGCAGCAAAACTGTAGGACTTTGCGTGAT
TATATGTTAATTTACCTTAAACTTGATGTATTCCTCCTTGCGGACTATTT
TCAACAATTCCGTGCCAAGGCTATTGTTTACAATGGTCTTGAACCTCTAA
ACTTTTATGGCATTCCGGGTATGTCATGGGCTTCAGCGCTTATGACATTA
ACGGAACCCATTGAACTTTTACAGGACATGGAAATGTTCAATTTTTACGA
AGGTGGAATACGGGGTGGGTTAACATTTGTTAACAAACATCATGTTGCAA
GTTCTGAAGATACAGAACTCTTGTATATCGACATTAATAATTTATATGGT
TGGGCACTTAGCCAAAACCTTCCGTATGGTGATTTTGTTTGGGTGCATGA
TAATCTGAATGATGTGCTGAGTGAATGTGTGAATGCGAATATTGAATTCC
TTCCGTATGGTTATACAATGGAAGTTGACATCAATATCCCTGAGCGTGTG
CATCAGTATTTGAATGACTTTCCGCTTGCTCCGGAAAAATGTGTCCGCCC
AATTCAAAAGTTGAGAAGTTAATGCTCACG
back to top

protein sequence of SMED30011549-orf-1

>SMED30011549-orf-1 ID=SMED30011549-orf-1|Name=SMED30011549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=511bp
MNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTL
PENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLIN
NYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFS
EVRQFKSCRTCYLCKKPIVHPVRDHCHFTGNYLGAACRKCNIARRIYRLL
PIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAV
RFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEE
VLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLL
ADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMF
NFYEGGIRGGLTFVNKHHVASSEDTELLYIDINNLYGWALSQNLPYGDFV
WVHDNLNDVLSECVNANIEFLPYGYTMEVDINIPERVHQYLNDFPLAPEK
CVRPIQKLRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0071897DNA biosynthetic process
GO:0006260DNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR004868DNA-dir_DNA_pol_B_mt/vir
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003887DNA-directed DNA polymerase activity
GO:00084083'-5' exonuclease activity