E3 ubiquitin-protein ligase XIAP

Overview
NameE3 ubiquitin-protein ligase XIAP
Smed IDSMED30011545
Length (bp)1734
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase XIAP (SMED30011545) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase XIAP (SMED30011545) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase XIAP (SMED30011545) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase XIAP (SMED30011545) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011545

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011545SMESG000081058.1 Contig2302GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30011545SMESG000081058.1 Contig2302GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011545SMESG000081058.1 Contig2302GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30011545SMESG000081058.1 Contig2302GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011545SMESG000081058.1 dd_Smed_v4_1803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011545SMESG000081058.1 dd_Smed_v4_1803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011545SMESG000081058.1 dd_Smed_v4_1803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30011545SMESG000081058.1 dd_Smed_v4_1803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011545SMESG000081058.1 dd_Smed_v4_1803_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 100.908 bits (250), Expect = 6.696e-22
Identity = 94/355 (26.48%), Postives = 161/355 (45.35%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEF-DIESRETTFAKL---ANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARL-DSRFANKVEQ----LEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  N+     SD    + + D +  N                N   N    D E+R  TF       N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ +       C V  +     +  R+ D+ F N + Q    + +  K +KK++E+K++ +G +Y S+   ++DL     D+ Q  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTGI---GDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESD----AVSSDRNFPN--------------STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE-------CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 488          

HSP 2 Score: 64.3142 bits (155), Expect = 3.232e-10
Identity = 33/106 (31.13%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNG 646
            +E++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H+K  P C F+    + N      ++   N    ++N+ G
Sbjct:   20 EEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTG---EGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLG 122          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 100.908 bits (250), Expect = 6.696e-22
Identity = 94/355 (26.48%), Postives = 161/355 (45.35%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEF-DIESRETTFAKL---ANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARL-DSRFANKVEQ----LEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  N+     SD    + + D +  N                N   N    D E+R  TF       N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ +       C V  +     +  R+ D+ F N + Q    + +  K +KK++E+K++ +G +Y S+   ++DL     D+ Q  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTGI---GDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESD----AVSSDRNFPN--------------STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE-------CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 488          

HSP 2 Score: 64.3142 bits (155), Expect = 3.232e-10
Identity = 33/106 (31.13%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNG 646
            +E++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H+K  P C F+    + N      ++   N    ++N+ G
Sbjct:   20 EEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTG---EGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLG 122          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 100.908 bits (250), Expect = 6.696e-22
Identity = 94/355 (26.48%), Postives = 161/355 (45.35%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEF-DIESRETTFAKL---ANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARL-DSRFANKVEQ----LEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  N+     SD    + + D +  N                N   N    D E+R  TF       N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ +       C V  +     +  R+ D+ F N + Q    + +  K +KK++E+K++ +G +Y S+   ++DL     D+ Q  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTGI---GDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESD----AVSSDRNFPN--------------STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE-------CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 488          

HSP 2 Score: 64.3142 bits (155), Expect = 3.232e-10
Identity = 33/106 (31.13%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNG 646
            +E++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H+K  P C F+    + N      ++   N    ++N+ G
Sbjct:   20 EEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTG---EGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLG 122          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Match: NAIP (NLR family apoptosis inhibitory protein [Source:HGNC Symbol;Acc:HGNC:7634])

HSP 1 Score: 78.5666 bits (192), Expect = 2.014e-14
Identity = 47/136 (34.56%), Postives = 72/136 (52.94%), Query Frame = 2
Query:  245 TIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEI 652
            T EH+ N      ++++R++  +     D  +  E  RL SF ++P+E +  V  +AKAG +Y G K   D V+C  C G L KW++ DDP+ +H + FP CPFL N+             SA   PDL++  GE+
Sbjct:  250 TGEHFVN------SWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALAKAGLFYTGIK---DIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNM-----------KSSAEVTPDLQS-RGEL 364          

HSP 2 Score: 64.6994 bits (156), Expect = 3.680e-10
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  311 SRMKVFDEKYRKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            SR++    +Y++E  RL SF N+P  +  + P  +++AGF + G +   D V+C  C G L  W++ DDP  EH K FP C FL
Sbjct:  147 SRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQ---DTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFL 227          

HSP 3 Score: 57.7658 bits (138), Expect = 5.501e-8
Identity = 34/88 (38.64%), Postives = 51/88 (57.95%), Query Frame = 2
Query:  320 KVFDEKYRKEFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGN 580
            K ++ + R E +RLK+F  + +  SS +P+ MA AGFY+ G KS    ++C  C  +L        P+ +HK+  P C FLLN +VGN
Sbjct:   51 KGYNSQMRSEAKRLKTFVTY-EPYSSWIPQEMAAAGFYFTGVKS---GIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGN 134          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Match: NAIP (NLR family apoptosis inhibitory protein [Source:HGNC Symbol;Acc:HGNC:7634])

HSP 1 Score: 78.5666 bits (192), Expect = 2.049e-14
Identity = 47/136 (34.56%), Postives = 72/136 (52.94%), Query Frame = 2
Query:  245 TIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEI 652
            T EH+ N      ++++R++  +     D  +  E  RL SF ++P+E +  V  +AKAG +Y G K   D V+C  C G L KW++ DDP+ +H + FP CPFL N+             SA   PDL++  GE+
Sbjct:  250 TGEHFVN------SWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALAKAGLFYTGIK---DIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNM-----------KSSAEVTPDLQS-RGEL 364          

HSP 2 Score: 64.6994 bits (156), Expect = 3.744e-10
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  311 SRMKVFDEKYRKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            SR++    +Y++E  RL SF N+P  +  + P  +++AGF + G +   D V+C  C G L  W++ DDP  EH K FP C FL
Sbjct:  147 SRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQ---DTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFL 227          

HSP 3 Score: 57.7658 bits (138), Expect = 5.693e-8
Identity = 34/88 (38.64%), Postives = 51/88 (57.95%), Query Frame = 2
Query:  320 KVFDEKYRKEFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGN 580
            K ++ + R E +RLK+F  + +  SS +P+ MA AGFY+ G KS    ++C  C  +L        P+ +HK+  P C FLLN +VGN
Sbjct:   51 KGYNSQMRSEAKRLKTFVTY-EPYSSWIPQEMAAAGFYFTGVKS---GIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGN 134          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Match: Det (gene:FBgn0264291 transcript:FBtr0083408)

HSP 1 Score: 63.5438 bits (153), Expect = 1.080e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  284 NFIKRKVDYSRMKVFDEKYRKEFERLKSFDN--FPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPF 556
            N +   +   +++VF +    E  R++S+ +  FP+  S  + KMA+AGFY+ G K E+D   C  C   L  W+  DDP  EH K  P C F
Sbjct:    7 NEVAASLGGEKLEVFRKLNLLEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEF 99          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087297)

HSP 1 Score: 63.1586 bits (152), Expect = 3.233e-10
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCP 553
            E  RL +F ++P    ++ P+ +AKAGFYY    +  D VKC++C GV++KW+K D+   EHK+ FP CP
Sbjct:  113 EANRLVTFKDWPN--PNITPQALAKAGFYYL---NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCP 177          

HSP 2 Score: 58.151 bits (139), Expect = 1.400e-8
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 2
Query: 1220 CVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            C VCLD+ V VVFLPCGHL TC  C+  +A+CP+CR  I+  V
Sbjct:  451 CKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFV 493          

HSP 3 Score: 53.5286 bits (127), Expect = 3.264e-7
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  251 EHYRNIYASPENFIKRKVDYSRMKVFDE------------KYRKEFERLKSFDNFPKELSSLVPK--MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLL 562
            EH R     P   +   ++++  K  DE            KY     RL++F ++P  +S++ P   +A+AG YY   +   DQV+C  C   L  W+K D+P  EH K  P C F+L
Sbjct:  168 EHKRFFPQCPRVQMGPLIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWP--ISNIQPASALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVL 280          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087296)

HSP 1 Score: 63.1586 bits (152), Expect = 3.233e-10
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCP 553
            E  RL +F ++P    ++ P+ +AKAGFYY    +  D VKC++C GV++KW+K D+   EHK+ FP CP
Sbjct:  113 EANRLVTFKDWPN--PNITPQALAKAGFYYL---NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCP 177          

HSP 2 Score: 58.151 bits (139), Expect = 1.400e-8
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 2
Query: 1220 CVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            C VCLD+ V VVFLPCGHL TC  C+  +A+CP+CR  I+  V
Sbjct:  451 CKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFV 493          

HSP 3 Score: 53.5286 bits (127), Expect = 3.264e-7
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  251 EHYRNIYASPENFIKRKVDYSRMKVFDE------------KYRKEFERLKSFDNFPKELSSLVPK--MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLL 562
            EH R     P   +   ++++  K  DE            KY     RL++F ++P  +S++ P   +A+AG YY   +   DQV+C  C   L  W+K D+P  EH K  P C F+L
Sbjct:  168 EHKRFFPQCPRVQMGPLIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWP--ISNIQPASALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVL 280          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Match: CG17019 (gene:FBgn0033783 transcript:FBtr0087806)

HSP 1 Score: 59.6918 bits (143), Expect = 4.849e-9
Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            +E +  D+ C +C+D P+  VFL CGH+ TC  C   L  CP+CRQ I + V
Sbjct:  644 VEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVV 695          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Match: CG17019 (gene:FBgn0033783 transcript:FBtr0339738)

