Minichromosome maintenance 9 homologous recombination repair factor

Overview
NameMinichromosome maintenance 9 homologous recombination repair factor
Smed IDSMED30011540
Length (bp)3524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Minichromosome maintenance 9 homologous recombination repair factor (SMED30011540) t-SNE clustered cells

Violin plots show distribution of expression levels for Minichromosome maintenance 9 homologous recombination repair factor (SMED30011540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Minichromosome maintenance 9 homologous recombination repair factor (SMED30011540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Minichromosome maintenance 9 homologous recombination repair factor (SMED30011540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011540

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011540SMESG000023015.1 SmedASXL_007418SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011540SMESG000023015.1 SmedASXL_007418SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011540SMESG000023015.1 SMED_10747_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011540SMESG000023015.1 SMED_10747_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Match: MCM9 (minichromosome maintenance 9 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:21484])

HSP 1 Score: 509.605 bits (1311), Expect = 1.276e-160
Identity = 294/650 (45.23%), Postives = 424/650 (65.23%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDM----GVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ IF+S   +   + L  +     V++ +   N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F +  +F +    +T   P  C +  S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN IQ VN+  S+   +  E++ +F+ FWE Y    F  RN++++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+K+YF  IR+   P ++   + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V+VMES++ G  +L     L ++FP +P E+Y+     I +KL+++S +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQ---NLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQ-VNNEQSSGIIMDEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRN-LQPTLSDVGNQVLLRYYQMQRQSDCRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Match: MCM9 (minichromosome maintenance 9 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:21484])

HSP 1 Score: 509.605 bits (1311), Expect = 1.276e-160
Identity = 294/650 (45.23%), Postives = 424/650 (65.23%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDM----GVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ IF+S   +   + L  +     V++ +   N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F +  +F +    +T   P  C +  S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN IQ VN+  S+   +  E++ +F+ FWE Y    F  RN++++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+K+YF  IR+   P ++   + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V+VMES++ G  +L     L ++FP +P E+Y+     I +KL+++S +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQ---NLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQ-VNNEQSSGIIMDEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRN-LQPTLSDVGNQVLLRYYQMQRQSDCRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Match: MCM9 (minichromosome maintenance 9 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:21484])

HSP 1 Score: 261.536 bits (667), Expect = 3.939e-77
Identity = 158/388 (40.72%), Postives = 234/388 (60.31%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDM----GVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGL 1247
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ IF+S   +   + L  +     V++ +   N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F +  +F +    +T   P  C +  S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN IQ VN+  S+   +  E++ +F+ FWE Y    F  RN++++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AG+
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQ---NLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQ-VNNEQSSGIIMDEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGI 385          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 228.409 bits (581), Expect = 3.238e-61
Identity = 193/639 (30.20%), Postives = 319/639 (49.92%), Query Frame = 3
Query:   81 IEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINEC-----ETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQT--FESSKESFNL---------------------EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            +E  H F N L  ++  +H  ++       FK+ I++      E+LV+  + +   +    ++ +L     +L++IF+    +++ +    M     +   +  VRI+ LP  +E+      + + + + +  +  V     +       +Y C KC F V+  F +S        P  C    S   +  F++     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++      N   V   VILAN +   ++ ++       ++K+   L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K++ R++ TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+VIAA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++        S+KE   L                     E LK Y  Y +   HPK+       + K Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  193 LEIHHRFKNFLRTHVD-SHGHNV-------FKERISDMCKENRESLVVNYEDLAAREHV--LAYFLPEAPAELLQIFDEAALEVVLA----MYPKYDRITNHIHVRISHLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNF-VLGPFCQSQNQEV--KPGSCPECQS---AGPFEV----NMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEK------IFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVM 798          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 215.698 bits (548), Expect = 2.720e-57
Identity = 128/323 (39.63%), Postives = 189/323 (58.51%), Query Frame = 3
Query: 1008 LLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQT--FESSKESFNL---------------------EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K++ R++ TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+VIAA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++        S+KE   L                     E LK Y  Y +   HPK+       + K Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  408 MIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVM 730          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 214.157 bits (544), Expect = 4.618e-57
Identity = 176/536 (32.84%), Postives = 273/536 (50.93%), Query Frame = 3
Query:  375 QVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDI-VESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDEC--VIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLC-GSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-NHQTFESS-----KESFNLEK----------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            +VRI+ LP  ++I    + + V +   +  A  V  A  I       +Y C  C + +     ++D       P  C +         F++ VE++        N Q I +QE    ++ G +PR+  VIL  DL D  KPGD++ + G     ++      +   V   +I AN I   +   S+  + +     D +   E     + + R  + S + P IYG   +K A+AL L  G         ++RG+ ++L+ GDPGTAKSQFL++A  + PRSVLTTG G++  GLT    +   +  W+LEAGA+VLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L  RC+VIAA+NP  G Y+ T++   N  +  P+LSRFD++ ++ D+ +   D  ++ F++ NH+T         KE   LE+                L+ Y  Y R   HP +  + S      +  MRK  +      IT+R +ES+IRLS++HA+  +R +V +ED   A+ VM
Sbjct:  258 KVRISQLPVEEDIR---MLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVR---PTICPSCQG---KGPFELNVENT-----VYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFPVFNTLIHANHITNKDKMASDQLTDE-----DIKAIRELSQDPNISQR--VFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVM 772          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 214.157 bits (544), Expect = 4.618e-57
Identity = 176/536 (32.84%), Postives = 273/536 (50.93%), Query Frame = 3
Query:  375 QVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDI-VESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDEC--VIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLC-GSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-NHQTFESS-----KESFNLEK----------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            +VRI+ LP  ++I    + + V +   +  A  V  A  I       +Y C  C + +     ++D       P  C +         F++ VE++        N Q I +QE    ++ G +PR+  VIL  DL D  KPGD++ + G     ++      +   V   +I AN I   +   S+  + +     D +   E     + + R  + S + P IYG   +K A+AL L  G         ++RG+ ++L+ GDPGTAKSQFL++A  + PRSVLTTG G++  GLT    +   +  W+LEAGA+VLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L  RC+VIAA+NP  G Y+ T++   N  +  P+LSRFD++ ++ D+ +   D  ++ F++ NH+T         KE   LE+                L+ Y  Y R   HP +  + S      +  MRK  +      IT+R +ES+IRLS++HA+  +R +V +ED   A+ VM
Sbjct:  258 KVRISQLPVEEDIR---MLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVR---PTICPSCQG---KGPFELNVENT-----VYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFPVFNTLIHANHITNKDKMASDQLTDE-----DIKAIRELSQDPNISQR--VFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVM 772          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Match: mcm-7 (DNA replication licensing factor MCM7 [Source:UniProtKB/TrEMBL;Acc:O16297])

HSP 1 Score: 200.29 bits (508), Expect = 2.890e-53
Identity = 157/500 (31.40%), Postives = 254/500 (50.80%), Query Frame = 3
Query:  432 KSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKL-SPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIR-RWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-HQTF----ESSKESFNLEKLKSYFAYIRSTFHPKMTPE-ASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVME 1898
            K+ ++G  +S+   V+RA  ++       Y C  C      E  +        PP  C N    CV +  +     +L   KF +  QE+ +QE  + +  G +PRT+ V +  ++      G+ V ++G  +    +  R     V    + A+ I    + + +N +       + ++   K  G ++     L + + P I+G   +K  L + L G  +   NGMK+RG  ++L++GDPG AKSQ L + ++L PRS  TTG GS+  GLT   +K+  +G  SLE GALVLADGGICCIDEF  + + D+ AIHE MEQQ+IS+AKAGI+  L  R ++IAA NP  G Y+  +SI  N  + + LLSRFDLI L+ D  +   D  +++ I   HQ         K+  +LE L+ Y +  + T+ P + P     I+E Y    R +  ++    ++ R +  ++R++ + A+  +   V E D   A+ +M+
Sbjct:  166 KATEIGHLVSMKGVVIRATEVKPCVEVMTYTCDTCA----AEVYQPVKGMQFTPPVNCPNKE--CVEAKANGRLHMQLRGSKFVK-FQELKIQELSEQVPVGSIPRTMTVHVYGEMTRKCNTGNVVHVSGVFLPIMQSGFRPTGGLVADTYLEAHYI----NNLDDNPTFNGVQSAELEVLRRK--GDNYET---LAASIAPEIFGHVDVKKCLLMALVGGNDNSSNGMKIRGCINVLMMGDPGVAKSQLLGYVNRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMSLEGGALVLADGGICCIDEFDKMMDHDRTAIHEVMEQQTISIAKAGIMTTLNARTAIIAAANPAYGRYNPNRSIEQNVDLPAALLSRFDLILLMQDKADRENDKILAEHITYVHQHGCHPNREKKDLISLETLREYISLCK-TYTPTVDPALRERIVEAYVEMRRDARYSSDPTFVSPRMILGIVRMATARAKLRLSTIVDESDVEEALRLMQ 648          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Match: mcm-6 (DNA replication licensing factor mcm-6 [Source:UniProtKB/Swiss-Prot;Acc:P34647])

HSP 1 Score: 185.652 bits (470), Expect = 7.447e-50
Identity = 113/255 (44.31%), Postives = 165/255 (64.71%), Query Frame = 3
Query: 1107 GMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-NHQTFESSKES---FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLD---RITMRFLESLIRLSQSHARF 1841
            G  +RG+ ++ +VGDP TAKSQ LK   + +PR++ T+G  S+ AGLT   VK  ES  + +EAGAL+LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R S++AA NP  G YD ++ +  N  +++P++SRFDL F+L+D CNE  D  ++  IL NH+      E    + ++ +K Y A+ R  F PK++ +A+  L + Y  +R S+  N+     RIT+R LESL+RLS++ AR 
Sbjct:   90 GTSLRGDINVCLVGDPSTAKSQVLKAVEEFSPRAIYTSGKASSAAGLTAAVVKDEESFEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARASILAAANPVNGRYDRSRPLKYNVQMSAPIMSRFDLFFVLVDECNEVTDYAIARRILDNHRAISEHTERDSVYKIDDIKKYIAFAR-CFKPKISDKAAETLVREYKKLRMSDSNNAATSSWRITVRQLESLVRLSEALARL 343          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Match: mcm-6 (DNA replication licensing factor mcm-6 [Source:UniProtKB/Swiss-Prot;Acc:P34647])

HSP 1 Score: 190.66 bits (483), Expect = 1.111e-49
Identity = 170/521 (32.63%), Postives = 265/521 (50.86%), Query Frame = 3
Query:  444 VGKFLSVAATVVRAGSIQVLEFQRE-YICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-----------------RRWNNLRVND--------------ECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKS-FTARNL---------LISQMCPLIYGMY--FLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-NHQTFESSKES---FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLD---RITMRFLESLIRLSQSHARF 1841
            VG  + +A  +VR   +   E  R  ++C+ C  +      +    F    P  C+N    C++ + F +  +S     F    Q+I +QE    L  G +PRT+ VI+  ++V+ V+PGD   I GT+I                    N  R  D              +   ++  LA  IQ     +  + S   E + D+   W K   +   T + +         ++  + P IYG +   L + L L+   ++     G  +RG+ ++ +VGDP TAKSQ LK   + +PR++ T+G  S+ AGLT   VK  ES  + +EAGAL+LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R S++AA NP  G YD ++ +  N  +++P++SRFDL F+L+D CNE  D  ++  IL NH+      E    + ++ +K Y A+ R  F PK++ +A+  L + Y  +R S+  N+     RIT+R LESL+RLS++ AR 
Sbjct:  130 VGGLVRIAGQIVRTHPVHP-ELSRACFVCEDCGVTT----RDVQQQFRYTQPTKCAN--PQCMNRTRFSLDVNSSTFVDF----QKIRIQETQAELPRGSIPRTVDVIVRGEMVETVQPGDKCDIVGTLIVIPDIAQLSTPGLRAETSNQNRGRATDKSEGITGLKALGVRDLTYKMAFLACHIQQTESLVGGDASGAVE-ETDYLDLWSKMSTEDRATLKKMSDDKKIEKNIVDSLFPNIYGNHEVKLGVLLMLLGGVAKKSRDEGTSLRGDINVCLVGDPSTAKSQVLKAVEEFSPRAIYTSGKASSAAGLTAAVVKDEESFEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARASILAAANPVNGRYDRSRPLKYNVQMSAPIMSRFDLFFVLVDECNEVTDYAIARRILDNHRAISEHTERDSVYKIDDIKKYIAFAR-CFKPKISDKAAETLVREYKKLRMSDSNNAATSSWRITVRQLESLVRLSEALARL 637          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 227.254 bits (578), Expect = 2.830e-61
Identity = 190/596 (31.88%), Postives = 301/596 (50.50%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDEC--VIQLVILANEI------QIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCF-FNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-HQTFESSK--------------ESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAF 1955
            ++ +L     ++++IF+   AK +  S+      +  EI    VRI+ LP  +E+ RT   + + + + +     V     +       +Y C KC + V+  F +S  +  I P       S+G  S          +     RN Q+I +QE    +  G +PR+  VIL  DL D  KPGD++ + G     ++     D+   V   VI+AN +      Q+V      + +   ++  D ++               +++ M P IYG  ++K ALAL L G E+       KVRG+ ++LI GDPGTAKSQFLK+  K+ PR+V TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+VIAA NP  G YD + + + N  ++ P+LSRFD++ ++ D  +   D  ++ F+++ H     S+              +    + L+ Y  Y +    PK+T      + K Y  +R+         IT+R +ES+IR+S++HAR  +RE V E D  MA+ +M  +   +   S  +++ S F
Sbjct:  229 LAYFLPEAPFQMLEIFDK-VAKDMVLSIFPTYERVTTEI---HVRISELPLIEEL-RTF--RKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGY-VLGPFVQSQNT-EIKPGSCPECQSTGPFSI--------NMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVER------------VVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQKFSVMKKMRSTF 795          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Match: Mcm6 (gene:FBgn0025815 transcript:FBtr0070952)