HSP 1 Score: 59.6918 bits (143), Expect = 4.849e-9
Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            +E +  D+ C +C+D P+  VFL CGH+ TC  C   L  CP+CRQ I + V
Sbjct:  644 VEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVV 695          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 110.153 bits (274), Expect = 4.750e-26
Identity = 90/341 (26.39%), Postives = 142/341 (41.64%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCS-NIKSLNSYDDLRIKNTVPKNDDRNN----FCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R E ERL++F N+P + +    ++A+AGF+Y G     D V+C  C+G+L  W   D P  EH++ FPTC  +   +VGN     P   S + D  L +    ++ +  G   +  +SE    D  +R +TF                           N         + L R  F Y+    N+K    + D  ++N  P +D        F Q EY + +   E      +   V+Q  ++               G+   S    LS   G +       +    L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   44 RSEEERLQTFHNWPSDAAVSPEELARAGFHYLGY---GDTVQCFCCEGILRHWVDGDTPRGEHERHFPTCGLMRGRDVGNV----PRGSSDSVDGQLLSQLQRLTMDEQGLTGQAAYSEMETED--NRRSTFH--------------------------NWPTGAAVQPDTLARAGFFYTGHGDNVKCF--FCDGGLRNWEPGDDPWQEHAKWFPQCEYLLQSRGQE------YVRNVQQSFFN-------------MNGRGGGS----LSSAAGNITPVRSDLSPEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCSDCAASLRHCPICRAVIRGSV 324          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 103.99 bits (258), Expect = 2.942e-24
Identity = 88/337 (26.11%), Postives = 139/337 (41.25%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYS-NCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R E ERL++F N+P + +    ++A+AGF+Y G     D V+C  C+G+L  W   D P  EH++ FPTC  +   +VGN     P   S + D  L +    ++ +  G   +  +SE    D  +R +TF                           N         + L R  F Y+ +  N+K    + D  ++N  P +D        E++    + E  L SR        EY R + +       +   K+ + + Q             + R C              VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   24 RSEEERLQTFHNWPSDAAVSPEELARAGFHYLGY---GDTVQCFCCEGILRHWVDGDTPRGEHERHFPTCGLMRGRDVGNV----PRGSSDSVDGQLLSQLQRLTMDEQGLTGQAAYSEMETED--NRRSTFH--------------------------NWPTGAAVQPDTLARAGFFYTGHGDNVKCF--FCDGGLRNWEPGDDPWQ-----EHAKWFPQCEYLLQSRGQ------EYVRNVQQSFFNMNGRGVRKNDEQLRQL-----------QEERTCK-------------VCMDKLVSMVFIPCGHLVVCSDCAASLRHCPICRAVIRGSV 288          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Match: xiap (X-linked inhibitor of apoptosis [Source:ZFIN;Acc:ZDB-GENE-030825-7])

HSP 1 Score: 99.7525 bits (247), Expect = 4.539e-22
Identity = 83/338 (24.56%), Postives = 131/338 (38.76%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSV-PILKNVENLPRTAFHYSNCSNIKSLNSYDDL-RIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + E  RL +F+N+P +       +A+AG YY G     D V+C  C G LS W++ DDP  EH K +  C F L  NVGN   + P  + AN  P    F G +                  F          +LA   F         + + + C++C   V   + + +     A HY  CS + +    + +  ++   PK   +N F   E                                        +G    ++    SD+    DD         +LE +  ++ C VC+D  +++VF+PCGHL TC  CS+ L  CP+C   I +++
Sbjct:  135 KSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGID---DNVQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPR-ANVHP-TDTFEGRLD----------------SFKGRQHPIDPERLARAGFYS-----TGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGEEYVSSVQLRYPKRPTQNGFSSHE----------------------------------------SGSSAQALIHGSSDMFEKADDPM------TELEKLQREKLCKVCMDSDISIVFIPCGHLVTCQKCSASLDKCPICCATITQKI 400          

HSP 2 Score: 53.9138 bits (128), Expect = 2.906e-7
Identity = 24/68 (35.29%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            R+ SF  FP        ++A+AGFY+ G   E D+V+C  C   +  W + D P+  H+ + P C FL
Sbjct:   25 RVNSFQRFPYSEDISAQRLARAGFYFTG---EGDRVQCFSCSATVQNWNRGDTPLERHQLASPDCRFL 89          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Match: xiap (X-linked inhibitor of apoptosis [Source:ZFIN;Acc:ZDB-GENE-030825-7])

HSP 1 Score: 99.7525 bits (247), Expect = 4.539e-22
Identity = 83/338 (24.56%), Postives = 131/338 (38.76%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSV-PILKNVENLPRTAFHYSNCSNIKSLNSYDDL-RIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + E  RL +F+N+P +       +A+AG YY G     D V+C  C G LS W++ DDP  EH K +  C F L  NVGN   + P  + AN  P    F G +                  F          +LA   F         + + + C++C   V   + + +     A HY  CS + +    + +  ++   PK   +N F   E                                        +G    ++    SD+    DD         +LE +  ++ C VC+D  +++VF+PCGHL TC  CS+ L  CP+C   I +++
Sbjct:  135 KSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGID---DNVQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPR-ANVHP-TDTFEGRLD----------------SFKGRQHPIDPERLARAGFYS-----TGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGEEYVSSVQLRYPKRPTQNGFSSHE----------------------------------------SGSSAQALIHGSSDMFEKADDPM------TELEKLQREKLCKVCMDSDISIVFIPCGHLVTCQKCSASLDKCPICCATITQKI 400          

HSP 2 Score: 53.9138 bits (128), Expect = 2.906e-7
Identity = 24/68 (35.29%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            R+ SF  FP        ++A+AGFY+ G   E D+V+C  C   +  W + D P+  H+ + P C FL
Sbjct:   25 RVNSFQRFPYSEDISAQRLARAGFYFTG---EGDRVQCFSCSATVQNWNRGDTPLERHQLASPDCRFL 89          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.097e-10
Identity = 33/71 (46.48%), Postives = 41/71 (57.75%), Query Frame = 2
Query:  353 ERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLN 565
            ERL +F N+P  +     ++AKAGFYY G    +D VKC  C G L  W+  DDP  EH K FP C +LL 
Sbjct:  300 ERLLTFVNWPSRIPVRPDQLAKAGFYYVG---RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLQ 367          

HSP 2 Score: 62.003 bits (149), Expect = 1.464e-9
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            R+E ERL +F N+   L+++ P ++AKAG YY G   + D+V C  C G L  W+  D  V EH++ +P C F+
Sbjct:  204 RREQERLDTFQNW--TLATVTPAELAKAGLYYLG---QGDRVACFSCGGQLGSWEPGDRAVSEHQRHYPNCRFV 272          

HSP 3 Score: 58.151 bits (139), Expect = 2.293e-8
Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            L  +  ++ C VC+DK V +VF+PCGHL  C +C+  L  CP+CR +++  V
Sbjct:  577 LRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGMVKGTV 628          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Match: fasn (fatty acid synthase [Source:Xenbase;Acc:XB-GENE-1002983])

HSP 1 Score: 105.145 bits (261), Expect = 1.955e-23
Identity = 96/356 (26.97%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSV--------PILKNVENLPRTAF-------HYSNCSNIKS--LNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRR-----NCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKR 1345
            E  RL++F N+P   S L PK +A AG +Y G    +DQVKC  C G L  W+  D    EHKK FP C F+L  +VGN      ++       +L       + N Y   +E   S +   D E+       LA   F       +   +  KC+ C   +        P  ++ +  P   F       H+ N + +K   L+  +       +PK+ +                   L S      +Q+ +  + +KKV+ +KLK+TGK+Y  + +F+SDL    +   ++      +    L  +  ++ C VC+D+ +++VF+PCGHL  C  C+  L  CP+C  ++E+R
Sbjct:  169 EEARLQTFQNWPA-YSPLTPKELANAGLFYTGI---NDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRDVGNVATEANTHGGRRRGSELAC----PAMNDYNARLETFSSWSFPIDKET-------LAKAGFYS-----IGDGDATKCFHCGGVLNCWSATDDPWEEHAKAYPGCKFLIDEKGQHFINHAQLKRPILHKANSADASPALPKDSNL------------------LKSPLVTDAQQMGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDLCAQKETVLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICCTIVERR 486          

HSP 2 Score: 64.6994 bits (156), Expect = 2.413e-10
Identity = 31/81 (38.27%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLN 571
            D+ Y +E  RL SF NFP       P +A+AGFYY G+    D+VKC  C  ++  W+  D  + +H+K  P C F+   N
Sbjct:   31 DQNYFEEEVRLASFANFPSSYPVSAPALARAGFYYTGD---GDRVKCFSCLAMVEGWQHGDTAIGKHRKISPNCKFINGFN 108          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 96.6709 bits (239), Expect = 5.392e-21
Identity = 92/374 (24.60%), Postives = 152/374 (40.64%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLAN--LKFLCFDGLF-VFKNEFLKCYKCNKSVPILKNVENL--PRT--AFHYSNCSNIKSLNSYDDLR-IKNTVPKNDDRNNFCQVEYSITADEIEAR------LDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDL------KGFVDDNYQRR-----------------NCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R E ER +SF  +P    ++ P ++A++GFYY G     D+V+C  C GVL  W+  D P  EH+K FP+CPFL        +   P    + +   L   +GE     +         E    D     +T+ + AN   + L   G F     + +KC+ C+     L+N E    P T  A  +  C  +  +     +R ++ +   + + +      Y  +             L +  A    Q+ + R  V  ++  +   TG  Y S+ + ++DL       G    +  R                  +    L  +  ++ C VC+D  V++VF+PCGHL  C +C+  L  CP+CR  I   V
Sbjct:   22 RSEAERQRSFRAWPHTCRTVSPAELARSGFYYLG---PGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCPFL------QVRRGPPGGTDSVDGQILGQLSGEEPDRTWEPVCPQMAGEG---DRLGSFSTWPRYANGDPQQLAGAGFFYTGHRDHVKCFHCDGG---LRNWEQGDDPWTEHAKWFPMCDFLLQVKGEAFIRSVQESFFSSPETSPESVGSYEGSPVSSPGSPPVCPFLSTSVAQGALQVGFKRNRVSSLMINRFILTGSCYGSVSELVTDLIRAEEIHGTESVSVPRAPTQRERPEPPKEPAPPLSTEEQLRQLKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSV 380          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 96.2857 bits (238), Expect = 6.516e-21
Identity = 90/376 (23.94%), Postives = 151/376 (40.16%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLAN-----LKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENL--PRT--AFHYSNCSNIKSLNSYDDLR-IKNTVPKNDDRNNFCQVEYSITADEIEAR------LDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDL------KGFVDDNYQRR-----------------NCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R E ER +SF  +P    ++ P ++A++GFYY G     D+V+C  C GVL  W+  D P  EH+K FP+CPFL        +   P    + +   L   +GE     +         E    D     +T+ + AN     L+       +    + +KC+ C+     L+N E    P T  A  +  C  +  +     +R ++ +   + + +      Y  +             L +  A    Q+ + R  V  ++  +   TG  Y S+ + ++DL       G    +  R                  +    L  +  ++ C VC+D  V++VF+PCGHL  C +C+  L  CP+CR  I   V
Sbjct:    2 RSEAERQRSFRAWPHTCRTVSPAELARSGFYYLG---PGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCPFL------QVRRGPPGGTDSVDGQILGQLSGEEPDRTWEPVCPQMAGEG---DRLGSFSTWPRYANGDPQQLQLAGAGFFYTGHRDHVKCFHCDGG---LRNWEQGDDPWTEHAKWFPMCDFLLQVKGEAFIRSVQESFFSSPETSPESVGSYEGSPVSSPGSPPVCPFLSTSVAQGALQVGFKRNRVSSLMINRFILTGSCYGSVSELVTDLIRAEEIHGTESVSVPRAPTQRERPEPPKEPAPPLSTEEQLRQLKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSV 362          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 70.8626 bits (172), Expect = 1.128e-12
Identity = 51/175 (29.14%), Postives = 78/175 (44.57%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLAN--LKFLCFDGLF-VFKNEFLKCYKCNKSVPILKNVEN 853
            R E ER +SF  +P    ++ P ++A++GFYY G     D+V+C  C GVL  W+  D P  EH+K FP+CPFL        +   P    + +   L   +GE     +         E    D     +T+ + AN   + L   G F     + +KC+ C+     L+N E 
Sbjct:   40 RSEAERQRSFRAWPHTCRTVSPAELARSGFYYLG---PGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCPFL------QVRRGPPGGTDSVDGQILGQLSGEEPDRTWEPVCPQMAGEG---DRLGSFSTWPRYANGDPQQLAGAGFFYTGHRDHVKCFHCDGG---LRNWEQ 199          