HSP 1 Score: 196.438 bits (498), Expect = 1.723e-51
Identity = 177/539 (32.84%), Postives = 268/539 (49.72%), Query Frame = 3
Query:  369 NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSN-YSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-------------RRWNNLRVN----------------DECVIQLVILANEIQIVNHTISNNYSIKSEM---KLDFQLF---WEKYHGKSFTARNL---LISQMCPLIYGMYFLKLALALV-LCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-HQTFESSKE-SFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLD---RITMRFLESLIRLSQSHARF 1841
            +C V  T +P   ++   +  K   +G  + ++  VVR   +        ++C  C+     E    +  F    P  C N   S       D+ +S  L      + Q+I +QE    L  GC+PR +++IL  +LV+ V+ GD     GT+I             R  N+ R                   E   ++  LA  +Q             SE+    +  Q+    W K +  S   RNL   LIS + P IYG   +K  + L    G          +RG+ ++ IVGDP TAKSQFLK     +PR++ T+G  S+ AGLT   V+  ES  + +EAGAL+LAD GICCIDEF  + + D+VAIHEAMEQQ+IS+A+AG+   L  R S++AA NP  G YD ++S+  N  +++P++SRFDL F+L+D CNE  D  ++  I++ H   E S E ++  E++  Y  + R  F P ++ EA  +L + Y  +R+ +   S     RIT+R LES+IRLS++ A+ 
Sbjct:  103 DCYVAFTEVPTRHKVRDLTTSK---IGTLIRISGQVVRTHPVHPELVSGVFMCLDCQ----TEIRNVEQQFKFTNPTICRNPVCSNRKRFMLDVEKSLFL------DFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMS-KDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNIEESVERAYTREEVLRYVTFARQ-FKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKL 626          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 179.104 bits (453), Expect = 4.295e-46
Identity = 132/374 (35.29%), Postives = 210/374 (56.15%), Query Frame = 3
Query: 1011 LISQMCPLIYGMYFLKLALA-LVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-------HQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRK--SEITNSLDR-----ITMRFLESLIRLSQSHARFMMREFVKEEDA-----VMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEE-YRLLKLNIFKKLQIKSFIPPNNPGIVQD 2060
            L   + P I+G   +K A+  ++  GS     +G+  RG+ ++L++GDPGTAKSQ LKF  K+ P +V T+G GS+ AGLT + +K+  +  + +E GA+VLADGG+ CIDEF  +RE D+VAIHEAMEQQ+IS+AKAGI   L +RCSV+AA N   G +D T+    N      +LSRFD+IF++ D  +ES D  ++  I+N           E ++   +L   K Y  Y R+   P+++  A   L+  Y  MR    +   + D+     IT+R LE++IR+S+S A+  ++ F  +E       +  V+ +++ + GS   +        F T+ ++E    ++  + ++  I S +   N  I+QD
Sbjct:  332 LSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGSLAGA------EGFTTEEDQETLNRIEKQLKRRFAIGSQVSEQN--ILQD 696          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0340476)

HSP 1 Score: 176.022 bits (445), Expect = 7.495e-45
Identity = 160/473 (33.83%), Postives = 240/473 (50.74%), Query Frame = 3
Query:  681 RNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLA-LALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-HQ----------------------TFESSKESFNLEKLKSYFA-----------------YIRSTFH------PKMTPEASVILEKYYTWMRKSE-ITNSLDR---ITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQ 1937
            ++ Q + +QE  +    G +PR++ ++ DDDLVD  KPGD V I G+                + V+LAN I +++    +N  I  E      +   K   K+     LL   + P I+G  ++K A L L+L G E    NG ++RG+ ++L++GDP  AKSQ L++     PR++ TTG GS+  GLT  VT  +E+G   LEAGA+VLAD G+ CIDEF  + + D+ AIHE MEQ  ++++KAGI   L  RCSV+AA NP  G YD  ++   N  +   LLSRFDL+F++LD  +   D  +SD ++  H+                      +F SS E  + E  + Y A                 ++R   H      PK+  +A   +   Y+ +R  E +   + R   IT R LE+LIRLS +HAR  M + V  +DA  A+ +++   Y   VL  D+
Sbjct:  191 KDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSK--ESNLDISRE-----DIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQ-FAYFKKVLDKDR 655          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0070762)

HSP 1 Score: 175.252 bits (443), Expect = 1.253e-44
Identity = 158/474 (33.33%), Postives = 238/474 (50.21%), Query Frame = 3
Query:  681 RNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLA-LALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFE------------------------SSKESFNLEKLKSYFA-----------------YIRSTFH------PKMTPEASVILEKYYTWMRKSE-ITNSLDR---ITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQ 1937
            ++ Q + +QE  +    G +PR++ ++ DDDLVD  KPGD V I G+                + V+LAN I +++    +N  I  E      +   K   K+     LL   + P I+G  ++K A L L+L G E    NG ++RG+ ++L++GDP  AKSQ L++     PR++ TTG GS+  GLT  VT  +E+G   LEAGA+VLAD G+ CIDEF  + + D+ AIHE MEQ  ++++KAGI   L  RCSV+AA NP  G YD  ++   N  +   LLSRFDL+F++LD  +   D  +SD ++    +                         SS+E  + E  + Y A                 ++R   H      PK+  +A   +   Y+ +R  E +   + R   IT R LE+LIRLS +HAR  M + V  +DA  A+ +++   Y   VL  D+
Sbjct:  191 KDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSK--ESNLDISRE-----DIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQ-FAYFKKVLDKDR 656          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Match: mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:NCBI gene;Acc:555610])

HSP 1 Score: 473.781 bits (1218), Expect = 2.017e-147
Identity = 270/544 (49.63%), Postives = 375/544 (68.93%), Query Frame = 3
Query:  369 NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES---FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYR 1982
            N  VRI+ LP C E++R  IPK+ DVG FLSV  TV+R    +VLE++R+Y+C KC+  FSV   F +    +T  PP  C +   GC S  F  +  S   P  C++ QEI +QEQ++ LS G +PR++ +IL+DDLVD  K GDD+ + G V +RW  +  +  C +++V+ AN I+ VN+  S    +  +++ +F+ FW+ +       RN ++  +CP ++GMY +KLA+A+VL G  +    +G KVRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGSTNAGLTV AVK+SG W LEAGALVL+DGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD   S++ N A+ASPLLSRFDL+ +LLD  N  WD  +S FIL ++   S  ES   +++EK+++YF  I+ T  P++TPEA+ IL +YY   R+S+  N+  R T+R LESL RL+++HAR M RE V  EDAV+ V+VME ++ G  +L     L ++FP +P E+Y+
Sbjct:  101 NMHVRISGLPVCPELTRDHIPKARDVGHFLSVTGTVIRTSVTKVLEYERDYMCNKCRHVFSVQASFEQF---YTFTPPTSCPS-EEGCGSFKFTCLSGSDAPPAACKDYQEIKIQEQVQKLSVGSIPRSMLIILEDDLVDSCKSGDDITVYGVVCQRWKPMFQDCRCDVEIVLKANYIE-VNNEQSTTALVLEDIQKEFEEFWDSHKHDPIAGRNEILMSLCPQVFGMYVVKLAVAMVLAGGVQRIDASGTKVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTAGIGSTNAGLTVAAVKDSGEWHLEAGALVLSDGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGMVCKLDTRTTILAATNPKGQYDPNVSVSVNVALASPLLSRFDLVLVLLDTKNPDWDKIISSFILQNKGAPS--ESLCLWSMEKMRAYFCLIK-TLKPRITPEANTILSRYYQLQRQSDSRNAA-RTTIRMLESLSRLAEAHARLMFRETVTVEDAVVVVSVMECSMQGGALLGNVNALHTSFPDEPCEQYK 635          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 217.238 bits (552), Expect = 8.154e-58
Identity = 184/577 (31.89%), Postives = 296/577 (51.30%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWN---NLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSKE-------------SFNL-----EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ +L     +++KIF+   AK +  ++      +  EI    VRI +LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD+ KPGD++ + G     ++   N+  N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IY    +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+VIAA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   S+KE             +F++     E L+ Y  Y +    PK+       + + Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  232 LAYFLPEAPAEMLKIFDEA-AKEVVLAMYPKYDRIAHEI---HVRIGNLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCNF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARKDEGVAVAELTDEDVKAIVALSKDERIGER------IFASIGPSIYAHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNTFDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMAIRVM 783          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 215.312 bits (547), Expect = 2.208e-57
Identity = 191/555 (34.41%), Postives = 276/555 (49.73%), Query Frame = 3
Query:  447 GKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQI--KYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI---RRWNNLRVNDECVIQLVILANEIQ------------------IVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFF---NGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGG--WSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQ----------------TFESS--------------------KESFN---LEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            GKF+ +  TVVR  +I+ L  +  ++C  C  +        D  +T+  P  C    S C   +F    SS  +     + Q I VQE +       G +PRTI+  L  DLVD   PGD V I G +       +     D+C+  L I AN +                    V  +I + Y+I+ E++    LF             L+++ +CP+IYG   +K  LAL L G    +    N + +RG+ HMLIVGDPG  KSQ L+    + PR V   G  +T +GLTV+  ++SG   ++LEAGALVL D GICCIDEF  +    + A+ EAMEQQSIS+AKAGIVC L  R S+IAA NP  G+Y+  ++++ N  + S LLSRFDL+F+LLD  NE  D  +S+ ++  +                T ESS                     E+F+    + L+ Y  Y R   HP ++ EA+ +L+ +Y  +RK   T     IT R LESLIRL+++ AR  +RE   + DA   V +M+ ++
Sbjct:  228 GKFVVIRGTVVRVSNIKPLCMKLAFVCNSCGDTQSVTLP--DGKYTM--PTKC--LQSECRGRSFTPNRSSPFT--LTVDWQTIKVQELMSGDQRESGRIPRTIECELTQDLVDSCVPGDMVTITGVIKVSNEEGSTRNKKDKCMFLLYIQANSVSNSKGQKSKAVSESEGQGPSVEFSIKDLYAIQ-EIQAQEDLF------------KLIVNSLCPVIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDPHMLIVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKMGSQHQ-ALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGKSGAVSGAAATRFNTHESSISILEVSSEKPLADTLKLVPGEAFDPIPHQLLRKYVGYARHYVHPTLSAEAAQVLQDFYLELRKQNQTADSTPITTRQLESLIRLTEARARVELREKATQSDAEDVVEIMKHSL 760          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 204.527 bits (519), Expect = 7.294e-54
Identity = 173/521 (33.21%), Postives = 266/521 (51.06%), Query Frame = 3
Query:  435 SVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-------------RRWNNLRVND------------------ECVIQLVILANEIQIVNHTISNNY---------SIKSEMKLDFQLFWEKYHGKSFTARNL---LISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFI--LNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSE---ITNSLDRITMRFLESLIRLSQSHARF 1841
            +V +G  L ++  VVR   +        ++C  C+ SVI +  +    F    P  C N    C +    +++++K   +F  + Q++ +QE    L  G +PR+++VIL  + V+  + GD     GT+I             R   + RV                    E   +L  LAN +   N                S+K++M +   L WEK    S   +NL   L + + P I+G   +K  + L+L G        G  +RG+ ++ IVGDP T+KSQFLK      PR+V T+G  S+ AGLT   VK  ES  + +EAGAL+LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R S++AA NP  G Y+  +S+  N  +++P++SRFDL F+L+D CNE  D  ++  I  L+ +  ES +  ++ ++++ Y  + R  F PK+T EA   +   Y  +R+ +    T S  RIT+R LES++RLS+  AR 
Sbjct:  122 TVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQ-SVIKDVEQQ---FKYTQPTICKN--PVCANRRRFMLDTNK--SRFV-DFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTV---LEWEKVFEMS-QDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVESVERVYSTDEIQRYILFARQ-FQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARL 628          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 202.216 bits (513), Expect = 3.626e-53
Identity = 172/521 (33.01%), Postives = 265/521 (50.86%), Query Frame = 3
Query:  435 SVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-------------RRWNNLRVND------------------ECVIQLVILANEIQIVNHTISNNY---------SIKSEMKLDFQLFWEKYHGKSFTARNL---LISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFI--LNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSE---ITNSLDRITMRFLESLIRLSQSHARF 1841
            +V +G  L ++  VVR   +        ++C  C+ SVI +  +    F    P  C N    C +    +++++K   +F  + Q++ +QE    L  G +PR+++VIL  + V+  + GD     GT+I             R   + RV                    E   +L  LAN +   N                S+K++M +     WEK    S   +NL   L + + P I+G   +K  + L+L G        G  +RG+ ++ IVGDP T+KSQFLK      PR+V T+G  S+ AGLT   VK  ES  + +EAGAL+LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R S++AA NP  G Y+  +S+  N  +++P++SRFDL F+L+D CNE  D  ++  I  L+ +  ES +  ++ ++++ Y  + R  F PK+T EA   +   Y  +R+ +    T S  RIT+R LES++RLS+  AR 
Sbjct:  122 TVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQ-SVIKDVEQQ---FKYTQPTICKN--PVCANRRRFMLDTNK--SRFV-DFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQE---WEKVFEMS-QDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVESVERVYSTDEIQRYILFARQ-FQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARL 628          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Match: sass6 (spindle assembly 6 homolog [Source:Xenbase;Acc:XB-GENE-5783525])