HSP 2 Score: 67.3958 bits (163), Expect = 1.661e-11
Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNL 568
            E +RL SF  +P+  +    ++A AGF+Y G++   D VKC  C G L  W++ DDP  EH K FP C FLL +
Sbjct:  150 EGDRLGSFSTWPRYANGDPQQLAGAGFFYTGHR---DHVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDFLLQV 220          

HSP 3 Score: 55.4546 bits (132), Expect = 1.161e-7
Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            L  +  ++ C VC+D  V++VF+PCGHL  C +C+  L  CP+CR  I   V
Sbjct:  286 LRQLKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSV 337          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Match: crebrf (CREB3 regulatory factor [Source:Xenbase;Acc:XB-GENE-988760])

HSP 1 Score: 69.3218 bits (168), Expect = 8.728e-12
Identity = 40/107 (37.38%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  251 EHYRNIYASPENFIKRKVDYS-RMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNL 568
            EH R+    P  F+K     S R  V +   +    RLK+F ++P  +     ++A+AGFYY G    +D VKC  C G L  W+  DDP  EH K FP C +LL++
Sbjct:  260 EHRRHFPNCP--FVKSSTRVSSRFSVSNVSMQASSARLKTFASWPPRIPISPTRLAEAGFYYVG---RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLHI 361          

HSP 2 Score: 68.1662 bits (165), Expect = 1.977e-11
Identity = 38/96 (39.58%), Postives = 52/96 (54.17%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLN---LNVGNEKYSDPSNKSANEDP 625
            E  RL +F  FP         +AKAGFYY G   + D+VKC  C  +L  WKK D+   +HKK +P+C F+ N   +N+G   YS  S  ++N  P
Sbjct:   67 ELYRLSTFSTFPSNTHVSERNLAKAGFYYTG---QDDKVKCFTCGLMLDNWKKGDNAFEKHKKLYPSCSFIQNVPSVNLGASLYSAFSPPASNSTP 159          

HSP 3 Score: 59.3066 bits (142), Expect = 1.246e-8
Identity = 32/86 (37.21%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  305 DYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            D S +++ +  Y +E  RL SF  +      L P ++AKAGFY+ G     D+V C  C G L+ W+  D+ + EH++ FP CPF+
Sbjct:  192 DLSHVRISEYMYTEE-ARLNSFQEWSNMF--LTPAELAKAGFYFVG---PGDKVACFTCDGKLNNWEPNDNAMSEHRRHFPNCPFV 271          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 100.908 bits (250), Expect = 4.212e-22
Identity = 87/353 (24.65%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSD-------PSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  NV     S        P++ ++  +P +  +   I          V F             T+    N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ ++  R    +   S+T    +    +    +  ++ +  K +KK +E+K++++G  Y S+   ++DL     DN +  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTG---ADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARI----------VTFG------------TWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRT--AEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487          

HSP 2 Score: 64.3142 bits (155), Expect = 2.334e-10
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            DE++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H++  P C F+
Sbjct:   20 DEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTG---EGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFI 93          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 100.908 bits (250), Expect = 4.212e-22
Identity = 87/353 (24.65%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSD-------PSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  NV     S        P++ ++  +P +  +   I          V F             T+    N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ ++  R    +   S+T    +    +    +  ++ +  K +KK +E+K++++G  Y S+   ++DL     DN +  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTG---ADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARI----------VTFG------------TWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRT--AEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487          

HSP 2 Score: 64.3142 bits (155), Expect = 2.334e-10
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            DE++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H++  P C F+
Sbjct:   20 DEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTG---EGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFI 93          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 100.908 bits (250), Expect = 4.212e-22
Identity = 87/353 (24.65%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSD-------PSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  NV     S        P++ ++  +P +  +   I          V F             T+    N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ ++  R    +   S+T    +    +    +  ++ +  K +KK +E+K++++G  Y S+   ++DL     DN +  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTG---ADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARI----------VTFG------------TWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRT--AEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487          

HSP 2 Score: 64.3142 bits (155), Expect = 2.334e-10
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            DE++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H++  P C F+
Sbjct:   20 DEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTG---EGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFI 93          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 100.908 bits (250), Expect = 4.212e-22
Identity = 87/353 (24.65%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSD-------PSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  NV     S        P++ ++  +P +  +   I          V F             T+    N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ ++  R    +   S+T    +    +    +  ++ +  K +KK +E+K++++G  Y S+   ++DL     DN +  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTG---ADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARI----------VTFG------------TWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRT--AEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487          

HSP 2 Score: 64.3142 bits (155), Expect = 2.334e-10
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            DE++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H++  P C F+
Sbjct:   20 DEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTG---EGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFI 93          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Match: Birc3 (baculoviral IAP repeat-containing 3 [Source:MGI Symbol;Acc:MGI:1197007])

HSP 1 Score: 72.4034 bits (176), Expect = 3.398e-13
Identity = 37/83 (44.58%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYS 592
            E  RL +++ +P  LS L P K+AKAGFYY G     D+V C  C G LS W++ DD + EH++ FP+CPFL +L     +Y+
Sbjct:  169 EKARLLTYETWP--LSFLSPAKLAKAGFYYIG---PGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYT 246          

HSP 2 Score: 68.1662 bits (165), Expect = 9.417e-12
Identity = 40/107 (37.38%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  251 EHYRNIYASPENFIK-RKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNL 568
            EH R+  + P  F+K      SR  V +   +    R+++F N+P        ++A AGFYY G+   SD VKC  C G L  W+  DDP  EH K FP C +LL +
Sbjct:  224 EHQRHFPSCP--FLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAGFYYTGH---SDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLRI 325          

HSP 3 Score: 65.4698 bits (158), Expect = 6.853e-11
Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  323 VFDEKY--RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDP 598
             F+ KY    E  RL ++  FP+ +      +A+AGFYY G    +D+VKC  C  +L  WK+ D P+ +H+K +P+C F+  LN  N   + P
Sbjct:   19 TFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTG---ANDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASP 109          
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Match: sp|Q8JHV9|BIR7A_XENLA (Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.008e-23
Identity = 94/373 (25.20%), Postives = 155/373 (41.55%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAF--HYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEAR-LDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCS------------------------NDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R E ERL+SF  +P+      P +MA++GFYY G     D+V+C  C GVL  W+  D P  EH+K FP+C FL       ++  DP    A +   L   +GE     + +++    +E  +     R        N + L   G F     + +KC+ C+  +        P  ++ +  P   F  H    + I+ +      R   + P +     + +   S        R L S  A    Q+ + + +V  +I+ K   TG  Y S+   ++DL    ++ +   + S                          L  +  ++ C VC+DK V+++F+PCGHL  C +C+  L  CP+CR  I   V
Sbjct:   38 RSEAERLRSFSAWPRTCPQPSPVEMARSGFYYLG---PGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCTFL------QQQQRDP---GATDSQILGQHSGEEPDRTW-ESVYPEMAEERDRLDSFRNWPMYAHGNPEHLAGSGFFYTGHRDNVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDFLLHVKGEAFIRRVQE-SLFRSPESSPDSLGSYIYDRSPASSPGSPESWRYLQSSVAQDALQMGFKQSLVASLIQSKFLLTGSSYSSVSDLVTDLLVAEEETHSTESVSVSRAPTRMERSEPPKESAPPLSTEEQLRRLKEERMCKVCMDKDVSMLFVPCGHLVVCTECAPNLRHCPICRAAIRGSV 396          
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Match: sp|Q5BKL8|XIAP_XENTR (E3 ubiquitin-protein ligase XIAP OS=Xenopus tropicalis OX=8364 GN=xiap PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.036e-22
Identity = 96/356 (26.97%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSV--------PILKNVENLPRTAF-------HYSNCSNIKS--LNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRR-----NCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKR 1345
            E  RL++F N+P   S L PK +A AG +Y G    +DQVKC  C G L  W+  D    EHKK FP C F+L  +VGN      ++       +L       + N Y   +E   S +   D E+       LA   F       +   +  KC+ C   +        P  ++ +  P   F       H+ N + +K   L+  +       +PK+ +                   L S      +Q+ +  + +KKV+ +KLK+TGK+Y  + +F+SDL    +   ++      +    L  +  ++ C VC+D+ +++VF+PCGHL  C  C+  L  CP+C  ++E+R
Sbjct:  169 EEARLQTFQNWPA-YSPLTPKELANAGLFYTGI---NDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRDVGNVATEANTHGGRRRGSELAC----PAMNDYNARLETFSSWSFPIDKET-------LAKAGFYS-----IGDGDATKCFHCGGVLNCWSATDDPWEEHAKAYPGCKFLIDEKGQHFINHAQLKRPILHKANSADASPALPKDSNL------------------LKSPLVTDAQQMGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDLCAQKETVLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICCTIVERR 486          

HSP 2 Score: 64.6994 bits (156), Expect = 1.278e-9
Identity = 31/81 (38.27%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLN 571
            D+ Y +E  RL SF NFP       P +A+AGFYY G+    D+VKC  C  ++  W+  D  + +H+K  P C F+   N
Sbjct:   31 DQNYFEEEVRLASFANFPSSYPVSAPALARAGFYYTGD---GDRVKCFSCLAMVEGWQHGDTAIGKHRKISPNCKFINGFN 108          
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Match: sp|A5D8Q0|XIAP_XENLA (E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 5.623e-22
Identity = 98/341 (28.74%), Postives = 153/341 (44.87%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFK-NEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDL----KGFVDDNYQRRNCSND--LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKR 1345
            E  RL++F N+P   S L+PK +A AG +Y G    +DQVKC  C G L  W+  D    EHKK FP C F+L  +VGN             D  ++   G    N Y   +E   S     D E    T AK    +    D    F     L C+  N   P  ++ +  P   F        K     ++ +++  +    +       E S    +  + L +      +Q+ +  + +KKV+ +KLK+TG +Y  + +F+SDL       + D   +R  S +  L  +  ++ C VC+D+ + +VF+PCGHL  C  C+  L  CP+C  +IE+R
Sbjct:  173 EEARLQTFQNWPG-YSPLMPKELANAGLFYTGI---NDQVKCFCCGGKLMNWEPSDRAWTEHKKHFPECYFVLGRDVGN----------VTRDASVQ---GSTYMNSYNARLETFSSWPFPIDKE----TLAKAGFYRIGDEDATKCFSCGGMLNCWAANDD-PWEEHAKAYPGCQFLIEE----KGQQFINNAQLQRPILHKANSG-----EASPALPKDTSFLKNPLVIYAQQMGFPLEEIKKVMGQKLKTTGNNYTCVEEFVSDLLCAQSETIADKPMKREISIEEKLRQLEEEKVCKVCMDRRITIVFIPCGHLVACAVCADVLDKCPICCTIIERR 482          

HSP 2 Score: 62.003 bits (149), Expect = 8.529e-9
Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLN 571
            D+ Y +E  RL SF NF        P +A+AGFYY G+    D+VKC  C  ++  W+  D  + +H+K  P C F+   N
Sbjct:   31 DQNYFEEEVRLASFANFSSSYPVSAPALARAGFYYTGD---GDRVKCFSCMAMVEDWQHGDTAIGKHRKISPNCKFINGFN 108          
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Match: sp|A9ULZ2|BIR7B_XENLA (Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis OX=8355 GN=birc7-b PE=2 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.378e-21
Identity = 84/362 (23.20%), Postives = 142/362 (39.23%), Query Frame = 2
Query:  308 YSRMKVFDEKYRKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKL-----ANLKFLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            +    +     R E ER +SF  +P+    L P ++A++GFYY G     D+V+C  C GVL  W+  D P  EH+K FP+CPFL       ++   P    + +   L   +GE     +    E  + E  E  +  R  +F+        + + L   G F     + +KC+ C+  +        P  ++ +  P   F          + S  +    +  P  +   ++   +Y           D   A+  E +   R        +  K +G    +  Q                     L+ +  ++ C VC+DK V+++F+PCGHL  C +C+  L  CP+CR  I   V
Sbjct:   30 WGAPGMLRPSMRSEAERQRSFRAWPRSCPQLSPVELARSGFYYLG---PGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCPFL------QQQQRGPGATDSVDGQVLGQLSGEEPDRTW----EPVYPEMSEEQV--RLGSFSTWPLDVPGSPEVLAGAGFFYTGHRDHVKCFHCDGGLQNWEQGDDPWTEHAKWFPMCDFLL-QVKGEAFIRSVQESLFSSPEPSPESLGSY---DY-----------DRSLASSTESVSVPRAPTPGERSEPPKVSGPPLSTEEQ---------------------LQRLKEERMCKVCMDKDVSMLFVPCGHLVVCTECAPNLRHCPICRAAIRGSV 340          
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Match: sp|Q60989|XIAP_MOUSE (E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 2.946e-21
Identity = 87/353 (24.65%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPK-MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSD-------PSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVF-KNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNI---KSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLE----------YILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLI 1336
            E  RLKSF N+P + + L P+ +A AG YY G     DQV+C  C G L  W+  D    EH++ FP C F+L  NV     S        P++ ++  +P +  +   I          V F             T+    N + L   G +   + + +KC+ C   +   K  E+   + A  Y  C  +   K     +++ + +++ ++  R    +   S+T    +    +    +  ++ +  K +KK +E+K++++G  Y S+   ++DL     DN +  +    L+           +  ++ C +C+D+ +A+VF+PCGHL TC  C+  +  CP+C  +I
Sbjct:  163 EEARLKSFQNWP-DYAHLTPRELASAGLYYTG---ADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARI----------VTFG------------TWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRT--AEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVI 487          