HSP 1 Score: 506.908 bits (1304), Expect = 2.264e-160
Identity = 287/646 (44.43%), Postives = 426/646 (65.94%), Query Frame = 3
Query:  108 ILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCS---SLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF-ESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            +   ++ ++H ++I  I+   ++ +        L ++ M L +    I  Y      +++ IF++   +   S   S ++    + K+  N   RIT LP C E++R  IP++ DVG FLSV  TV+R   ++VLE++++++C KCK  V  + ++ +  +T  PP  CSN   GC SS F  +  S  +P  CR+ QEI +QEQ++ LS G +PR++ V+L+DDLVD  K GDDV + G V++RW  L ++  C +++V+ AN I  VN+       I  E++ +++ FWEKY       RN +++ +CP ++GM+ +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGST+AGLTVTAVK+SG W+LEAGALVLADGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +SI+ N A+ASPLLSRFDL+ +LLD  NE WD  +S FIL  +     S + +++EK+K+YF  I++   PKM+ +A+VIL +YY   R+S   N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V++MES++ G  +L     L ++FP +P E+YR+    + ++L ++  +
Sbjct:   14 VFESFVLEHHQKEIAQILTEKYEDA-----HYSLVVNAMTLFEANMEIGEYFNAFPNEVLPIFDNALRRAAMSFLQSCSEKQTLVMKQ--NFHARITGLPVCPELTREHIPRTRDVGHFLSVTGTVIRTSLVKVLEYEQDFMCNKCKHVVTVK-ADFEQYYTFKPPITCSN-EEGCNSSKFTCLSDSS-TPASCRDYQEIKIQEQVQRLSVGSIPRSMIVVLEDDLVDSCKSGDDVTVYGVVMQRWKPLYIDTRCDLEIVLKANYI-AVNNEQPCGVVINEEVRKEYEGFWEKYRNSPLEGRNEILASLCPQVFGMFVVKLAVAMVLAGGVQRIDSAGTRVRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDSGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPEESISVNVALASPLLSRFDLVLVLLDTKNEDWDRIISSFILESKGCPRKSDKLWSMEKMKTYFCLIKN-LQPKMSQDANVILVRYYQLQRQSSCRNAA-RTTIRLLESLIRLAEAHARLMYRDVVTTEDAITVVSIMESSMQGGALLGGVNALHTSFPENPREQYRMQCELLLERLGLQKLL 646          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Match: sass6 (spindle assembly 6 homolog [Source:Xenbase;Acc:XB-GENE-5783525])

HSP 1 Score: 506.523 bits (1303), Expect = 6.975e-160
Identity = 287/646 (44.43%), Postives = 426/646 (65.94%), Query Frame = 3
Query:  108 ILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCS---SLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF-ESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            +   ++ ++H ++I  I+   ++ +        L ++ M L +    I  Y      +++ IF++   +   S   S ++    + K+  N   RIT LP C E++R  IP++ DVG FLSV  TV+R   ++VLE++++++C KCK  V  + ++ +  +T  PP  CSN   GC SS F  +  S  +P  CR+ QEI +QEQ++ LS G +PR++ V+L+DDLVD  K GDDV + G V++RW  L ++  C +++V+ AN I  VN+       I  E++ +++ FWEKY       RN +++ +CP ++GM+ +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGST+AGLTVTAVK+SG W+LEAGALVLADGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +SI+ N A+ASPLLSRFDL+ +LLD  NE WD  +S FIL  +     S + +++EK+K+YF  I++   PKM+ +A+VIL +YY   R+S   N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V++MES++ G  +L     L ++FP +P E+YR+    + ++L ++  +
Sbjct:   11 VFESFVLEHHQKEIAQILTEKYEDA-----HYSLVVNAMTLFEANMEIGEYFNAFPNEVLPIFDNALRRAAMSFLQSCSEKQTLVMKQ--NFHARITGLPVCPELTREHIPRTRDVGHFLSVTGTVIRTSLVKVLEYEQDFMCNKCKHVVTVK-ADFEQYYTFKPPITCSN-EEGCNSSKFTCLSDSS-TPASCRDYQEIKIQEQVQRLSVGSIPRSMIVVLEDDLVDSCKSGDDVTVYGVVMQRWKPLYIDTRCDLEIVLKANYI-AVNNEQPCGVVINEEVRKEYEGFWEKYRNSPLEGRNEILASLCPQVFGMFVVKLAVAMVLAGGVQRIDSAGTRVRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDSGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPEESISVNVALASPLLSRFDLVLVLLDTKNEDWDRIISSFILESKGCPRKSDKLWSMEKMKTYFCLIKN-LQPKMSQDANVILVRYYQLQRQSSCRNAA-RTTIRLLESLIRLAEAHARLMYRDVVTTEDAITVVSIMESSMQGGALLGGVNALHTSFPENPREQYRMQCELLLERLGLQKLL 643          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Match: sass6 (spindle assembly 6 homolog [Source:Xenbase;Acc:XB-GENE-5783525])

HSP 1 Score: 506.138 bits (1302), Expect = 1.681e-159
Identity = 287/646 (44.43%), Postives = 426/646 (65.94%), Query Frame = 3
Query:  108 ILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCS---SLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF-ESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            +   ++ ++H ++I  I+   ++ +        L ++ M L +    I  Y      +++ IF++   +   S   S ++    + K+  N   RIT LP C E++R  IP++ DVG FLSV  TV+R   ++VLE++++++C KCK  V  + ++ +  +T  PP  CSN   GC SS F  +  S  +P  CR+ QEI +QEQ++ LS G +PR++ V+L+DDLVD  K GDDV + G V++RW  L ++  C +++V+ AN I  VN+       I  E++ +++ FWEKY       RN +++ +CP ++GM+ +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGST+AGLTVTAVK+SG W+LEAGALVLADGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +SI+ N A+ASPLLSRFDL+ +LLD  NE WD  +S FIL  +     S + +++EK+K+YF  I++   PKM+ +A+VIL +YY   R+S   N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V++MES++ G  +L     L ++FP +P E+YR+    + ++L ++  +
Sbjct:   14 VFESFVLEHHQKEIAQILTEKYEDA-----HYSLVVNAMTLFEANMEIGEYFNAFPNEVLPIFDNALRRAAMSFLQSCSEKQTLVMKQ--NFHARITGLPVCPELTREHIPRTRDVGHFLSVTGTVIRTSLVKVLEYEQDFMCNKCKHVVTVK-ADFEQYYTFKPPITCSN-EEGCNSSKFTCLSDSS-TPASCRDYQEIKIQEQVQRLSVGSIPRSMIVVLEDDLVDSCKSGDDVTVYGVVMQRWKPLYIDTRCDLEIVLKANYI-AVNNEQPCGVVINEEVRKEYEGFWEKYRNSPLEGRNEILASLCPQVFGMFVVKLAVAMVLAGGVQRIDSAGTRVRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDSGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPEESISVNVALASPLLSRFDLVLVLLDTKNEDWDRIISSFILESKGCPRKSDKLWSMEKMKTYFCLIKN-LQPKMSQDANVILVRYYQLQRQSSCRNAA-RTTIRLLESLIRLAEAHARLMYRDVVTTEDAITVVSIMESSMQGGALLGGVNALHTSFPENPREQYRMQCELLLERLGLQKLL 646          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 229.18 bits (583), Expect = 1.677e-61
Identity = 199/631 (31.54%), Postives = 319/631 (50.55%), Query Frame = 3
Query:   93 HYFLNILTDYLSKNHIQDIQNIINASFKKSINEC-----ETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSK-----ESFNL-----------EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            H F N L  ++ + H  ++       FK+ I++      E+LV+  + +   +    ++ +L     +++KIF+   AK +   +      + +EI    VRI+ LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + GT    ++      N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC++IAA+NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   SSK     E F L           E LK Y  Y +   HPK+       + K Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  201 HRFKNFLRTHVDE-HGHNV-------FKEKISDMCKENKESLVVNYEDLAAREHV--LAYFLPEAPAEMLKIFDEA-AKEVVLVMYPKYDRIAREI---HVRISHLPLVEELRSL---RQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGER------IFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHHPSSKDIANGEEFALPNTFGVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVM 797          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 228.409 bits (581), Expect = 2.087e-61
Identity = 199/631 (31.54%), Postives = 319/631 (50.55%), Query Frame = 3
Query:   93 HYFLNILTDYLSKNHIQDIQNIINASFKKSINEC-----ETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSK-----ESFNL-----------EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            H F N L  ++ + H  ++       FK+ I++      E+LV+  + +   +    ++ +L     +++KIF+   AK +   +      + +EI    VRI+ LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + GT    ++      N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC++IAA+NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   SSK     E F L           E LK Y  Y +   HPK+       + K Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  181 HRFKNFLRTHVDE-HGHNV-------FKEKISDMCKENKESLVVNYEDLAAREHV--LAYFLPEAPAEMLKIFDEA-AKEVVLVMYPKYDRIAREI---HVRISHLPLVEELRSL---RQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGER------IFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHHPSSKDIANGEEFALPNTFGVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVM 777          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Match: Mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1918817])

HSP 1 Score: 516.153 bits (1328), Expect = 2.697e-163
Identity = 291/645 (45.12%), Postives = 424/645 (65.74%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +  T G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK   + E ++ +  +T + P  C + +S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDL+ +LLD  NE WD  +S FIL ++ + S  E+ +++EK+K+YF  IR+  HP ++  ++ +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R  V  EDAV AV+VMES++ G  +L     L ++FP +P  +Y+     I +KL+++  +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVE-ADFEQYYTFSRPSSCPSLAS-CDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQ-VNNEQSSGMVMDEDTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPKESVSVNIALGSPLLSRFDLVLVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRN-LHPTLSEVSNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRSAVTLEDAVTAVSVMESSMQGGALLGGVNALHTSFPENPRAQYQRQCELILEKLELQGLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Match: Mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1918817])

HSP 1 Score: 516.153 bits (1328), Expect = 1.117e-161
Identity = 291/645 (45.12%), Postives = 424/645 (65.74%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +  T G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK   + E ++ +  +T + P  C + +S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDL+ +LLD  NE WD  +S FIL ++ + S  E+ +++EK+K+YF  IR+  HP ++  ++ +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R  V  EDAV AV+VMES++ G  +L     L ++FP +P  +Y+     I +KL+++  +
Sbjct:  167 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVE-ADFEQYYTFSRPSSCPSLAS-CDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQ-VNNEQSSGMVMDEDTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPKESVSVNIALGSPLLSRFDLVLVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRN-LHPTLSEVSNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRSAVTLEDAVTAVSVMESSMQGGALLGGVNALHTSFPENPRAQYQRQCELILEKLELQGLL 801          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Match: Mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1918817])

HSP 1 Score: 266.929 bits (681), Expect = 2.523e-79
Identity = 155/382 (40.58%), Postives = 232/382 (60.73%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAG 1244
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +  T G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK   + E ++ +  +T + P  C + +S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AG
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVE-ADFEQYYTFSRPSSCPSLAS-CDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQ-VNNEQSSGMVMDEDTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAG 384          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Match: Mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1918817])

HSP 1 Score: 251.136 bits (640), Expect = 2.156e-73
Identity = 153/402 (38.06%), Postives = 231/402 (57.46%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXX---------------------XXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNA 1241
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +  T G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK   + E ++ +  +T + P  C + +S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD                      +  GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+A
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVE-ADFEQYYTFSRPSSCPSLAS-CDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSVLQCHLTVHDLPAGLTWVLSLGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQ-VNNEQSSGMVMDEDTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSA 404          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 224.942 bits (572), Expect = 3.323e-60
Identity = 191/639 (29.89%), Postives = 318/639 (49.77%), Query Frame = 3
Query:   81 IEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINEC-----ETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-----------------NHQTFESSK------ESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            +E  H F N L  ++  +H  ++       FK+ I++      E+LV+  + +   +    ++ +L     +L++IF+    +++ +    M     +   +  VRI+ LP  +E+      + + + + +  +  V     +       +Y C KC F V+  F +S        P  C    S   +  F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++      N   V   +ILAN +   ++ ++       ++K+   L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K++ R++ TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+VIAA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++                 N  T E +       E    E LK Y  Y +    PK+       + + Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V E+D  MA+ VM
Sbjct:  193 LEIHHRFKNFLRTHVD-SHGHNV-------FKERISDMCKENRESLVVNYEDLAAREHV--LAYFLPEAPAELLQIFDEAALEVVLA----MYPKYDRITNHIHVRISHLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNF-VLGPFCQSQNQEV--KPGSCPECQS---AGPFEI----NMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEK------IFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLEPAMPNTYGVEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVM 798          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Match: sp|F1M5F3|MCM9_RAT (DNA helicase MCM9 OS=Rattus norvegicus OX=10116 GN=Mcm9 PE=3 SV=2)

HSP 1 Score: 516.924 bits (1330), Expect = 7.025e-163
Identity = 294/647 (45.44%), Postives = 422/647 (65.22%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     L ++ M L +    I  Y      +++ +F+S   +   + L  +    G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F+V  +F +    +T + P  C + S  C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E+ +++EK+K+YF  IR+  HP ++  ++ +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R  V  EDA+  V+VMES++ G  +L     L ++FP  P  +YR     I +KL+++S +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPLVVNAMTLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAVLQSLPEPEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKYVFTVKADFEQY---YTFSRPSSCPS-SDTCDSSKFTCLSDLSASPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDMRCEVEIVLKANYVQ-VNNEQSSGMVMDEDARKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRN-LHPTLSDVSNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRSTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPESPRAQYRRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Match: sp|Q2KHI9|MCM9_MOUSE (DNA helicase MCM9 OS=Mus musculus OX=10090 GN=Mcm9 PE=1 SV=2)

HSP 1 Score: 516.153 bits (1328), Expect = 1.886e-162
Identity = 291/645 (45.12%), Postives = 424/645 (65.74%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +  T G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK   + E ++ +  +T + P  C + +S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDL+ +LLD  NE WD  +S FIL ++ + S  E+ +++EK+K+YF  IR+  HP ++  ++ +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R  V  EDAV AV+VMES++ G  +L     L ++FP +P  +Y+     I +KL+++  +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVE-ADFEQYYTFSRPSSCPSLAS-CDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQ-VNNEQSSGMVMDEDTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPKESVSVNIALGSPLLSRFDLVLVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRN-LHPTLSEVSNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRSAVTLEDAVTAVSVMESSMQGGALLGGVNALHTSFPENPRAQYQRQCELILEKLELQGLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Match: sp|Q9NXL9|MCM9_HUMAN (DNA helicase MCM9 OS=Homo sapiens OX=9606 GN=MCM9 PE=1 SV=4)

HSP 1 Score: 509.605 bits (1311), Expect = 6.129e-160
Identity = 294/650 (45.23%), Postives = 424/650 (65.23%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDM----GVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ IF+S   +   + L  +     V++ +   N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F +  +F +    +T   P  C +  S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN IQ VN+  S+   +  E++ +F+ FWE Y    F  RN++++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+K+YF  IR+   P ++   + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V+VMES++ G  +L     L ++FP +P E+Y+     I +KL+++S +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQ---NLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFVIKADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQ-VNNEQSSGIIMDEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRN-LQPTLSDVGNQVLLRYYQMQRQSDCRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Match: sp|F1N2W9|MCM9_BOVIN (DNA helicase MCM9 OS=Bos taurus OX=9913 GN=MCM9 PE=3 SV=2)

HSP 1 Score: 507.679 bits (1306), Expect = 3.434e-159
Identity = 293/647 (45.29%), Postives = 422/647 (65.22%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ IF++   +   + L  +    G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   +++LEF+R+Y+C KCK  F V  +F +    +T   P  C +  + C SS F  + S   SP  CR+ QEI +QEQ++ LS G +PR+++VIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN IQ VN+  S   ++  E++ +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A++SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+KSYF  IR    P ++ E + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDAV  V+VMES++ G  +L     L ++FP +P ++Y+     I +KL++ + +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPVVVNAMTLFETNMEIGEYFNAFPNEVLTIFDNALRRSALTILQSLSQPEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKILEFERDYMCNKCKHVFVVQADFEQY---YTFFRPSSCPSLEN-CDSSKFTCL-SDLSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMQVILEDDLVDSCKSGDDITIYGVVMQRWKPFKQDVRCEVEIVLKANYIQ-VNNEESAGVNMDEEVRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPRESVSVNIALSSPLLSRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKSYFCLIRK-LQPTLSDEGNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAVTVVSVMESSMQGGALLGGVNALHTSFPENPLQQYQTQCELILEKLELPNLL 644          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Match: sp|F6RIX4|MCM9_XENTR (DNA helicase MCM9 OS=Xenopus tropicalis OX=8364 GN=mcm9 PE=3 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 3.990e-159
Identity = 287/646 (44.43%), Postives = 426/646 (65.94%), Query Frame = 3
Query:  108 ILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCS---SLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF-ESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            +   ++ ++H ++I  I+   ++ +        L ++ M L +    I  Y      +++ IF++   +   S   S ++    + K+  N   RIT LP C E++R  IP++ DVG FLSV  TV+R   ++VLE++++++C KCK  V  + ++ +  +T  PP  CSN   GC SS F  +  S  +P  CR+ QEI +QEQ++ LS G +PR++ V+L+DDLVD  K GDDV + G V++RW  L ++  C +++V+ AN I  VN+       I  E++ +++ FWEKY       RN +++ +CP ++GM+ +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGST+AGLTVTAVK+SG W+LEAGALVLADGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +SI+ N A+ASPLLSRFDL+ +LLD  NE WD  +S FIL  +     S + +++EK+K+YF  I++   PKM+ +A+VIL +YY   R+S   N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V++MES++ G  +L     L ++FP +P E+YR+    + ++L ++  +
Sbjct:   14 VFESFVLEHHQKEIAQILTEKYEDA-----HYSLVVNAMTLFEANMEIGEYFNAFPNEVLPIFDNALRRAAMSFLQSCSEKQTLVMKQ--NFHARITGLPVCPELTREHIPRTRDVGHFLSVTGTVIRTSLVKVLEYEQDFMCNKCKHVVTVK-ADFEQYYTFKPPITCSN-EEGCNSSKFTCLSDSS-TPASCRDYQEIKIQEQVQRLSVGSIPRSMIVVLEDDLVDSCKSGDDVTVYGVVMQRWKPLYIDTRCDLEIVLKANYI-AVNNEQPCGVVINEEVRKEYEGFWEKYRNSPLEGRNEILASLCPQVFGMFVVKLAVAMVLAGGVQRIDSAGTRVRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDSGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPEESISVNVALASPLLSRFDLVLVLLDTKNEDWDRIISSFILESKGCPRKSDKLWSMEKMKTYFCLIKN-LQPKMSQDANVILVRYYQLQRQSSCRNAA-RTTIRLLESLIRLAEAHARLMYRDVVTTEDAITVVSIMESSMQGGALLGGVNALHTSFPENPREQYRMQCELLLERLGLQKLL 646          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Match: H0WRA3 (Minichromosome maintenance 9 homologous recombination repair factor OS=Otolemur garnettii OX=30611 GN=MCM9 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 6.550e-164
Identity = 294/650 (45.23%), Postives = 425/650 (65.38%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMG----VTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     + ++ M L +    I  Y      +++ +F+S   +   + L  +     V++ +   N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F V  +F +    +T   P  C +  S C SS F  + S   SP  CR+ QEI +QEQ++ LS G +PR++KV+L+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+  ++  E++ +F+ FWE Y    F  RN +++ +CP I+GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+K+YF  IR+   P ++   + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V+VMES++ G  +L     L ++FP +P E+Y+     I +KL+++S +
Sbjct:   15 QVFESYVSEYHKNDILLIL-----KERDEDAHYAVVVNAMTLFETNMEIGEYFTVFPNEVLSVFDSALRRSALTILQSLSQPECVSMKQ---NLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHIFVVKADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSSLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVVLEDDLVDSCKSGDDLTIYGVVMQRWKPFQQDVRCEVEIVLKANYVQ-VNNEQSSGITMDEEVRKEFEDFWECYKSDPFAGRNEILASLCPQIFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRN-LQPSLSDVGNQVLLRYYQMQRQSDARNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPREQYQRQCELILEKLELQSLL 649          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Match: G1NKV5 (Minichromosome maintenance 9 homologous recombination repair factor OS=Meleagris gallopavo OX=9103 GN=MCM9 PE=3 SV=2)

HSP 1 Score: 510.76 bits (1314), Expect = 9.503e-164
Identity = 287/647 (44.36%), Postives = 422/647 (65.22%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEI---PNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   YL ++H  DI  I+    +++ +E    +L +D + L +    I  Y      +++ IF+    +   + L     T   E+   PN   RI+ LP C E++R  IPK+ DVG FLSV  TV+R   ++VLEF+R YIC KCK   + + ++ +  +    P  C N   GC S+ F  +  +  SP  CR+ QEI +QEQ++ LS G +PR + V+L+DDLVD  K GDD+ + G V++RW     +  C ++LV+ AN I++ N  ++    I  E++ +F+ FWEK+       RN +++ +CP ++G+Y +KLA+A+VL G  +     G ++RGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGST+AGLTVTAVK+ G W+LEAGALVLADGG+CCIDEF SI+E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG+YD T+S++ N A+ SPLLSRFDL+ +LLD  NE WD  +S FIL ++   S  E  +++EK+K+YF  I+    PK++ E+++IL +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDAV  V+VMES++ G  +L     L ++FP +P  +YR+    I ++L+++  +
Sbjct:   15 QVFESYLLQHHRDDILGIL----RQADDEAHYPIL-VDALTLFETNMEIGEYFNAFPSQVLPIFDGALRRAAMAVLQ--AATPSPELRMKPNLHTRISGLPICPELTREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERSYICNKCKHVFVAK-ADFEQYYAFCRPSACLN-EEGCNSTKFTCLSGTSSSPTSCRDYQEIKIQEQVQRLSVGSIPRCMVVVLEDDLVDSCKSGDDITVYGVVMQRWKPFHQDARCDLELVLKANYIKVNNEQLAG-VIIDEEVRKEFEDFWEKHRNNPLAGRNEILASLCPQVFGLYLVKLAVAMVLAGGVQRIDATGTRIRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDFGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGHYDPTESVSVNIALGSPLLSRFDLVLVLLDTKNEEWDRIISSFILQNKGCPSKSEKLWSMEKMKTYFCLIKR-IQPKLSDESNLILVRYYQMQRQSDCRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAVTVVSVMESSMQGGALLGAINALHTSFPENPVAQYRMQCELILERLELQHLL 649          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Match: A0A3M6UYU4 (MCM domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00014485 PE=3 SV=1)

HSP 1 Score: 517.309 bits (1331), Expect = 2.472e-163
Identity = 290/653 (44.41%), Postives = 430/653 (65.85%), Query Frame = 3
Query:   99 FLNILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEI-PNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQ----TFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEY-RLLKLNIFKKLQIKSFI 2030
            ++ I   +L ++H +DI N++ A    S        + ++V+ L      +S  LL +  K++ +F+   A+   S + +    +      +  VR+++LP C E+ R  IPK+ D+G+FL+++ TV+R  ++++LE++R+YIC +CK  F V  +F +    ++I  P  C + S  C S+ F  +      PK CR+ QEI +QEQ++ L+ G +PR++ VIL+DDLVD  K GDD+ + G V+RRW  +  +  C +++V  AN +  VN+       +  E+K +F  FWE++       RN ++S  CP +YG+Y +KLA+AL+L G  +    +G +VRGESH+L+VGDPGT KSQFLK+A K+ PRSVLTTGIGST+AGLTV AV++SG W LEAGALVLADGG+CCIDEF SI+E D+  IHEAMEQQ+ISVAKAG+VCKL TR +V+AATNPKG YD ++S++ N A+ASPLLSRFDL+ +L D  NE WD  VS FIL  +    T  SS+  +++EK+++YF Y++ T  P++TPE++ IL +YY   R++++ N+  R T+R LESLIRL+Q+HAR M REFV  +DA+ AV  +E ++  S +L +   L + FP DP+EEY R  KL + K+LQ+   +
Sbjct:   12 YIAIFQAFLEEHHKEDILNVLMADDPSS-----QYCVVVNVLELFDSNIEVSQKLLADPNKMLPLFDGALAQAAVSIMQESTTQISMSFKAHLHVRLSNLPICPELRRDKIPKTSDIGRFLAISGTVIRVSTVKLLEYERDYICARCKHIFGVQADFEQF---YSIPKPSKCPS-SKECNSNKFSCLSDGASEPKSCRDYQEIKIQEQVQKLAVGTIPRSMWVILEDDLVDCCKAGDDITVCGVVMRRWKPVFPDSRCDLEVVFKANHVS-VNNEQKATVLVTEELKREFAEFWERFKQSPLQGRNHILSSFCPQVYGLYAVKLAVALILIGGVQRVDASGTRVRGESHLLLVGDPGTGKSQFLKYAAKIMPRSVLTTGIGSTSAGLTVAAVRDSGEWQLEAGALVLADGGLCCIDEFNSIQEHDRTCIHEAMEQQTISVAKAGMVCKLSTRTTVLAATNPKGPYDPSESLSVNIAVASPLLSRFDLLLVLHDARNEEWDRIVSSFILEGKGLSTTASSSEPLWSMEKMQAYFCYVK-TLKPQLTPESNRILSRYYHCQRQADLRNAA-RTTIRLLESLIRLAQAHARLMCREFVTVQDAITAVTCVECSMQNSALLGSMNALHTKFPDDPQEEYSRQAKL-VLKRLQLNDMV 651          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Match: K3W4U8 (DNA helicase MCM9 OS=Rattus norvegicus OX=10116 GN=Mcm9 PE=3 SV=2)

HSP 1 Score: 517.309 bits (1331), Expect = 1.677e-160
Identity = 294/647 (45.44%), Postives = 422/647 (65.22%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S+ H  DI  I+     K  +E     L ++ M L +    I  Y      +++ +F+S   +   + L  +    G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F+V  +F +    +T + P  C + S  C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  + + +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+A+VL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E+ +++EK+K+YF  IR+  HP ++  ++ +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R  V  EDA+  V+VMES++ G  +L     L ++FP  P  +YR     I +KL+++S +
Sbjct:   11 QVFESYVSEYHKNDILLIL-----KERDEDAHYPLVVNAMTLFETNMEIGDYFTVFPNEVLTVFDSALRRSALAVLQSLPEPEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKYVFTVKADFEQY---YTFSRPSSCPS-SDTCDSSKFTCLSDLSASPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDMRCEVEIVLKANYVQ-VNNEQSSGMVMDEDARKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRN-LHPTLSDVSNQVLLRYYQMQRQSDSRNAA-RTTIRLLESLIRLAEAHARLMFRSTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPESPRAQYRRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Match: G1TAF0 (Minichromosome maintenance 9 homologous recombination repair factor OS=Oryctolagus cuniculus OX=9986 GN=MCM9 PE=3 SV=3)