HSP 2 Score: 64.3142 bits (155), Expect = 1.632e-9
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            DE++ +EF RLK+F NFP         +A+AGF Y G   E D V+C  C   + +W+  D  V  H++  P C F+
Sbjct:   20 DEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTG---EGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFI 93          
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Match: A0A3Q2D1D2 (Baculoviral IAP repeat containing 7 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.043e-28
Identity = 106/401 (26.43%), Postives = 179/401 (44.64%), Query Frame = 2
Query:  311 SRMKVFDE-KYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTF-----AKLANLKFLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAF-------HYSNCSNIKSLNSYDDLRIKNTVPKND--DRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDL------KGFVDDNYQRRNCSND-------------------------LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + +++ +E + R E ERL +F N+P +      ++AKAGF++ G+    D+V+C  C G+L  W++ D+PV EHK+ FPTC F+L   VGN      S+ S   D  L +    ++ +  G   +  + E +E + +SR TTF       L     L   G F     + +KC+ C+  +        P  ++ +  PR  F        Y N       +  D +    T  + D   RN+       +      + + S     V Q+ ++  +V+ +++ K   TG+ Y S+ + +SD+      +     N Q  N S+                          L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:    7 TMLRILEEPRMRGEVERLCTFQNWPSDAPVASGELAKAGFFFLGS---GDKVQCFCCGGILRYWEQGDNPVVEHKRHFPTCSFILGQAVGNIPLETGSSDSV--DGQLLSQLQRLTMDDQGTTGQAVYPE-LEAE-DSRLTTFHNWPSEALVQPDVLAHAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIQSRGQEYINNIQDAHFHMGDTVGGSQTTTRRDIGARNDL------VGGLGASSAMLSPVVQTVLQMGFEASVVESLVQTKYLLTGQHYISVSELVSDVLQAEEEERQTGQNNQEPNTSHGSSAETVRTETPIPKRAIKDQNPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 394          
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Match: A0A3Q2TZ12 (Baculoviral IAP repeat containing 7 OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.290e-27
Identity = 99/381 (25.98%), Postives = 166/381 (43.57%), Query Frame = 2
Query:  329 DEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIE-SRETTF-----AKLANLKFLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSY---DDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDL-------------KGFVDDNYQRRNCSND-----LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            D +   E ERL++F N+P E       +AKAGF++ G+    D+V+C  C GVL  W+  D P  EHK+ FPTC F+L   VGN   +  S+ S +          ++        +    +   E + E SR  TF       L     L   G F     + +KC+ C+  +        P  ++ +  PR  F   +      SNI+  +S+     + + + +P     +    +  S       + + S     V Q+ ++  +V+ +++ K   TG+ Y  + + +SD+                V   Y +R+         L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:    5 DPRMLGELERLRTFHNWPAEAPVASGDLAKAGFFFLGS---GDKVQCFCCGGVLRYWEPGDSPAVEHKRHFPTCSFILGRAVGNIPLAAGSSDSVD-----GQLLSQLQRMTMDDQVTAGQAAYPEMEAEDSRLATFHNWPSEALVQPDVLAQAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIQSRGQEYISNIQDAHSHLAPGFMSLSSLLPPPFPSDLVGGLGAS-------SAMLSPIVQTVLQMGFEASVVESLVQTKYLLTGQHYTLVSELVSDVLQAEEEERQTGPNSTGVAGAYLQRSLGRPYPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 370          
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Match: A0A3Q3XEK6 (Baculoviral IAP repeat containing 7 OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.635e-27
Identity = 100/378 (26.46%), Postives = 169/378 (44.71%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKL---ANLK--FLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQR-------RNCSNDLEYILY----------------DQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            R+E ER+++F N+P + +     +AKAGF++ G     D+V+C  C G+L  W   D P  EHK+ FPTC F+L   VGN      S+ S   D  L +    ++ +  G   +  + E    D  SR TTF      A+++   L   G F     + +KC+ C+  +        P  ++ +  PR  F   +      SNI+  +      +  T       N       +++     + + S     V Q+ ++  +V+ +++ K   TG+ Y S+   +SD+     ++ +R         C   L+Y+                  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   14 RREGERIRTFHNWPADAAVTSGDLAKAGFFFLG---PGDKVRCFCCGGILRCWVHGDSPAVEHKRHFPTCGFILGRAVGNIPLQVGSSDSV--DGQLLSQLQRMTMDDQGTAGQAVYPEMEAED--SRLTTFHNWPTEASVQPDVLATAGFFYTGHGDNVKCFYCDGGLRNWEPGDDPWQEHAKWFPRCEFLIQSRGQEYISNIQDAH----FHLGETGGSQTSTN-------TVSGLAASSAMLSPVVQTVLQMGFETSLVESLVQTKYLLTGQQYTSVSDLVSDVLQAEQEDRERAPQSPGKSRCGRYLQYLSTVLSTSVPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 373          
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Match: A0A060YJZ5 (RING-type domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00022368001 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.353e-27
Identity = 99/382 (25.92%), Postives = 171/382 (44.76%), Query Frame = 2
Query:  335 KYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGN-EKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTF-----AKLANLKFLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSN-------DLEYILY-----------------DQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + R E ERL++F+N+P +       +A+AGF++       D+VKC  C G+L  W   D P+ EHK+ FPTC  ++   VGN   Y  P + S + D  L +    ++ +  G   +  + E +E + ESR TTF             L   G F     + +KC+ C+  +        P  ++ +  PR  F          SNI+  +   +    +  P + + N+   V   +    + + + S     V Q+ ++  +V+ +++ K    G+ Y S+   ++D+    +++  RR  S         + +I Y                 ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR  I   V
Sbjct:   32 QMRGEEERLRTFENWPGDAPVTATNLARAGFFFL---EPDDKVKCFCCGGILRYWVHGDSPIVEHKRHFPTCSLVMGRAVGNIPLYVVPGSPSDSVDGQLLSQLQRMTVDDQGAAGQAVYPE-MESE-ESRLTTFHNWPTGAAVQPDVLSRAGFFYTGHGDNVKCFYCDGGLRNWEPGDDPWQEHAKWFPRCDFLIQTRGRDYVSNIQDTHFNIETVGVSQTPVSREMNSENDV---VGGLGVPSAMLSPVVQTVLQMGFEAGLVEGLVQTKYLLNGQHYTSVSGLVTDILAAEEEDRTRRPQSRGQSKNGEGIHFIHYQAVGDPTPDELLRQLQEERTCKVCMDKRVSIVFIPCGHLVVCSDCAASLRHCPICRATIRGSV 405          
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Match: A0A3Q3GJ05 (Baculoviral IAP repeat containing 7 OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.399e-27
Identity = 102/402 (25.37%), Postives = 180/402 (44.78%), Query Frame = 2
Query:  305 DYSRMKVFDE-KYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKL---ANLK--FLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSY--DDLRIKNTVPKND--DRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSND------------------------------LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            D + +++ +E + R E ERL++F ++P +       +AKAGF++ G     D+V+C  C G+L  W + D P  EHK+ FPTC F+  L VGN      S+ S   D  L +    ++ +  G   +  + E    D  SR T+F      A+++   L   G F     + +KC+ C+  +        P  ++ +  PR  F   +      +NI+  + +  D +    T    D   RNN       +      + + S     V Q+ ++  +V+ +++ +   TG+ Y S+ + ++D+    +++ QR   S +                              L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   20 DRTLLQLLEEPQMRGEGERLQTFQSWPADAPVTSGDLAKAGFFFLG---PGDEVQCFCCGGILRHWVRGDHPDAEHKRHFPTCSFIQGLAVGNIPLQAGSSDSV--DGQLLSQLQRMTMDDQGTAGQAVYPEMEAED--SRLTSFHNWPTEASVQPDVLARAGFFYTGHGDNVKCFYCDGGLRNWEPGDDPWQEHAKWFPRCEFLIQSRGQEYITNIQDAHFHLGDTVGGSQTSTGGDVGSRNNL------VGGWAASSAVLSPVVQTVLQMGFEVSLVESLVQTRYLLTGRHYTSVSELVTDVLQAEEEDRQREPSSTESETRQGSSAGNVRTQTPAREKVKDPSPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 408          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 117.472 bits (293), Expect = 3.886e-28
Identity = 92/367 (25.07%), Postives = 165/367 (44.96%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV--YGKNIEVNFSENIEFDIESRETTFAKLANLK--------FLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRR---------NCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            E ERL+SF+++  +       +A+AGFY+ G     D V+C  C GVL  W   D+P+ EHK+ FPTC F+L  +VGN   +  S       PD  + +G++   +   G + +V+  + +  ++E+ +T      N           L   G F     + +KC+ C+  +        P  ++ +  PR  +          +NI+  +        +  P   +     +V    +A  + A + S       Q+ + R +V+ +++ +   TG  Y S+   ++D+    ++  Q           +    L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   47 EEERLRSFEHWATDSPVSPTDLARAGFYFLGY---GDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGS-------PD--SVDGQLLSQLQRMGVDEQVSVGQAVYPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNNIQQSHFNMSEMSGSQTPAAGNIPTGHEVLSGQSA--VVAAMLSPVVQTALQMGFQRALVESLVQSRYLLTGHHYTSVSDLVADVLQAEEEERQGSQSRPVTGNLSAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRAVIRGSV 399          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 110.538 bits (275), Expect = 3.398e-26
Identity = 90/342 (26.32%), Postives = 152/342 (44.44%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV--YGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCS-NIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSR---FANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSND--LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            E ERL+SF+++  +       +A+AGFY+ G     D V+C  C GVL  W   D+P+ EHK+ FPTC F+L  +VGN   +  S       PD  + +G++   +   G + +V+  + +  ++E+ +T               L  F+N     +    SV      + L +  F Y+    N+K    + D  ++N  P +D        E++      E  L +R   + N ++Q  +                  +   M    +   G +   +   N S +  L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   47 EEERLRSFEHWATDSPVSPTDLARAGFYFLGY---GDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGS-------PD--SVDGQLLSQLQRMGVDEQVSVGQAVYPEMEAEDTR--------------LTTFQN-----WPPGASV----QPDTLAQAGFFYTGHGDNVKCF--FCDGGLRNWEPGDDPWQ-----EHAKWFPRCEYLLQTRGREYVNNIQQSHF------------------NMSEMSGSQTPAAGNIPTGHVTGNLSAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRAVIRGSV 328          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 109.768 bits (273), Expect = 1.927e-25
Identity = 94/389 (24.16%), Postives = 167/389 (42.93%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV--YGKNIEVNFSENIEFDIESRETTFAKLANLK--------FLCFDGLF-VFKNEFLKCYKCNKSV--------PILKNVENLPRTAFHYSN-----CSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQ----------RRNCSND---------------------LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            E ERL+SF+++  +       +A+AGFY+ G     D V+C  C GVL  W   D+P+ EHK+ FPTC F+L  +VGN   +  S       PD  + +G++   +   G + +V+  + +  ++E+ +T      N           L   G F     + +KC+ C+  +        P  ++ +  PR  +          +NI+  +        +  P   +     +V    +A  + A + S       Q+ + R +V+ +++ +   TG  Y S+   ++D+    ++  Q          R+  S                       L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   47 EEERLRSFEHWATDSPVSPTDLARAGFYFLGY---GDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGS-------PD--SVDGQLLSQLQRMGVDEQVSVGQAVYPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNNIQQSHFNMSEMSGSQTPAAGNIPTGHEVLSGQSA--VVAAMLSPVVQTALQMGFQRALVESLVQSRYLLTGHHYTSVSDLVADVLQAEEEERQGSQSRPEPVVRQGGSTGEVRTQTSVGEKVTGNLSAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRAVIRGSV 421          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Match: xiap (X-linked inhibitor of apoptosis [Source:NCBI gene;Acc:103037921])

HSP 1 Score: 108.997 bits (271), Expect = 6.111e-25
Identity = 86/350 (24.57%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  341 RKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSVPILK-NVENLPRTAFHYSNCSNIKS------LNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFV--DDNYQRRNCSND-----LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + E  RL +F N+P         + +AG ++  + + +D V+C  C G+LS W+  DDP  EH K +  C F+L  +VGN         S++    L+ F G +           +F + +         +  +LA   F         + + + C+KC   V   + N +     A HY  CS + +      +NS      +   P     N F + E +         + S  A K  ++ +D   V++ I +K++ T + Y ++   + D+   V   D+   +   N+     LE +  ++ C VC+D  +++VF+PCGHL TC  CS  +  CP+C  +I +++
Sbjct:  139 KSEEARLMTFSNWPSSSPVQPSDLVQAGLFHVADTTLNDLVQCFCCGGMLSGWEDGDDPWSEHSKFYRNCFFILGHDVGNIPSEMLRLGSSSHRSPLETFEGRLD----------SFRDRL------HPISHERLARAGFYS-----TGERDRVICFKCGGGVKEWQPNEDPWEEHAKHYPGCSFLLAEKGQEFVNSVQLRNPRGRNPNASTENGFSRHERASNV------MQSEIAQKAVEMGFDPIKVERTILEKIRQTSEGYSTVETLIQDITNNVYDGDSDMLQEAENEDPLKTLEKLQREKLCKVCMDSDISIVFIPCGHLVTCKRCSDSVEKCPICCSVITQKI 461          

HSP 2 Score: 70.4774 bits (171), Expect = 1.819e-12
Identity = 39/105 (37.14%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL---LNLNVGNEKYSDPSNKSANEDPDLKNF---NGEI 652
            RL SF  FP   S    ++A+AGFY+ G   +SDQV+C  CQ  +  W + D PV  H++  P+C FL      N+ ++ YS+ S+ + +ED +   F    GEI
Sbjct:   25 RLSSFQAFPHTQSLSAERLARAGFYFTG---QSDQVRCFSCQKTVENWHQGDTPVERHREVSPSCKFLSCAHRRNLIDDHYSESSSSNYDEDAEAMEFRLRTGEI 126          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 73.1738 bits (178), Expect = 1.720e-13
Identity = 49/172 (28.49%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  347 EFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV--YGKNIEVNFSENIEFDIESRETTFAKLANLK--------FLCFDGLF-VFKNEFLKCYKCNKSV 829
            E ERL+SF+++  +       +A+AGFY+ G     D V+C  C GVL  W   D+P+ EHK+ FPTC F+L  +VGN   +  S       PD  + +G++   +   G + +V+  + +  ++E+ +T      N           L   G F     + +KC+ C+  +
Sbjct:   47 EEERLRSFEHWATDSPVSPTDLARAGFYFLGY---GDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGS-------PD--SVDGQLLSQLQRMGVDEQVSVGQAVYPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHGDNVKCFFCDGGL 206          

HSP 2 Score: 68.5514 bits (166), Expect = 4.998e-12
Identity = 32/70 (45.71%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLN 565
            RL +F N+P   S     +A+AGF+Y G+    D VKC FC G L  W+  DDP  EH K FP C +LL 
Sbjct:  165 RLTTFQNWPPGASVQPDTLAQAGFFYTGH---GDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQ 231          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 62.7734 bits (151), Expect = 1.345e-10
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 1190 DLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            +L+ +     C VC+DK V+VVF+PCGHL  C DC+S L  CP+CR ++   V
Sbjct:  519 ELKRLQEQHTCKVCMDKEVSVVFIPCGHLVVCRDCASSLRKCPICRAVVRGTV 571          

HSP 2 Score: 62.3882 bits (150), Expect = 1.405e-10
Identity = 57/235 (24.26%), Postives = 98/235 (41.70%), Query Frame = 2
Query:  299 KVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYN------------------VYGKNIEVNFSENIEFDIESRE----TTFAKLANLKF--LCFDGL-FVFKNEFLKCYKCNKSVPILKNVE--NLPRTAF--HYSNCSNIKSLNSYD 916
            KV    M    +   K   RL  F N P  L   +  +AKAGF+Y G +   D+V+C  C+GV+  WK  D  + +H +SFP C F  +L    +  +              N   EI+++                      N+E     N E  +E+      +T+ + + ++   L   GL +V  N+ + C+ C+    ++++ E  ++P      H+S C+  K   SY+
Sbjct:   12 KVKKESMSFPIDDLSKHIYRLGRFVNCPSNLEPRIRDLAKAGFFYTGKE---DKVECFSCKGVIGNWKSGDSAIAKHLQSFPNCTFARSLAQATDTQTSGGASVPRHIVAATNNASEITHHHSLPPSIGMNEPPMQNTLTSLPNVEAGVPSNSEMCVEANRLLSFSTWPESSPVRPADLARAGLYYVGPNDRVACFYCSG---VMRDWEEGDVPAKEHERHFSTCAFAKDSASYN 240          