HSP 1 Score: 516.153 bits (1328), Expect = 6.206e-160
Identity = 293/647 (45.29%), Postives = 422/647 (65.22%), Query Frame = 3
Query:  105 NILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIP-NCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
             +   Y+S++H  DI  I+  S     +E     + ++ M L +    I  Y      +++ +F++   +   + L  +    G  +  N   RI+ LP C E+ R  IPK+ DVG FLSV  TV+R   ++VLEF+R+Y+C KCK  F+V  +F +    +T   P  C +  S C SS F  +     SP  CR+ QEI +QEQ++ LS G +PR++KVIL+DDLVD  K GDD+ I G V++RW   + +  C +++V+ AN +Q VN+  S+   +  E++ +F+ FWE Y    F  RN +++ +CP ++GMY +KLA+ALVL G  +     G +VRGESH+L+VGDPGT KSQFLK+A K+TPRSVLTTGIGST+AGLTVTAVK+SG W+LEAGALVLAD G+CCIDEF S++E D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG YD  +S++ N A+ SPLLSRFDLI +LLD  NE WD  +S FIL ++ + S  E  +++EK+K+YF  IR    P ++   + +L +YY   R+S+  N+  R T+R LESLIRL+++HAR M R+ V  EDA+  V+VMES++ G  +L     L ++FP +P E+Y+     I +KL+++S +
Sbjct:   11 QVFESYVSEHHKNDILLILKES-----DEDAHYSVVVNAMTLFETNMEIGDYFTVFPNEVLTVFDNALRRSALAILQSLSQPEGASMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFAVSADFEQY---YTFCRPSSCPSLES-CDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQKLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQQDVRCEVEIVLKANYVQ-VNNEQSSGVIMDEEVRKEFEDFWEYYKSDPFAGRNEILASLCPQVFGMYLVKLAVALVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLLDTKNEDWDHIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRK-LQPSLSDVGNQVLLRYYQMQRQSDCRNAA-RTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPREQYQRQCELILEKLELQSLL 645          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Match: mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:NCBI gene;Acc:555610])

HSP 1 Score: 485.723 bits (1249), Expect = 1.355e-151
Identity = 284/630 (45.08%), Postives = 407/630 (64.60%), Query Frame = 3
Query:  108 ILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLG-KEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYR 1982
            +   Y++++H  DI  I+     +  +E     L ++ M L +    +  Y      +++ +F+S   K   S      +  G K   N  VRI+ LP C E+SR  IPK+ DVG FLSV  TV+R    +VLE++R+Y+C KC+  FSV  +F +    ++ +PP  C +    C S  F  +  S  +P  C++ QEI +QEQ++ LS G +PR++ VIL+DDLVD  K GDD+ + G + +RW  L  +  C +++V+ AN I+I N   +   +++ + + +F+ FWE +       RN ++  +CP ++GMY +KLA+ +VL G  +    +G KVRGESH+L+VGDPGT KSQFLK+A K+TPRSVLT GIGSTNAGLTV AVK+SG W LEAGALVL+DGG+CCIDEF SI+E D+ +IHEAMEQQSISVAKAG+VCKL TR +++AATNPKG YD   S++ N A+ASPLLSRFDL+ +LLD  N  WD  +S FIL ++   S   S +++EK+++YF  I+    P +T EA+ IL +YY   R+++ + S  R T+R LESL RL+++HAR M RE V  EDAV+AV+VME ++ G  +L     L ++FP +P E+YR
Sbjct:   14 VFETYVAEHHKSDILQIL-----QEPDEDAHYPLVVNAMSLFEANMEVGEYFNALPSEVLPVFDSALHKAATSISQTESLHRGLKPKCNMHVRISGLPVCPELSRDHIPKARDVGHFLSVTGTVIRTSVTKVLEYERDYMCNKCRHVFSVQADFEQF---YSFSPPSHCPSEDE-CNSFKFTCLADSDAAPAACKDYQEIKIQEQVQRLSVGSIPRSMLVILEDDLVDRCKSGDDITVYGVLWQRWKPLYQDSRCDVEIVLKANYIEINNDQSTAAVALE-DFQKEFEEFWENHKQDPIAGRNQILMSLCPQVFGMYVVKLAVGMVLAGGVQRVDASGTKVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTAGIGSTNAGLTVAAVKDSGEWHLEAGALVLSDGGLCCIDEFNSIKEHDRTSIHEAMEQQSISVAKAGMVCKLDTRTTILAATNPKGPYDPNVSVSVNVAVASPLLSRFDLVLVLLDTKNPEWDKIISSFILQNKGAPSQSSSLWSMEKMRAYFCVIK-RLRPNITQEANSILARYYQLQRQND-SRSAARTTIRMLESLGRLAEAHARLMFREIVTVEDAVVAVSVMECSMQGGALLGNVNTLHTSFPDNPREQYR 631          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 218.009 bits (554), Expect = 3.384e-58
Identity = 182/577 (31.54%), Postives = 293/577 (50.78%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWN---NLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSKES------------------FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ +L     +++KIF+   AK +  ++      +  EI    VRI +LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++   N+  N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+V+AA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   S+KE                      E L+ Y  Y +    PK+       + + Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V+E+D  MA+ VM
Sbjct:  223 LAYFLPEAPAEMLKIFDEA-AKEVVLAMYPKYDRIAHEI---HVRIGNLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGER------IFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM 774          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 217.624 bits (553), Expect = 4.280e-58
Identity = 181/576 (31.42%), Postives = 291/576 (50.52%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSKES------------------FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ +L     +++KIF+   AK +  ++      +  EI    VRI +LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++      N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+V+AA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   S+KE                      E L+ Y  Y +    PK+       + + Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V+E+D  MA+ VM
Sbjct:  223 LAYFLPEAPAEMLKIFDEA-AKEVVLAMYPKYDRIAHEI---HVRIGNLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGER------IFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM 774          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 218.009 bits (554), Expect = 4.349e-58
Identity = 182/577 (31.54%), Postives = 293/577 (50.78%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVS-SAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWN---NLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSKES------------------FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ +L     +++KIF+   AK +  ++      +  EI    VRI +LP  +E+      + + + + +  +  V     +       +Y C KC F ++  F +S        P  C      C S   F+I     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++   N+  N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K  LAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+V+AA NP  G YD + + + N  +  P++SRFD++ ++ D  +   D  ++ F++    +   S+KE                      E L+ Y  Y +    PK+       + + Y+ +RK  +      IT+R +ES+IR++++HAR  +R++V+E+D  MA+ VM
Sbjct:  232 LAYFLPEAPAEMLKIFDEA-AKEVVLAMYPKYDRIAHEI---HVRIGNLPLVEELRSL---RQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSF-ILGPFFQSQNQEV--KPGSCPE----CQSLGPFEI----NMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGER------IFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM 783          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:103047810])

HSP 1 Score: 214.157 bits (544), Expect = 2.567e-57
Identity = 187/542 (34.50%), Postives = 274/542 (50.55%), Query Frame = 3
Query:  447 GKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQI--KYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI---RRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHG-KSFTARN----LLISQMCPLIYGMYFLKLALALVLCGSENCFF---NGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGG--WSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQ----------------TFESS--------------------KESFN---LEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            GKF+++  TVVR  +I+ L  +  +IC  C  +   +    D  +T   P  C      C    F    SS L+     + Q I VQE I       G +PRTI+  L  DLVD   PGD V I G +       +     D+C+  L I AN +       S + S         +   +  +G +   A+     L+++ +CP IYG   +K  LAL L G    +    N + +RG+ H+L+VGDPG  KSQ L+    ++PR +   G  +T++GLTV+  ++SG   ++LEAGALVL D GICCIDEF  +    + A+ EAMEQQSIS+AKAGIVC L  R S+IAA NP  G+Y+  ++++ N  + S LLSRFDL+F+LLD  NE  D  +S+ I+  +                T ES+                     E+F+    + L+ Y  Y R   HP ++ EA+ +L+ +Y  +RK   +     IT R LESLIRL+++ AR  +RE   E DA   V +M+ ++
Sbjct:  159 GKFVAIRGTVVRVSNIKPLCSKMAFICNSCGDTQSLDLP--DGKYTT--PSKCPQKE--CRGRIFTPNRSSPLT--LTVDWQTIKVQELISDDQRESGRIPRTIECELTQDLVDSCVPGDMVTITGIIKVSNEEGSGRNKKDKCMFLLYINANSVSNSKGQKSKSASEPESQGASVEFSLKDLYGIQEIQAQEDLFKLIVNSLCPAIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDPHVLVVGDPGLGKSQMLQAVCNVSPRGIYVCGNTTTSSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKMGNQHQ-ALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHMLSEHIMAMRAGKKGMVSSAAVARNCTQESNISILEISSDQPLSDRLKVLPGENFDPIPHQLLRKYVGYARHYVHPNLSAEAAQVLQDFYLELRKQNQSADSTPITTRQLESLIRLTEARARLELREKATESDAEDVVDIMKHSL 691          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 184.111 bits (466), Expect = 1.409e-49
Identity = 122/320 (38.12%), Postives = 186/320 (58.13%), Query Frame = 3
Query: 1023 MCPLIYGMYFLKLALA-LVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESG--GWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAK-AGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-----HQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDR-------ITMRFLESLIRLSQSHARFMMREF-----VKEEDAVMAVAVMESTVYGS 1916
            + P IYG   +K A+A L++ GS     +G+  RG+ ++L++GDPGTAKSQ LKF  + +P  V T+G GS+ AGLT + +++     + +E GA+VLADGG+ CIDEF  +RE D+VAIHEAMEQQ+IS  +  GI   L +RCSV+AA N   G +D ++    N      +LSRFD+IF++ D  NE  D  ++  ++N         ++ +    L  LK + AY RS   P+M+ EA   L+  Y  MR     +  DR       IT+R LE+++R+S+S A+  ++ F     V E   +  V+ +++ + GS
Sbjct:  148 IAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVHLNAKTQMQAVEGEIELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTLDAALSGS 466          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 184.496 bits (467), Expect = 3.816e-48
Identity = 184/546 (33.70%), Postives = 268/546 (49.08%), Query Frame = 3
Query:  447 GKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQI--KYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTV----IRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSE--MKLDFQLFWEKYHGKSFTAR----NLLISQMCPLIYGMYFLKLALALVLCGSENCFF---NGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQ---------------------TFESSKE--------SFNLEK-------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMEST 1904
            G+ +++  TVVR G+I+ L  +  + C  C    +         FT+ P K        C S  F     S+L+     + Q I VQE +  +    G +PRT++  L  DLVD   PGD + + G V         N    D+C+  L I A  +       S+     +   + LDF L  E Y  +   A+     LL+  +CP IYG   +K  LAL L G    +    N + VRG+ H+LIVGDPG  KSQ L+    + PR V   G  +T AGLTVT  K+  SG ++LEAGALVL D G+CCIDEF  +    + A+ EAMEQQSIS+AKAG+VC L  R S++AA NP  G+Y+ +++++ N  + S LLSRFDL+F+L+D  +E  D  +S+ ++                        T  SS +        S  L+              L+ Y  Y R    P ++ EA+  L+ +Y  +R+         IT R LESLIRL+++ AR  +RE   +EDA   + +M+ +
Sbjct:  220 GRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVLRLPY--GKFTL-PTKRVKCADEDCRSRTFMPNRRSQLTETV--DWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQRSDGGGEDTAPGVALDFSL-KELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPNQHQ-ALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEALDPVPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRRQHHGGDGTPITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHS 758          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.136e-42
Identity = 123/324 (37.96%), Postives = 187/324 (57.72%), Query Frame = 3
Query:  681 RNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLA-LALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKE 1640
            R+ Q I++QE  +    G +PR+  V+LDDDLVD  KPGD V + GT                + +++ N ++ +N  +   +S +   K+     + K H K+    + L   + P I+G  ++K A L L+L G+E    NG ++RG+ ++L++GDP  AKSQ L++     PR++ TTG GS+  GLT  VT  +E+G   LEAGA+VL D G+ CIDEF  + + D+ AIHE MEQ  +++AKAGI  +L  RCSV+AA NP  G YD  ++   N  +   LLSRFDL+F++LD  +  +D  +SD +L    + +  E
Sbjct:  131 RDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGKKAGYTSGTFRTILIGNNVKQMNKEVVPTFSGEDVNKIKT---FSKTHSKNIF--DQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMHRYRAVGE 449          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 5.508e-37
Identity = 115/345 (33.33%), Postives = 179/345 (51.88%), Query Frame = 3
Query:  432 KSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRW-NNLRVNDECVIQLVIL-ANEIQIVNHTISNNYSIK--SEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKA--GIVCKLKTR 1442
            K+  +G+ ++V   V RA  ++ +     Y C +C      E  +  AS +  P   C +       S   +   S+ S KF +  QE+ +QE    +  GC+PR + V +  +   L +PGD + I G  +       R   + ++    L A+ +  +N T  N   ++  SE +L  Q+  E ++ K       L + + P IYG   +K AL L+L G  +    GMK+RG  ++ ++GDPG AKSQ L +  +L PRS  TTG GS+  GLT   +++  +G  +LE GALVLAD G+CCIDEF  + + D+ +IHE MEQQ+IS+AK   G+    +TR
Sbjct:  152 KANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCG----AETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGS-KFVKF-QELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSESEL-RQITEEDFYEK-------LAASIAPEIYGHEDVKKALLLLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTR 482          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 9.482e-37
Identity = 115/347 (33.14%), Postives = 179/347 (51.59%), Query Frame = 3
Query:  432 KSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRW-NNLRVNDECVIQLVIL-ANEIQIVNHTISNNYSIK--SEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKA--GIVCKLKTRCS 1448
            K+  +G+ ++V   V RA  ++ +     Y C +C      E  +  AS +  P   C +       S   +   S+ S KF +  QE+ +QE    +  GC+PR + V +  +   L +PGD + I G  +       R   + ++    L A+ +  +N T  N   ++  SE +L  Q+  E ++ K       L + + P IYG   +K AL L+L G  +    GMK+RG  ++ ++GDPG AKSQ L +  +L PRS  TTG GS+  GLT   +++  +G  +LE GALVLAD G+CCIDEF  + + D+ +IHE MEQQ+IS+AK   G+    +  CS
Sbjct:  152 KANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCG----AETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGS-KFVKF-QELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSESEL-RQITEEDFYEK-------LAASIAPEIYGHEDVKKALLLLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCS 484          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 204.527 bits (519), Expect = 4.567e-55
Identity = 123/319 (38.56%), Postives = 198/319 (62.07%), Query Frame = 3
Query: 1008 LLISQMCPLIYGMYFLKLALA-LVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF---------ESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDR-------ITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMEST 1904
            +L + + P I+G   +K A+  L++ GS+    +GM++RG+ ++L++GDPGTAKSQ LKF  K++P +V T+G GS+ AGLT +  ++  +  + LE GA+VLADGG+ CIDEF  +R+ D+VAIHEAMEQQ+IS+AKAGI   L +R SV+AA NP  G YD  +S   N    + +LSRFD+IF++ D+ NE  D  +++ ++N  T          E +    ++EK+K Y  Y R    P+++P+A+  L   +  +RK  + N L+        IT+R LE++IR+++S A+  +    +E     A+ + +++
Sbjct:  369 ILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQAS 687          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 206.453 bits (524), Expect = 7.185e-55
Identity = 127/285 (44.56%), Postives = 183/285 (64.21%), Query Frame = 3
Query: 1011 LISQMCPLIYGMYFLKLALAL-VLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFI--LNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSE---ITNSLDRITMRFLESLIRLSQSHAR 1838
            L+  + P ++G   +K  + L +L G       G+K+RG+ ++ +VGDP T+KSQFLK+     PRSV T+G  S+ AGLT   V+  E G +++EAGAL+LAD GICCIDEF  +   D+VAIHEAMEQQ+IS+AKAGI   L  R S++AA NP  G Y+   S+  N  + +P++SRFDL F++LD+CNE  D+ ++  I  L+ +  E+ +  F+ E+L+ Y  Y R TF P +T EA   L + Y  +RK +    + S  RIT+R LES+IRLS++ AR
Sbjct:  529 LVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYAR-TFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIAR 812          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 199.134 bits (505), Expect = 6.255e-53
Identity = 177/551 (32.12%), Postives = 271/551 (49.18%), Query Frame = 3
Query:  480 RAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWN-NLRV-NDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFT--ARNL-----LISQMCPLIYGMYFLKLALALVLCGSENCFFNGMK-VRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGN-YDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-----HQTFESSKESFNL-----------------------------------------EKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAF 1955
            R G    L++ + + C KC   +   F +S+    I+   FC+N    C S     V   K      RN Q + +QE    +  G +PR  +VIL  DLVD+ KPG++V + G     ++ NL   N   V   +I AN I+      +N    + E  LD    W +   + F   +R+      +IS M P IYG   +K A+A  L G      NG   +RG+ ++L++GDPGTAKSQ LK+  K   R+V  TG G++  GLT +  K+  +  W+LE GALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RCS+IAA NP G  Y+ T  +  N ++  P+LSRFD++ ++ D  +E  D  ++ F+++     H   +  +E   L                                         E L  Y  Y R+  +PK+       + + Y  +R+  I+     IT+R LES++R+++S A+  + EFV   D   A+ V+  +   +  +S  +QL  +F
Sbjct:  327 RTGVFPQLKYVK-FNCLKCGSILGPFFQDSNEEIRIS---FCTN----CKSKGPFRVNGEKT---VYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTAN----EGEEGLDV-FSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSF 861          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 190.274 bits (482), Expect = 6.009e-50
Identity = 123/313 (39.30%), Postives = 184/313 (58.79%), Query Frame = 3
Query: 1008 LLISQMCPLIYGMYFLKLALALVLCGSEN-CFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGN-YDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFE-----SSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLD--RI--TMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            LL   + P IY +  +K  + L L G  N  F  G + RG+ ++L+ GDP T+KSQ L++ HK+TPR V T+G GS+  GLT  +T   ++    LE+GALVL+DGG+CCIDEF  + +  +  +HE MEQQ+IS+AKAGI+  L  R S++A+ NP G+ Y+    +T N  +  PLLSRFDL++L+LD  +E  D  ++  + N    +     S  +   +E L  Y +Y +   HP +T  A   L + Y  MRK    +  D  RI  T R LES+IRL+++HA+  ++  V+ ED   AV ++ S +
Sbjct:  521 LLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 167.162 bits (422), Expect = 1.501e-42
Identity = 102/228 (44.74%), Postives = 140/228 (61.40%), Query Frame = 3
Query: 1005 NLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTF--------ESSKESFNL 1652
            ++L   + P IYG   +K A+ L+L G  E    NG  +RG+ ++L+VGDP TAKSQ L+F       ++ TTG GS+  GLT  VT  +E+G   LEAGA+VLAD G+ CIDEF  + + D+VAIHE MEQQ++++AKAGI   L  RCSVIAA NP  G YD+ +    N A+   LLSRFDL+F++ D+ NE  D  +S+ +L    +        E  +E  NL
Sbjct:  361 DILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNL 588          

HSP 2 Score: 48.521 bits (114), Expect = 6.378e-6
Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 3
Query: 1659 LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTV 1922
            L+ Y  Y +    P++T EA  ++ K YT +R  + T     IT R LE+LIRL+ +HA+  + + V + DA +A  ++   + G  +
Sbjct:  656 LRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKK-SPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDI 742          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Match: EDO42446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E9])

HSP 1 Score: 491.115 bits (1263), Expect = 3.153e-161
Identity = 268/561 (47.77%), Postives = 385/561 (68.63%), Query Frame = 3
Query:  366 PNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-----FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            PN  VR+++LP C E+ R++IPKS D+G+FL+V+ TV+R  SI++LE +RE+IC +CK+ V    ++ +  +TI  P  C +   GC S+ F+ +     +P  CR+ QEI +QEQ++ L+ G +PR++ V+L+DDLVD  K GDDV I+G V+RRW  +    +C +++V  AN +  VN+       +  EMK +F  FW K+  K  + RN +++  CP +YG+Y +KLA+ L+L G  +    +G +VRGESHML++GDPGT KSQFLK++ K+ PRSVLTTGIGST+AGLTV AV++SG W LEAGALVLADGG+CCIDEF SIRE D+ +IHEAMEQQ+ISVAKAG+VCKL TR +++AATNPKG  DI QS++ NTA+ASPLLSRFDL+F+L D  NE WD  VS FIL  +    S E      + +++L++Y  + + T  P++  +++ +L +YY   R+++  N+  R T+R LESLIRL+Q+HAR M RE V  +DAV+AV  +E ++  + +L     L + FP DPE+EY+     I K+L +   +
Sbjct:    5 PNIHVRLSNLPICPELKRSTIPKSSDMGRFLAVSGTVIRVSSIKMLEHEREFICSRCKY-VFSAQADFEQFYTIPKPTSCPS-GEGCTSNKFNCLSEPGSNPTSCRDYQEIKIQEQVQKLAVGTIPRSMWVVLEDDLVDSCKAGDDVTISGVVMRRWWPVIAEVKCDLEVVFKANHVS-VNNEQRIGAIVTEEMKQEFDEFWSKHKDKPLSGRNHILASFCPQVYGLYAVKLAVTLILMGGVQRVDASGTRVRGESHMLLIGDPGTGKSQFLKYSAKIMPRSVLTTGIGSTSAGLTVAAVRDSGEWQLEAGALVLADGGLCCIDEFNSIREHDRGSIHEAMEQQTISVAKAGMVCKLNTRTTILAATNPKGQLDIDQSLSVNTALASPLLSRFDLVFVLQDVKNEDWDRIVSSFILEGKGVRMSAEKPAEALWGMDRLQAYICHAK-TLEPQLNTDSNRVLRQYYQCQRQADTRNAA-RTTLRLLESLIRLAQAHARLMYREHVTVQDAVVAVTCVECSMQNTALLGCMNALHTRFPDDPEQEYKQQAKLILKRLGLTDLM 560          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 234.958 bits (598), Expect = 1.620e-64
Identity = 194/607 (31.96%), Postives = 302/607 (49.75%), Query Frame = 3
Query:  207 LRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQ------TFESSKES-----FNLEK-------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAF 1955
            L ID  IL  +   ++ +L     ++++IF+    +++ +    M     +      VRI  LP  +E+      + + V + +     V  +  I       +Y C KC F +   F  SD       P  C    S      F+I     +     +N Q+I +QE    ++ G +PR   VIL  DLVD  KPGD++ + G     +++   R N   V   +I AN I   +  ++       ++K    L  ++  G+       +I+ + P IYG   +K ALAL L G       G  K+RG+ ++L+ GDPGTAKSQFLK+  K  PR+V TTG G++  GLT    +   +  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RCS++AA NP  G YD + +   N  +  P+LSRFD++ ++ D  +   D  ++ F++N        T E+  E      F L +       LK Y  Y R   HP++       + K +  +RK  +      IT+R +ES+IR+++SHA+  +RE+V E+D  MA+ VM  +   +   S  + +  AF
Sbjct:  154 LVIDYNILANEQQVLAYFLPEAPTEMLQIFDEAAKEVVLA----MFPNYDRITTEIHVRIAELPLMEELRSL---RQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSFILGPFFQGSDQEVK---PGSCPECQS---RGPFEI----NMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNRSNGFPVFATIIEANFITKQDDKMAVTSLTDEDIKAINALSKDERIGER------IIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNTPENEDEDMEVHMFTLRRNAIPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATGSIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVMLESFIDTQKFSVMRNMKKAF 737          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 199.519 bits (506), Expect = 8.265e-53
Identity = 183/582 (31.44%), Postives = 285/582 (48.97%), Query Frame = 3
Query:  399 FCDEISRTSIPK--SVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSN-YSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI--------------------------------RRWNNLRVNDECVIQLVILANEIQIVNHTISNN---------YSIKSEMK-LDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-HQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRK---SEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV--YGSTVLSTDQQLPSAFPTDPEEE 1976
            F D  +R  I +  S  +G  L ++  VVR   +        + C  C+ +VI +  +    F    P  C N         A DI +S  +      + Q++ +QE    L  GC+PR+++VIL  + V+  + GD     GT+I                                R    L V D    +L  LA  +Q  N                +IK +M   ++Q  +E    K+      +I+ + P I+G   +K  + L+L G           +RG+ ++ +VGDP TAKSQFLK   + + R+V T+G  S+ AGLT   VK  ES  + +EAGA++LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R SV+AA NP  G YD T+S+  N  +++P++SRFDL F+L+D CNE  D  ++  I++ H   E S E  + +++++ Y  + R  F P +T EA   + + Y  +R+   S  T S  RIT+R LES+IRLS++ AR   ++ V+ +    A  ++  ++    +  +  D++      TD  EE
Sbjct:  108 FIDLPTRHKIRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQ-TVIKDVEQQ---FKYTQPTVCRNPICQNRARFALDINKSRYV------DFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRD-LTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQN--IINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRREQSVERVYAVDEVQRYLTFARQ-FKPTITKEAQDYMVEQYKHLRERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSIIRVETPDIQFDEEGEEDMETDNNEE 675          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Match: EDO48453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT1])