HSP 3 Score: 62.3882 bits (150), Expect = 1.480e-10
Identity = 29/70 (41.43%), Postives = 39/70 (55.71%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLN 565
            RL ++  +P   +     +A AGFYY G+    D VKC  C G L  W++ D+P +EH K FP C FLL 
Sbjct:  252 RLATYQAWPSTANVAAQPLAIAGFYYTGH---GDNVKCFHCDGGLRNWEQGDNPWYEHGKWFPRCAFLLQ 318          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Match: rffl (ring finger and FYVE-like domain containing E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-040426-2274])

HSP 1 Score: 51.6026 bits (122), Expect = 2.485e-7
Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 2
Query: 1220 CVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            C +C+D P+  V L CGH+ TC  C  +++ CP+CRQ + + V
Sbjct:  340 CKICMDAPIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAV 382          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Match: birc6 (baculoviral IAP repeat containing 6 [Source:ZFIN;Acc:ZDB-GENE-091202-7])

HSP 1 Score: 49.2914 bits (116), Expect = 2.470e-6
Identity = 28/90 (31.11%), Postives = 43/90 (47.78%), Query Frame = 2
Query:  296 RKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPK--MAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            R VD S M  + E  R+E     +F ++P           MA+AGFY+    +  D+  C  C   L  W+  D+P  EH++  P CP++
Sbjct:  242 RPVDRSLM--YSEANRRE-----TFTSWPHAHYRWAQPDPMAQAGFYHQPTSNGDDRAMCFTCSVCLVSWEPTDEPWSEHERHSPNCPYV 324          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006592.1 (pep scaffold:Pmarinus_7.0:GL484173:814:7294:1 gene:ENSPMAG00000005951.1 transcript:ENSPMAT00000006592.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 7.319e-6
Identity = 21/45 (46.67%), Postives = 29/45 (64.44%), Query Frame = 2
Query: 1214 QWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            + CVVC DK  AV+F PCGH+  C +C+S +  C  CR  ++ RV
Sbjct:  131 EECVVCSDKRAAVLFQPCGHMCACDNCASLMKKCVQCRSTVDVRV 175          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Match: birc5a (baculoviral IAP repeat containing 5a [Source:ZFIN;Acc:ZDB-GENE-030826-1])

HSP 1 Score: 44.669 bits (104), Expect = 8.083e-6
Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 2
Query:  356 RLKSFDN-FP-KELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            R K++D+ +P KE  +  P +MA AGF +  +  E D V C FC   L  W++ D P+ EHKK    C FL
Sbjct:   19 RRKTYDDRWPFKENCACTPEQMAIAGFLHQPSDLELDAVICFFCFKELDGWEQDDVPLIEHKKHSSDCGFL 89          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Match: EDO35786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK5])

HSP 1 Score: 60.4622 bits (145), Expect = 4.842e-10
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV 664
            R+++F+ +P   S+ V ++A+AGF + G     D V+C  C+G L +WK  D P+  H++ +P CP L  L+    K ++  + +     DLK+ N  ++  +
Sbjct:  138 RVRTFNFWPATSSANVFELARAGFVFTGR---DDVVECFKCKGTLKQWKVDDRPIESHREFYPDCPLLTELD----KNANKVDATVTRLKDLKDVNDGVARRI 233          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Match: EDO32646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG7])

HSP 1 Score: 53.1434 bits (126), Expect = 1.737e-8
Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 2
Query:  347 EFERLKSFDNFP---KELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            E +RL++F ++P    +      KMA AGFY+     + D  +C  C   L  W+  DDP  EHKK  P C F+
Sbjct:   13 EKKRLETFKDWPFNHMDCKCTAEKMAAAGFYHCETDDDPDVARCFVCFKELDGWEPEDDPWQEHKKHSPKCEFV 86          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Match: EDO43423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU6])

HSP 1 Score: 56.225 bits (134), Expect = 2.794e-8
Identity = 21/43 (48.84%), Postives = 31/43 (72.09%), Query Frame = 2
Query: 1220 CVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            CV+CLD    VV LPCGH+  C +C+  +++CP+CRQ + +RV
Sbjct:  698 CVICLDNRSDVVMLPCGHVCCCSNCAGAVSACPICRQTLSQRV 740          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Match: EDO30381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y6])

HSP 1 Score: 54.6842 bits (130), Expect = 3.896e-8
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            LE +  ++ C +C+D  V +VFLPCGHL  C  C+  +  CP+CR  I + +
Sbjct:  276 LERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGMELCPMCRAPIRETI 327          

HSP 2 Score: 54.299 bits (129), Expect = 6.362e-8
Identity = 30/78 (38.46%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  356 RLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKY 589
            RL+S+ ++P+       ++A AGFYY G     DQV+C  C   L KW   D+P  EH K  P+C F+L  N+ +E +
Sbjct:    7 RLESYIHWPENCPVRPRELAMAGFYYTGC---GDQVRCFSCDLQLGKWVDGDEPFEEHLKHRPSCGFILE-NLQSEHH 80          

HSP 3 Score: 51.9878 bits (123), Expect = 3.129e-7
Identity = 27/77 (35.06%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  332 EKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLL 562
            E  + E  RL +F ++P+       +++ AGFYY G++   D VKC  C   L  W+  D P  EH+K  P CP ++
Sbjct:   73 ENLQSEHHRLTTFVDWPESSPVRPWELSSAGFYYLGDQ---DSVKCYKCGVALRNWEPDDLPWVEHEKWSPHCPLVI 146          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Match: EDO44591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV74])

HSP 1 Score: 54.299 bits (129), Expect = 4.482e-8
Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 2
Query: 1211 DQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            D+ C VC+D  +  V L CGH+  CI+CS +LA CP+CRQ I + V
Sbjct:  253 DESCKVCMDNLIDCVLLECGHMVACINCSKQLAECPICRQNISRIV 298          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Match: ENSORLT00000034629.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 114.39 bits (285), Expect = 3.502e-27
Identity = 95/385 (24.68%), Postives = 163/385 (42.34%), Query Frame = 2
Query:  338 YRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGL------FVFKNEFLKCYKCNKSV--------PILKNVENLPRTAF--HYSNCSNIKSL-NSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSND-------------------------------LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
             R+E ERL++F N+P E       +AKAGFY+ G++   D+V+C  C G+L  W   D P  EH + FP C F+L   VGN      S+     D  L +    ++ +  G   +  + E    D  SR TTF    +   +  D L      +    + +KC+ C+  +        P  ++ +  PR  F  H      I ++ +++  L       +     +       +      + + S     V Q+ ++  +V+ +++ K   TG+ Y S+   ++D+    ++  QR   S +                               L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:   17 MRRERERLQTFQNWPDEAPVTSEDLAKAGFYFLGSE---DKVRCFCCGGILRHWADGDCPTAEHSRHFPNCKFILGQAVGNIPLQPGSSDFV--DGQLLSQLQRMTMDDQGTAGQAVYPEMEAED--SRLTTFHNWPSEASIQPDALASAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIHSRGQDYINNIQDAHFHLGNSGEGSQTPPGRDIGSTHDMVGGLGASSAMLSPVVQTVLQMGFEDSLVQSLVQTKYLLTGQHYTSVSDLVTDVLQAEEEERQRGANSREPDIRRSSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 394          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Match: xiap (E3 ubiquitin-protein ligase XIAP [Source:NCBI gene;Acc:101166883])

HSP 1 Score: 83.1889 bits (204), Expect = 9.422e-17
Identity = 96/378 (25.40%), Postives = 168/378 (44.44%), Query Frame = 2
Query:  338 YRKEFERLKSFDN--FPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNI--EVNFSENIEFDIE-SRETTFAKL-----ANLKFLCFDGLF-VFKNEFLKCYKCNKSVPILKNVEN-LPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLE---------YDRXXXXXXXXXXXXSTGKDYD---------------SMH-----QFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            Y K   RL+SF N  + K++S L  ++A+AGF + G    SD+V+C  CQ  +  W + D PV  H +  P+C FL   +  N   S+P    +N         G I Y +  + I  E  +  N     E +R  TF+          + L   GLF + K + ++C+ C   +   K  +        H+S+C  I   +   ++ ++    +N++  +  Q    +  + ++ RL + FA     ++         Y +    +VI  +     KD+D               S+H     + L+  + FV    + +N   +LE +  ++ C +CLD+   +VF+PCGHL +C  CS+KL  CP+C   I +++
Sbjct:   18 YSKINNRLESFYNSSWSKKVSPL--QLAEAGFLFTG---VSDRVRCFSCQKTVENWSQEDQPVDRHIQVSPSCTFLRCTHF-NRFKSNPHMPLSNGGLH-DGTEGYIDYQLRTRAIVDETPYPRNRNMKSEEARLETFSSWPRSAPVRPRDLAQAGLFYLGKEDKVECFSCGGKLSGWKPGDTPWNEHEKHFSHCFYILG-HDVGNVPLERDGGENEETGSRNQHRTPVNLENLDERLGT-FARVQHPIDHELLAKAGFYSKGEGDEVICFRCGGGLKDWDPEDNPWEEHMAIDVFSLHDKGGQRALTSAQSFV--GVKLKNPLEELEKLRQEKRCKICLDENACIVFIPCGHLASCKACSNKLNQCPICCAAIAQKI 384          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Match: xiap (E3 ubiquitin-protein ligase XIAP [Source:NCBI gene;Acc:101166883])