HSP 1 Score: 188.348 bits (477), Expect = 1.397e-49
Identity = 124/331 (37.46%), Postives = 196/331 (59.21%), Query Frame = 3
Query: 1005 NLLISQMCPLIYGMYFLKLALA-LVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILN-----HQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDR-------ITMRFLESLIRLSQSHARFMMREF-----VKEEDAVMAVAVMESTVYGSTVLSTD 1934
            +++   + P IYG   +K  +A L+  GS     +G+  RG+ ++L++GDPGTAKSQ LKF  K++P  V T+G GS+ AGLT + +++  S  + +E GA+VLADGG+ CIDEF  +RE D+VAIHEAMEQQ+IS+AKAGI   L +RC+V+AA N   G +D T+    N      +LSRFD IF++ D  N++ D  ++  ++       QT ++++   +L  LK Y +Y +S   P+++  A+  L+  Y  MR     +  D        IT+R LE++IR+S+S A+  +  F     V E   +  V+ +++ + GS   ++D
Sbjct:  329 DVIARSIAPSIYGSVDIKKCIACLLFGGSRKRLPDGLTRRGDINVLLLGDPGTAKSQLLKFVEKVSPIGVYTSGKGSSAAGLTASVMRDPVSRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCAVLAAANSVFGRWDDTKG-DQNIDFMPTILSRFDTIFIVKDEHNQAKDIHLAKHVMQVHLNAAQTTQANEGELSLSFLKKYISYCKSKCGPRLSESAAEKLKNRYVLMRSGAKEHERDTEKKISIPITVRQLEAIIRISESLAKMSLSPFATETHVDEALRLFQVSTLDAAMSGSLAGASD 658          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 178.333 bits (451), Expect = 2.315e-46
Identity = 160/495 (32.32%), Postives = 252/495 (50.91%), Query Frame = 3
Query:  444 VGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTAR--NLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSD---FILNHQTFESSK-ESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRIT-MRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVME 1898
            +GK   V   V+R   ++ +     Y C +C      E  ++  S T  P   C +       +   +   ++ S KF +  QE+ +QE    +  G +PR++ +I   +   L  PGD V + G  +     ++     + Q  +L++     +  +  N +   EM  D  L  E+    S  A   + L S + P IYG   +K AL L+L G  +C  +GMK+RG  ++L++GDPG AKSQ L +  +L PRS  TTG GST  GLT   +K+  +G   LE GALVLAD G+CCIDEF  + + D+ AIHE MEQQ++S+AKAGI+  L  R S++AA NP  G Y+  +S   N  + + LLSRFDL++L+ D  ++  D  ++    ++  H     S  +  ++  ++ Y A  +    P +  E S  +   Y  MRK    N     T  R L +++RL+ + AR  + + V++ED   A+ +ME
Sbjct:  156 IGKLTVVRGIVMRCTEVKPVVEVATYTCDQCG----AESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGS-KFVKF-QELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIFL---PMMKTGFRQMTQ-GLLSDTFLEAHRIVRMNKTEDDEMPTD-DLSDEEIRALSTEADFYDKLASSLAPEIYGHEDIKKALLLLLVGGVDCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQHSAHPPSHYDPLDMNLMRRYIAACKEK-QPIVPGELSDYIVSAYVEMRKDARNNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLME 638          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Match: mcm9 (minichromosome maintenance 9 homologous recombination repair factor [Source:NCBI gene;Acc:101172783])

HSP 1 Score: 482.641 bits (1241), Expect = 6.455e-151
Identity = 268/540 (49.63%), Postives = 369/540 (68.33%), Query Frame = 3
Query:  375 QVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKES-FNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYR 1982
              RIT LP C E++R +IP+S DVG FLSV  TV+R    +VLE++R+Y+C KC+  F V  +F   D  +T + P  C +  +GC S  F  + S    P  CR+ QEI +QEQ++ LS G +PR++ VIL+DDLVD  K GDDV I G +  RW  L     C ++LV+ AN ++ VN+  +    + ++ + +F+ FW  Y       RN ++  +CP ++GMY +KLA+A+VL G  +    +G +VRGE HML+VGDPGT KSQFLK+A K+TPRSVLT GIGSTNAGLTV AVK+ G W LEAGALVL+DGG+CCIDEF SI+E D+++IHEAMEQQSISVAKAGIVCKL TR +++AATNPKG YD  + ++ N A+ASPLLSRFDL+ +LLDN N  WD  +S FIL  Q   +   + +++EK+K+YF  I+    P++  +A++IL +YY   R+S+  N+  R T+R LESL RL+++HAR M R+ V  EDAV+AV++ME ++ G  +L     L ++FP DP E+YR
Sbjct:  105 HARITGLPVCPELTRHTIPRSKDVGHFLSVTGTVIRTSVAKVLEYERDYMCTKCRHVFKVHADF---DQFYTFSAPVSCPS-PAGCNSMKFSCL-SEGSEPAACRDYQEIKIQEQVQRLSVGSIPRSLVVILEDDLVDGCKSGDDVTIYGVMCLRWKPLYDGTRCEVELVLRANNLE-VNNQQTAAAQLLTDAQKEFEEFWRSYEHDPMAGRNQILLSLCPQVFGMYVVKLAVAMVLAGGVQRIDPSGTRVRGECHMLLVGDPGTGKSQFLKYAAKITPRSVLTAGIGSTNAGLTVAAVKDGGEWHLEAGALVLSDGGLCCIDEFNSIKEHDRISIHEAMEQQSISVAKAGIVCKLNTRTTILAATNPKGQYDPNEPLSVNVALASPLLSRFDLVLVLLDNRNAEWDRVISSFILEEQGLPAESSALWSMEKMKAYFCVIKQ-LQPQVCDQANLILTRYYQVQRRSDGRNAA-RTTIRMLESLSRLAEAHARLMFRDTVTIEDAVVAVSIMECSMQGGALLGNVNALLTSFPADPVEQYR 636          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 220.32 bits (560), Expect = 6.225e-59
Identity = 182/574 (31.71%), Postives = 293/574 (51.05%), Query Frame = 3
Query:  249 ISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNL--RVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG-MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKE--SGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNH--QTFESSKE-SFNLEK----------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVM 1895
            ++ +L     +++K+F+   AK +  ++      +  EI    VR+++LP  +EI      + + + + +  +  V     +       +Y C KC F V+  F +S        P  C    S      F++     +     +N Q I +QE    ++ G +PR+   IL  DLVD  KPGD++ + G     ++      N   V   VILAN I   +  ++       ++K    L  ++  G+       + + + P IYG   +K ALAL L G E     G  KVRG+ ++L+ GDPGTAKSQFLK+  K+  R+V TTG G++  GLT    +   S  W+LEAGALVLAD G+C IDEF  + + D+ +IHEAMEQQSIS++KAGIV  L+ RC+V+AA NP  G YD + +   N  +  P++SRFD++ ++ D  +   D  ++ F++    +   S+KE    LE+                L+ Y  Y +   HPK+       + + Y+ +RK  +      IT+R +ES+IR++++HA+  +R++V E+D  MA+ VM
Sbjct:  232 LAYFLPEAPAEMLKVFDEA-AKEVVLAMYPKYDRIAHEI---HVRVSNLPLVEEIRAL---RQLHLNQLIRTSGVVSCCTGVLPQLSMVKYNCSKCSF-VLGPFFQSQNQEV--KPGSCPECQS---QGPFEV----NMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHISRRDEGVAVAELTDEDVKAIVALSKDECIGER------IFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSTKEGGVALEEMVLPNTTDVSPIPQDLLRKYIIYAKERVHPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVM 782          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:101159855])

HSP 1 Score: 206.838 bits (525), Expect = 8.746e-55
Identity = 178/542 (32.84%), Postives = 275/542 (50.74%), Query Frame = 3
Query:  378 VRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-------------RRWNNLRVND-------------------ECVIQLVILANEIQIVNHTISNNY---------SIKSEMKLDFQLFWEKYHGKSFTARNL---LISQMCPLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFI--LNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLD----RITMRFLESLIRLSQSHARF 1841
            V I  LP   +I   S   S+ +G  + ++  VVR   +        ++C  C+  +     +    F  +PP  C N    C + +   +++ K   KF  + Q++ +QE    L  G +PR+++V+L  + V+  + GD     GT+I             R   + RV                     E   +L  LA  +   N                SIKS+M    +  WEK    S   +NL   L + + P I+G   +K  + L+L G        G  +RG+ ++ IVGDP TAKSQFLK   + +PR+V T+G  ST AGLT   V+  ES  + +EAGAL+LAD G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAG+   L  R S++AA NP  G YD ++S+  N  + +P++SRFDL F+L+D+CNE  D  ++  I  L+ +  ES    ++L++++ Y  + R  F PK++ E+   + + Y  +R+ + T S+     RIT+R LES+IRLS++ AR 
Sbjct:  109 VAIEDLPTRHKIRELS---SMRIGTLVKISCQVVRTHPVHPELVSGTFVCMDCQMVI----KDVPQQFKYSPPTICRN--PVCSNRSRFHLDTHK--SKFI-DFQKVRIQETQAELPRGSIPRSLEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSQLSTPGLRAETSSRVGGGRQGYEAEGLRGLKALGVRELSYRLAFLACNVAPTNPRFGGKELRDEEQTAESIKSQMT---EKEWEKVFEMS-QDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDVNVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASTAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDIKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRVEESVDRLYSLDEIRRYLLFARQ-FKPKISKESEEFIVEQYKRLRQRDSTGSVSKSAWRITVRQLESMIRLSEAMARM 633          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:101154800])

HSP 1 Score: 205.297 bits (521), Expect = 3.528e-54
Identity = 185/545 (33.94%), Postives = 276/545 (50.64%), Query Frame = 3
Query:  447 GKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQI--KYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNN---LRVN-DECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTA----------RNLLISQMCPLIYGMYFLKLALALVLCGSENCFF--NGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKES--GGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFES-------------SKESFNLEK------------------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            G+ + V  TVVR  +I+ L  +  + C+ C  ++         +     P  C     GC S +F  + SS L+     + Q I VQE +  +    G +PRT++  L  DL D   PGD VI+ G V  R NN    R N D+C+  L I A  +      +S +   +S   L+ +   E++  K   A            LL+  +CP IYG   +K ALAL L G        N + VRG+ H+LIVGDPG  KSQ L+    + PR +   G  ++  GLTV+  +++  G ++LEAGALVLAD G+CCIDEF  +    + A+ EAMEQQS+S+AKAGIV  L  R SV+AA NP  G+Y+  ++++ N  + S LLSRFD++FLLLD  +ES D C+S+ ++ ++  +              S+ S  L+                         L+ Y +Y R   HP ++PEA+  L+ +Y  +R    +     IT R LESLIRL+++ A+  +RE     DA   V +M+ ++
Sbjct:  221 GRLVCVKGTVVRVSNIRPLCTRMAFRCQTCTSAMSLPLQHGKYAT----PTKC--IQPGCRSRSFAPLRSSALT--LTVDWQIIKVQELMGGEQRETGRIPRTVECHLTSDLCDSCVPGDTVIVTGIV--RVNNDGSSRGNKDQCMFLLYIDATSVSNTKGQLSKSVGEESSGSLEDRSGGEEFSLKELYAVQEIQSQPDLLRLLVHSLCPAIYGHSLVKAALALALFGGRQKHMGKNSVPVRGDPHILIVGDPGLGKSQMLQAVCNVAPRGIYVCGNSTSTTGLTVSLSRDAGTGDYALEAGALVLADQGLCCIDEFDKLGN-QQQALLEAMEQQSVSLAKAGIVSSLPARTSVVAAANPVGGHYNRGKTVSENLKMGSALLSRFDVVFLLLDIPDESHDRCLSEHVMANRAGKGRSSGAVVTRANGESETSILLQHSDMPLSERLQVPAGQTLDLIPACLLRKYISYARQYVHPTLSPEAAQTLQDFYLSLRSQASSADSTPITTRQLESLIRLTEARAKLELREMATRGDAEDVVEIMKHSL 754          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:101154800])

HSP 1 Score: 187.193 bits (474), Expect = 1.549e-48
Identity = 180/531 (33.90%), Postives = 265/531 (49.91%), Query Frame = 3
Query:  447 GKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQI--KYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFF--NGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKES--GGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFES-------------SKESFNLEK------------------------LKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            G+ + V  TVVR  +I+ L  +  + C+ C  ++         +     P  C     GC S +F  + SS L+     + Q I VQE +  +    G +PRT++  L  DL D   PGD VI+ G V  R NN    D+C+  L I A        ++SN   I  +M +  Q  W       FT         C L+      K ALAL L G        N + VRG+ H+LIVGDPG  KSQ L+    + PR +   G  ++  GLTV+  +++  G ++LEAGALVLAD G+CCIDEF  +    + A+ EAMEQQS+S+AKAGIV  L  R SV+AA NP  G+Y+  ++++ N  + S LLSRFD++FLLLD  +ES D C+S+ ++ ++  +              S+ S  L+                         L+ Y +Y R   HP ++PEA+  L+ +Y  +R    +     IT R LESLIRL+++ A+  +RE     DA   V +M+ ++
Sbjct:  205 GRLVCVKGTVVRVSNIRPLCTRMAFRCQTCTSAMSLPLQHGKYA----TPTKC--IQPGCRSRSFAPLRSSALT--LTVDWQIIKVQELMGGEQRETGRIPRTVECHLTSDLCDSCVPGDTVIVTGIV--RVNNDGNKDQCMFLLYIDAT-------SVSNTKGIVCQMLMQTQ--W------VFT-----FLPFCSLV------KAALALALFGGRQKHMGKNSVPVRGDPHILIVGDPGLGKSQMLQAVCNVAPRGIYVCGNSTSTTGLTVSLSRDAGTGDYALEAGALVLADQGLCCIDEFDKLGN-QQQALLEAMEQQSVSLAKAGIVSSLPARTSVVAAANPVGGHYNRGKTVSENLKMGSALLSRFDVVFLLLDIPDESHDRCLSEHVMANRAGKGRSSGAVVTRANGESETSILLQHSDMPLSERLQVPAGQTLDLIPACLLRKYISYARQYVHPTLSPEAAQTLQDFYLSLRSQASSADSTPITTRQLESLIRLTEARAKLELREMATRGDAEDVVEIMKHSL 698          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Match: SMESG000023015.1 (SMESG000023015.1)