HSP 1 Score: 82.8037 bits (203), Expect = 1.121e-16
Identity = 98/365 (26.85%), Postives = 162/365 (44.38%), Query Frame = 2
Query:  338 YRKEFERLKSFDN--FPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNI--EVNFSENIEFDIE-SRETTFAKL-----ANLKFLCFDGLF-VFKNEFLKCYKCNKSVPILKNVENLPRTAF--HYSNCSNI--KSLNSYDDLRIKNTVPKNDDR-NNFCQVEYSITADEIEARLDSRFANKVEQLEY-------DRXXXXXXXXXXXXSTGKDYDSMH-----QFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            Y K   RL+SF N  + K++S L  ++A+AGF + G    SD+V+C  CQ  +  W + D PV  H +  P+C FL   +  N   S+P    +N         G I Y +  + I  E  +  N     E +R  TF+          + L   GLF + K + ++C+ C   +   K  +  P      H+S+C  I    + + +  R    +   D+R   F +V++ I   + E    + F +K E  E          K          +    D  S+H     + L+  + FV    + +N   +LE +  ++ C +CLD+   +VF+PCGHL +C  CS+KL  CP+C   I +++
Sbjct:   18 YSKINNRLESFYNSSWSKKVSPL--QLAEAGFLFTG---VSDRVRCFSCQKTVENWSQEDQPVDRHIQVSPSCTFLRCTHF-NRFKSNPHMPLSNGGLH-DGTEGYIDYQLRTRAIVDETPYPRNRNMKSEEARLETFSSWPRSAPVRPRDLAQAGLFYLGKEDKVECFSCGGKLSGWKPGDT-PWNEHEKHFSHCFYILGHDVGNVNQHRTPVNLENLDERLGTFARVQHPI---DHELLAKAGFYSKGEGDEVICFRCGGGLKDWDPEDNPWEEHMAIDVFSLHDKGGQRALTSAQSFV--GVKLKNPLEELEKLRQEKRCKICLDENACIVFIPCGHLASCKACSNKLNQCPICCAAIAQKI 369          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Match: birc2 (baculoviral IAP repeat-containing protein 2 [Source:NCBI gene;Acc:101172600])

HSP 1 Score: 75.485 bits (184), Expect = 6.163e-14
Identity = 91/394 (23.10%), Postives = 149/394 (37.82%), Query Frame = 2
Query:  323 VFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDP----------------------VHEHKKSFPTC-----------------PFLLNLNVGNEKYSD------PSNKSANE---DPDLKNFNGEISYNVYGKN---IEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSV-PILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            V +   ++  +R  +F N+P  +     ++AKAGFYY G    +D VKC  C G L  W+  DDP                      VH+ +  FP                   P +++L  G ++  D      P  KSA E   +  L     +      G+N   ++   S+ +  + + RE     LA  + +  DG    K       +  KSV P+L+++              N+ S   Y  L  + +  +   R     +E  +      A +   F N +++ +            +  S  +D       LSDL                L  +  ++ C VC+DK V +VF+PCGHL  C +C+  L  CP+CR L++  V
Sbjct:  350 VSNPSMQQSEDRRLTFVNWPSRIPVRPEQLAKAGFYYVGR---NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLQEKGQDFVHQIQARFPRLFEQLLTNGENSSREFVDPPVVHLGPGEDRSEDAVMMNTPVIKSALEMGFERSLVKQTVQSKILTSGENYRTVQELVSDLLSAEDQKREEEREMLA--EAMASDGFTFVKRHQAALIQRLKSVEPVLEHLRE-----------QNVLSAEEYGSLLAQTSAQQQTAR----LIELVLNKGNAAAEV---FRNWIQKNDVHLLRDLMAQSNEASSPSQD-------LSDLP-----------MEEQLRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGLVKGTV 702          

HSP 2 Score: 63.1586 bits (152), Expect = 4.727e-10
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  302 VDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVP-KMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFL 559
            + + R    +   R+E +RL SF   P  +S + P ++AKAGFYY G   ++D+V C  C G LS W+  D  V EH++ +P C F+
Sbjct:  238 LSHQRPTCHNPSMRREQDRLDSFQ--PWAISIITPAELAKAGFYYLG---QNDRVACFSCGGQLSNWEPGDRAVSEHQRHYPNCRFV 319          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Match: ENSORLT00000012200.2 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 70.8626 bits (172), Expect = 7.640e-13
Identity = 34/77 (44.16%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  335 KYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLN 565
            +   E  RL +F N+P E S     +A AGF+Y G+    D VKC FC G L  W+  DDP  EH K FP C FL++
Sbjct:   95 EMEAEDSRLTTFHNWPSEASIQPDALASAGFFYTGH---GDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIH 168          

HSP 2 Score: 62.7734 bits (151), Expect = 3.701e-10
Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 2
Query: 1193 LEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRV 1348
            L  +  ++ C VC+DK V++VF+PCGHL  C DC++ L  CP+CR +I   V
Sbjct:  307 LRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSV 358          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Match: SMESG000081058.1 (SMESG000081058.1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 428/439 (97.49%), Postives = 432/439 (98.41%), Query Frame = 2
Query:   65 MSTINLQNKTFELNFHHGKEKYWLTPTEGSTITKKIKEDRDYKKIKVSYGGYTSQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFDGNTTS 1381
            MSTINLQNKTF LNFHHGKEKYWLTPTEGSTITK IKEDRDYKKI+VS G YTSQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNG+ISYNVYGKNIEVNFSENIEFDIESRETTFAKLA LKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLR+KNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRKIVKKVIEKKLKSTGKDYDSM+QFLSDLKGFVDDNYQ RNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFD NTTS
Sbjct:    1 MSTINLQNKTFVLNFHHGKEKYWLTPTEGSTITKIIKEDRDYKKIEVSNGSYTSQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGKISYNVYGKNIEVNFSENIEFDIESRETTFAKLAYLKFLCFDGLFVFKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRVKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRKIVKKVIEKKLKSTGKDYDSMYQFLSDLKGFVDDNYQHRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFDWNTTS 439          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 307.76 bits (787), Expect = 1.895e-99
Identity = 171/386 (44.30%), Postives = 241/386 (62.44%), Query Frame = 2
Query:  224 SQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEV---NFSENIEFDIESRETTFAKLANLKFLCFDGLFV---FKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKF 1363
            +Q    + + HYRNI+A+PENFIKRKVDYS+MKVF+EKYRKEFER+ SF          V  +AK+GFYY  N    DQVKCI+CQG +S W+K D P+ +HK  FPTCPF++ LNVGNE     + KS NEDPD+K  + ++   +     ++   +F +  + DI+ RE TFA+  NLK     G F      + +++C  C   + +LK +ENL  +  H +NC      N+ +DL  KN         +FC VE+S+  DEIEAR+++RF +++    YDRK ++   E +LK+ GKD++S+++   +L+  V +N  +R  S   E+ L +  CVVCLDKPV VVFLPCGHL+TC+DCS  + +CPVCR  I+KRV   KF
Sbjct:    9 AQKPITANLIHYRNIFANPENFIKRKVDYSKMKVFEEKYRKEFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYENEKSPNEDPDVKKPSEKVEVIIPIVQSDICLESFDKIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNC----KFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRE-SFGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 389          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 307.375 bits (786), Expect = 3.727e-99
Identity = 171/386 (44.30%), Postives = 241/386 (62.44%), Query Frame = 2
Query:  224 SQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEV---NFSENIEFDIESRETTFAKLANLKFLCFDGLFV---FKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKF 1363
            +Q    + + HYRNI+A+PENFIKRKVDYS+MKVF+EKYRKEFER+ SF          V  +AK+GFYY  N    DQVKCI+CQG +S W+K D P+ +HK  FPTCPF++ LNVGNE     + KS NEDPD+K  + ++   +     ++   +F +  + DI+ RE TFA+  NLK     G F      + +++C  C   + +LK +ENL  +  H +NC      N+ +DL  KN         +FC VE+S+  DEIEAR+++RF +++    YDRK ++   E +LK+ GKD++S+++   +L+  V +N  +R  S   E+ L +  CVVCLDKPV VVFLPCGHL+TC+DCS  + +CPVCR  I+KRV   KF
Sbjct:   20 AQKPITANLIHYRNIFANPENFIKRKVDYSKMKVFEEKYRKEFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYENEKSPNEDPDVKKPSEKVEVIIPIVQSDICLESFDKIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNC----KFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRE-SFGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 400          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 308.145 bits (788), Expect = 4.322e-99
Identity = 172/392 (43.88%), Postives = 244/392 (62.24%), Query Frame = 2
Query:  224 SQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEV---NFSENIEFDIESRETTFAKLANLKFLCFDGLFV---FKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFDGNTTS 1381
            +Q    + + HYRNI+A+PENFIKRKVDYS+MKVF+EKYRKEFER+ SF          V  +AK+GFYY  N    DQVKCI+CQG +S W+K D P+ +HK  FPTCPF++ LNVGNE     + KS NEDPD+K  + ++   +     ++   +F +  + DI+ RE TFA+  NLK     G F      + +++C  C   + +LK +ENL  +  H +NC      N+ +DL  KN         +FC VE+S+  DEIEAR+++RF +++    YDRK ++   E +LK+ GKD++S+++   +L+  V +N  +R  S   E+ L +  CVVCLDKPV VVFLPCGHL+TC+DCS  + +CPVCR  I+KRV   KF  +T +
Sbjct:    9 AQKPITANLIHYRNIFANPENFIKRKVDYSKMKVFEEKYRKEFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYENEKSPNEDPDVKKPSEKVEVIIPIVQSDICLESFDKIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNC----KFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRE-SFGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKFRRSTIN 395          
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 308.145 bits (788), Expect = 4.618e-99
Identity = 172/392 (43.88%), Postives = 244/392 (62.24%), Query Frame = 2
Query:  224 SQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLKSFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDDPVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNVYGKNIEV---NFSENIEFDIESRETTFAKLANLKFLCFDGLFV---FKNEFLKCYKCNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNNFCQVEYSITADEIEARLDSRFANKVEQLEYDRXXXXXXXXXXXXSTGKDYDSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLPCGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFDGNTTS 1381
            +Q    + + HYRNI+A+PENFIKRKVDYS+MKVF+EKYRKEFER+ SF          V  +AK+GFYY  N    DQVKCI+CQG +S W+K D P+ +HK  FPTCPF++ LNVGNE     + KS NEDPD+K  + ++   +     ++   +F +  + DI+ RE TFA+  NLK     G F      + +++C  C   + +LK +ENL  +  H +NC      N+ +DL  KN         +FC VE+S+  DEIEAR+++RF +++    YDRK ++   E +LK+ GKD++S+++   +L+  V +N  +R  S   E+ L +  CVVCLDKPV VVFLPCGHL+TC+DCS  + +CPVCR  I+KRV   KF  +T +
Sbjct:   20 AQKPITANLIHYRNIFANPENFIKRKVDYSKMKVFEEKYRKEFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYENEKSPNEDPDVKKPSEKVEVIIPIVQSDICLESFDKIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNC----KFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRE-SFGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKFRRSTIN 406          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XIAP6.696e-2226.48X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP6.696e-2226.48X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP6.696e-2226.48X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
NAIP2.014e-1434.56NLR family apoptosis inhibitory protein [Source:HG... [more]
NAIP2.049e-1434.56NLR family apoptosis inhibitory protein [Source:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Det1.080e-1135.48gene:FBgn0264291 transcript:FBtr0083408[more]
Diap23.233e-1044.29gene:FBgn0015247 transcript:FBtr0087297[more]
Diap23.233e-1044.29gene:FBgn0015247 transcript:FBtr0087296[more]
CG170194.849e-944.23gene:FBgn0033783 transcript:FBtr0087806[more]
CG170194.849e-944.23gene:FBgn0033783 transcript:FBtr0339738[more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc74.750e-2626.39baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
birc72.942e-2426.11baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
xiap4.539e-2224.56X-linked inhibitor of apoptosis [Source:ZFIN;Acc:Z... [more]
xiap4.539e-2224.56X-linked inhibitor of apoptosis [Source:ZFIN;Acc:Z... [more]
birc21.097e-1046.48baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fasn1.955e-2326.97fatty acid synthase [Source:Xenbase;Acc:XB-GENE-10... [more]
arsa.15.392e-2124.60arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
arsa.16.516e-2123.94arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
arsa.11.128e-1229.14arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
crebrf8.728e-1237.38CREB3 regulatory factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xiap4.212e-2224.65X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap4.212e-2224.65X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap4.212e-2224.65X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap4.212e-2224.65X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Birc33.398e-1344.58baculoviral IAP repeat-containing 3 [Source:MGI Sy... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JHV9|BIR7A_XENLA2.008e-2325.20Baculoviral IAP repeat-containing protein 7-A OS=X... [more]
sp|Q5BKL8|XIAP_XENTR1.036e-2226.97E3 ubiquitin-protein ligase XIAP OS=Xenopus tropic... [more]
sp|A5D8Q0|XIAP_XENLA5.623e-2228.74E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis... [more]
sp|A9ULZ2|BIR7B_XENLA1.378e-2123.20Baculoviral IAP repeat-containing protein 7-B OS=X... [more]
sp|Q60989|XIAP_MOUSE2.946e-2124.65E3 ubiquitin-protein ligase XIAP OS=Mus musculus O... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2D1D21.043e-2826.43Baculoviral IAP repeat containing 7 OS=Cyprinodon ... [more]
A0A3Q2TZ122.290e-2725.98Baculoviral IAP repeat containing 7 OS=Fundulus he... [more]
A0A3Q3XEK65.635e-2726.46Baculoviral IAP repeat containing 7 OS=Mola mola O... [more]
A0A060YJZ57.353e-2725.92RING-type domain-containing protein OS=Oncorhynchu... [more]
A0A3Q3GJ059.399e-2725.37Baculoviral IAP repeat containing 7 OS=Kryptolebia... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc73.886e-2825.07baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc73.398e-2626.32baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc71.927e-2524.16baculoviral IAP repeat-containing protein 7 [Sourc... [more]
xiap6.111e-2524.57X-linked inhibitor of apoptosis [Source:NCBI gene;... [more]
birc71.720e-1328.49baculoviral IAP repeat-containing protein 7 [Sourc... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc21.345e-1047.17baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
rffl2.485e-741.86ring finger and FYVE-like domain containing E3 ubi... [more]
birc62.470e-631.11baculoviral IAP repeat containing 6 [Source:ZFIN;A... [more]
ENSPMAT00000006592.17.319e-646.67pep scaffold:Pmarinus_7.0:GL484173:814:7294:1 gene... [more]
birc5a8.083e-640.85baculoviral IAP repeat containing 5a [Source:ZFIN;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO357864.842e-1030.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326461.737e-836.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434232.794e-848.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303813.896e-840.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445914.482e-850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034629.13.502e-2724.68baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
xiap9.422e-1725.40E3 ubiquitin-protein ligase XIAP [Source:NCBI gene... [more]
xiap1.121e-1626.85E3 ubiquitin-protein ligase XIAP [Source:NCBI gene... [more]
birc26.163e-1423.10baculoviral IAP repeat-containing protein 2 [Sourc... [more]
ENSORLT00000012200.27.640e-1344.16baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
back to top
BLAST of E3 ubiquitin-protein ligase XIAP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081058.10.000e+097.49SMESG000081058.1[more]
SMESG000023072.11.895e-9944.30SMESG000023072.1[more]
SMESG000023072.13.727e-9944.30SMESG000023072.1[more]
SMESG000023072.14.322e-9943.88SMESG000023072.1[more]
SMESG000023072.14.618e-9943.88SMESG000023072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011545 ID=SMED30011545|Name=E3 ubiquitin-protein ligase XIAP|organism=Schmidtea mediterranea sexual|type=transcript|length=1734bp
GATATATTTTGACTTAATATTTTAAAACAGTTTATTAAATAAACATTTAA
CATCCTGTTTGTAAATGTCTACCATAAATCTTCAAAATAAGACATTTGAG
TTGAACTTTCATCACGGAAAGGAAAAGTATTGGTTAACGCCTACAGAAGG
ATCAACTATAACAAAGAAAATCAAGGAAGATAGAGATTATAAGAAAATAA
AAGTTTCTTACGGGGGTTACACTAGTCAAAATTCTACAGTGAGTACAATT
GAGCATTACAGGAATATTTATGCTTCGCCAGAAAATTTTATTAAAAGAAA
AGTTGATTATAGTCGAATGAAAGTTTTTGATGAAAAATATAGAAAAGAAT
TCGAAAGATTAAAATCATTTGATAATTTTCCAAAAGAGCTTTCTTCTTTA
GTTCCTAAAATGGCAAAAGCAGGATTTTATTATTTTGGTAATAAGTCAGA
ATCTGATCAAGTTAAATGCATATTTTGTCAAGGTGTTTTATCAAAATGGA
AGAAATTGGATGATCCTGTGCATGAACACAAAAAGTCATTCCCAACTTGT
CCATTTCTATTAAATTTAAATGTCGGAAATGAAAAATACAGTGATCCGTC
GAACAAATCAGCAAATGAAGATCCTGATTTAAAAAATTTCAATGGAGAAA
TATCTTACAATGTTTATGGAAAGAATATTGAAGTAAATTTTTCTGAAAAC
ATTGAATTTGATATTGAATCCAGAGAAACAACATTTGCAAAGCTGGCTAA
TTTAAAATTTCTATGCTTTGATGGTTTATTTGTATTTAAAAACGAATTTT
TAAAATGCTATAAATGTAACAAATCCGTTCCAATATTGAAAAATGTTGAA
AATTTACCTCGAACGGCCTTTCATTACTCCAATTGCAGCAACATAAAATC
GCTTAATAGTTACGATGATCTGAGAATTAAAAATACTGTACCCAAGAATG
ATGATAGAAATAATTTTTGTCAGGTCGAGTATTCGATAACTGCCGATGAA
ATTGAAGCAAGATTGGATTCAAGATTCGCTAATAAAGTCGAGCAATTAGA
ATACGATCGTAAAATTGTGAAAAAAGTAATTGAAAAAAAACTCAAAAGTA
CCGGCAAGGATTATGATTCAATGCATCAGTTCTTAAGTGATCTGAAAGGT
TTTGTCGATGACAATTACCAACGCAGAAACTGTTCCAATGATTTAGAGTA
TATACTTTATGATCAATGGTGTGTTGTATGTCTAGACAAGCCAGTTGCGG
TTGTATTCTTACCTTGCGGACACTTGAGAACTTGCATTGATTGCTCTAGC
AAGTTAGCGAGTTGCCCAGTTTGTCGGCAGCTCATAGAAAAGCGAGTTTG
TGGAATTAAATTTGATGGGAATACAACTTCTTGATTTTTACTTTATCAAT
TGAAACACAAATAATAATAATAATCAGTGAACTTACTTTAATTTATTATG
ACAGATTCTATTTCTATTGTAATATTTATTTACTAATGCTATTAATACCA
ATATTTATATTCCACGTGTTTCATTCGAAAGTACTTTTTAAATTTTTTTG
CTGAAAAATTTGCTAACAATTTAGTGGCATTTGAATTTTCGAATTATTGT
TTTACCAATGCGGTGCGGTTGCTATTGGATGCAATAATAAAAGGAAATTA
ATAAAATTTCATATTGCAATGCCAATGTAGTTTCTACTAAAATTGGAAAT
TATTGAAAATTTTATTAAACTTTTTCATGTTTAC
back to top

protein sequence of SMED30011545-orf-1

>SMED30011545-orf-1 ID=SMED30011545-orf-1|Name=SMED30011545-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MSTINLQNKTFELNFHHGKEKYWLTPTEGSTITKKIKEDRDYKKIKVSYG
GYTSQNSTVSTIEHYRNIYASPENFIKRKVDYSRMKVFDEKYRKEFERLK
SFDNFPKELSSLVPKMAKAGFYYFGNKSESDQVKCIFCQGVLSKWKKLDD
PVHEHKKSFPTCPFLLNLNVGNEKYSDPSNKSANEDPDLKNFNGEISYNV
YGKNIEVNFSENIEFDIESRETTFAKLANLKFLCFDGLFVFKNEFLKCYK
CNKSVPILKNVENLPRTAFHYSNCSNIKSLNSYDDLRIKNTVPKNDDRNN
FCQVEYSITADEIEARLDSRFANKVEQLEYDRKIVKKVIEKKLKSTGKDY
DSMHQFLSDLKGFVDDNYQRRNCSNDLEYILYDQWCVVCLDKPVAVVFLP
CGHLRTCIDCSSKLASCPVCRQLIEKRVCGIKFDGNTTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0042802identical protein binding
GO:0043027cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006974cellular response to DNA damage stimulus
GO:0016567protein ubiquitination
GO:0031398positive regulation of protein ubiquitination
GO:0043066negative regulation of apoptotic process
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051402neuron apoptotic process
GO:0090263positive regulation of canonical Wnt signaling pathway
GO:1902530positive regulation of protein linear polyubiquitination
GO:1990001inhibition of cysteine-type endopeptidase activity involved in apoptotic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR001370BIR_rpt
IPR013083Znf_RING/FYVE/PHD