HSP 1 Score: 1464.9 bits (3791), Expect = 0.000e+0
Identity = 775/777 (99.74%), Postives = 775/777 (99.74%), Query Frame = 3
Query:   63 MNLLESIEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFIPPNNPGIVQDKPFARPPLISKPKRLTALPSVTQKSNTSILNITFNKSILDNFHDVTQIDCSQVNQSXXXXXXXXXXXXXXXAIHSTVSGRLTALPIVSSGRNIFSDSITDTKDLTDDDFEL 2393
            MNLLESIEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVILDDDLVDLVKPGDDVIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPLLSRFDLIFLLLDNCNESWDSCVSDFILNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFIPPNNPGIVQDK FARPPLISKPKRLTALPSVTQKSNTSILN TFNKSILDNFHDVTQIDCSQVNQSINIIDEIFNENNNDNAIHSTVSGRLTALPIVSSGRNIFSDSITDTKDLTDDDFEL
Sbjct:    1 MNLLESIEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINECETLVLRIDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKEIPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVILDDDLVDLVKPGDDVIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPLLSRFDLIFLLLDNCNESWDSCVSDFILNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFIPPNNPGIVQDKLFARPPLISKPKRLTALPSVTQKSNTSILNSTFNKSILDNFHDVTQIDCSQVNQSINIIDEIFNENNNDNAIHSTVSGRLTALPIVSSGRNIFSDSITDTKDLTDDDFEL 777          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Match: SMESG000004906.1 (SMESG000004906.1)

HSP 1 Score: 212.616 bits (540), Expect = 3.797e-57
Identity = 194/598 (32.44%), Postives = 296/598 (49.50%), Query Frame = 3
Query:  333 NDMGVTLGKEIPNC--QVRITSL-PFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQE----------------QIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVND------ECVIQLVILANEI----QIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG---MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKES-GGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFES----------------------------------SKESFN---LEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYG 1913
            N++      ++PN    VRI +  P C  ++     ++  +G F+SV   VV+   ++ +  + ++ C  CK   I    + D  F +  P  C N    C S +F+ ++ S  +     + Q I +QE                     + G +P+T+  IL  DLVD   PGD+VI+ G V+    +   +        C+  LV+  N I      V   + +  S  +E  +      E  H +    + LL++ +CP IYG   +K +L L L G    F N    + +RG SH+LIVGDPG  KSQ L+ A  + PRSV   G   T AGLTV+  K+S  G +LEAGALV++D G CCIDEF  +      ++ EAMEQQSIS+AKAG+VC L  R SV+AA NP  G+Y+  +++  N  +++PLLSRFDL++++LD  NE  DS +S  +L+  T +S                                   KES +    + L+ Y AY +   HPK++ EA+ IL+++Y  +RK         IT R LES++RL+++ AR  +RE   E+DA     +M  ++ G
Sbjct:   79 NNISSISNSDLPNIYINVRIANFSPICKSLNL----QANQIGSFISVKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPD-DYKFAV--PTRCVNRV--CKSKSFEPLKESDETVTI--DYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFK-LLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDSDSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTLHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMG 664          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 206.068 bits (523), Expect = 7.866e-55
Identity = 174/542 (32.10%), Postives = 267/542 (49.26%), Query Frame = 3
Query:  441 DVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSS-AFDIVESSKLSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVI-------------------------------RRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGK------SFTARNLLISQMC----PLIYGMYFLKLALALVLCGS-ENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVK--ESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNP-KGNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQT----FESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEI---TNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTV 1907
            ++GK +     V+R+  +        + C+ C   V       +  F    P  C N    C++   F+++        F    Q++ VQE    L  GC+PR + VIL ++ V+  +PGD     G++I                                    L V D    ++  LAN +  VN+       +  E +L +    +K   +      +      L+  MC    P  YG   +K  L L+L G        G K+RG+ ++ IVGDP TAKSQFLK     +PR+V T+G  S+ AGLT   V+  ESG + +EAGAL+LA+ G+CCIDEF  +   D+VAIHEAMEQQ+IS+ KAGI   L  + SV+AA NP  G YD ++S+  N ++++P++SRFDL F+L+D C E  D  ++  I   Q      +S    +N + ++ Y  + R  F P++T EA  ++   Y  MR+ +    + S  RIT+R LESL+RLS++ AR    +FV+E D V A  ++  ++
Sbjct:  126 NLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVV----KNIEQQFIFTKPTICGN--PQCMNRLKFELIPEQSKYVDF----QKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRD-LTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSI 655          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 193.741 bits (491), Expect = 5.309e-51
Identity = 175/579 (30.22%), Postives = 293/579 (50.60%), Query Frame = 3
Query:  432 KSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINP-------PKFCSNYSSGCVSSAFDIVESSKLSPKF-------CRNRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIING-TVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTAR----NLLISQMCPLIYGMYFLKLALA-LVLCGSENCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKESGGWS--LEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFILNHQTFESSKESFN----------------LEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMR-------KSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKLQIKSFI 2030
            KS  + K + ++  VV A  I+         CK C+  +         S ++ P       P+ C   +S          +S  + P +       C + Q + +QE  + +  G MPR  ++ +D  L +   PG+ V + G + I + +++ +  + V       + I+++N  I N  S +S +        E+   + F+ +     ++   + P IYG   +K A+A L+  GS      G+ +RG+ +M+++GDPGTAKSQ LKF  +  P +V T+G GS+ AGLT + +++S   S  +E GA+VLADGG+ CIDEF  ++E D+VAIHEAMEQQ+IS+AKAGI   L +RCSV+AA N   G++D T+    N      ++SRFD+IF++ D  +E  D  + + +++    +      N                + KLK Y A+ R    P++TPEA  I+  +Y  MR       K    N+   IT+R LE+++R+++S A+  +  F  E DA  A+ + + +   S+ L+ + +    F TD +E   ++K+   +KL  K F+
Sbjct:  133 KSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL--------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKH-----SYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL-SSALTGNLEGVEGF-TDRQEHDVIVKV---EKLMKKRFV 692          
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 177.948 bits (450), Expect = 9.880e-46
Identity = 170/524 (32.44%), Postives = 270/524 (51.53%), Query Frame = 3
Query:  384 ITSLPFCDEISRTSI---PKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCK--FSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCR--NRQEINVQEQIKYLSFGCMPRTIKVIXXXXXXXXXXXXXXXIINGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSI-KSEMKLDFQLFWE-KYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSE----NCFFNGMKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLT--VTAVKESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPKGN-YDITQSITANTAIASPXXXXXXXXXXXXXNCNESWDSCVSDFIL-----NHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNS-LDRITM--RFLESLIRLSQSHARFMMREFVKEEDAVMA 1883
            I + P+  EISR      P+ +D  + ++V   V+R   I     +  + C  C     V CE         I  P+FC+     C +       + ++    C   ++Q + +QE  + +  G  P T+ +    DLVD ++PGD V + G  I R  + R N +  +   +    + +++   S N  I + E KL  +   E +   +       L   + P IYG   +K  L ++L G           G  +R   H+L+ GDPGT+KSQ L++ + LTPR   T+G GS+  GLT  +T   E+G  +L++GAL L+D GICCIDEF  + +  +  +HE MEQQS+S+AKAGI+C+L  R SV+AA NP G+ +D  ++I  N  +   LLSRFDLIFL+LD  +E +D+ ++  I+     +++T E    + +   L+ Y AY +   HP ++ EA   + + Y  MRK  + N+   +I+   R LESLIRL+++HAR  + + V   D + A
Sbjct:  171 ILTRPYNCEISRNLRNLNPEDLD--QLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGR------IIDPEFCNQ----CQAK-----HTQQIVHNCCEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG--IYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPG--TVDTAMLRDYIAYAKENIHPILSEEAENYVTEEYVEMRK--VGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEA 671          
The following BLAST results are available for this feature:
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM91.276e-16045.23minichromosome maintenance 9 homologous recombinat... [more]
MCM91.276e-16045.23minichromosome maintenance 9 homologous recombinat... [more]
MCM93.939e-7740.72minichromosome maintenance 9 homologous recombinat... [more]
MCM23.238e-6130.20minichromosome maintenance complex component 2 [So... [more]
MCM22.720e-5739.63minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-24.618e-5732.84DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-24.618e-5732.84DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-72.890e-5331.40DNA replication licensing factor MCM7 [Source:Uni... [more]
mcm-67.447e-5044.31DNA replication licensing factor mcm-6 [Source:Un... [more]
mcm-61.111e-4932.63DNA replication licensing factor mcm-6 [Source:Un... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm22.830e-6131.88gene:FBgn0014861 transcript:FBtr0081827[more]
Mcm61.723e-5132.84gene:FBgn0025815 transcript:FBtr0070952[more]
Mcm54.295e-4635.29gene:FBgn0017577 transcript:FBtr0082279[more]
Mcm37.495e-4533.83gene:FBgn0284442 transcript:FBtr0340476[more]
Mcm31.253e-4433.33gene:FBgn0284442 transcript:FBtr0070762[more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm92.017e-14749.63minichromosome maintenance 9 homologous recombinat... [more]
mcm28.154e-5831.89minichromosome maintenance complex component 2 [So... [more]
mcm82.208e-5734.41minichromosome maintenance 8 homologous recombinat... [more]
mcm6l7.294e-5433.21MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm6l3.626e-5333.01MCM6 minichromosome maintenance deficient 6, like ... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sass62.264e-16044.43spindle assembly 6 homolog [Source:Xenbase;Acc:XB-... [more]
sass66.975e-16044.43spindle assembly 6 homolog [Source:Xenbase;Acc:XB-... [more]
sass61.681e-15944.43spindle assembly 6 homolog [Source:Xenbase;Acc:XB-... [more]
adat31.677e-6131.54adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
adat32.087e-6131.54adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm92.697e-16345.12minichromosome maintenance 9 homologous recombinat... [more]
Mcm91.117e-16145.12minichromosome maintenance 9 homologous recombinat... [more]
Mcm92.523e-7940.58minichromosome maintenance 9 homologous recombinat... [more]
Mcm92.156e-7338.06minichromosome maintenance 9 homologous recombinat... [more]
Mcm23.323e-6029.89minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1M5F3|MCM9_RAT7.025e-16345.44DNA helicase MCM9 OS=Rattus norvegicus OX=10116 GN... [more]
sp|Q2KHI9|MCM9_MOUSE1.886e-16245.12DNA helicase MCM9 OS=Mus musculus OX=10090 GN=Mcm9... [more]
sp|Q9NXL9|MCM9_HUMAN6.129e-16045.23DNA helicase MCM9 OS=Homo sapiens OX=9606 GN=MCM9 ... [more]
sp|F1N2W9|MCM9_BOVIN3.434e-15945.29DNA helicase MCM9 OS=Bos taurus OX=9913 GN=MCM9 PE... [more]
sp|F6RIX4|MCM9_XENTR3.990e-15944.43DNA helicase MCM9 OS=Xenopus tropicalis OX=8364 GN... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H0WRA36.550e-16445.23Minichromosome maintenance 9 homologous recombinat... [more]
G1NKV59.503e-16444.36Minichromosome maintenance 9 homologous recombinat... [more]
A0A3M6UYU42.472e-16344.41MCM domain-containing protein OS=Pocillopora damic... [more]
K3W4U81.677e-16045.44DNA helicase MCM9 OS=Rattus norvegicus OX=10116 GN... [more]
G1TAF06.206e-16045.29Minichromosome maintenance 9 homologous recombinat... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm91.355e-15145.08minichromosome maintenance 9 homologous recombinat... [more]
mcm23.384e-5831.54minichromosome maintenance complex component 2 [So... [more]
mcm24.280e-5831.42minichromosome maintenance complex component 2 [So... [more]
mcm24.349e-5831.54minichromosome maintenance complex component 2 [So... [more]
mcm82.567e-5734.50minichromosome maintenance 8 homologous recombinat... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm51.409e-4938.13minichromosome maintenance complex component 5 [So... [more]
mcm83.816e-4833.70minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000008164.11.136e-4237.96pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
ENSPMAT00000006035.15.508e-3733.33pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000006014.19.482e-3733.14pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM54.567e-5538.56Component of the Mcm2-7 hexameric helicase complex... [more]
MCM67.185e-5544.56Protein involved in DNA replication; component of ... [more]
MCM26.255e-5332.12Protein involved in DNA replication; component of ... [more]
MCM46.009e-5039.30Essential helicase component of heterohexameric MC... [more]
MCM31.501e-4244.74Protein involved in DNA replication; component of ... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424463.153e-16147.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350601.620e-6431.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339718.265e-5331.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484531.397e-4937.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379462.315e-4632.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm96.455e-15149.63minichromosome maintenance 9 homologous recombinat... [more]
mcm26.225e-5931.71minichromosome maintenance complex component 2 [So... [more]
mcm68.746e-5532.84minichromosome maintenance complex component 6 [So... [more]
mcm83.528e-5433.94minichromosome maintenance 8 homologous recombinat... [more]
mcm81.549e-4833.90minichromosome maintenance 8 homologous recombinat... [more]
back to top
BLAST of Minichromosome maintenance 9 homologous recombination repair factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023015.10.000e+099.74SMESG000023015.1[more]
SMESG000004906.13.797e-5732.44SMESG000004906.1[more]
SMESG000038798.17.866e-5532.10SMESG000038798.1[more]
SMESG000005389.15.309e-5130.22SMESG000005389.1[more]
SMESG000060238.19.880e-4632.44SMESG000060238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011540 ID=SMED30011540|Name=Minichromosome maintenance 9 homologous recombination repair factor|organism=Schmidtea mediterranea sexual|type=transcript|length=3524bp
AAAATTGAATGTTTTAAAAATGCTCAATTAGAAATTCTTATTATTCACTA
TCTTAAAAATAAATGAATTTGCTAGAATCAATTGAAGGACGTCATTATTT
TCTGAACATCTTAACTGATTATTTATCTAAAAACCACATTCAAGATATTC
AAAATATCATAAATGCTTCATTTAAGAAGTCTATAAATGAATGCGAGACT
TTAGTATTAAGAATCGATGTAATGATATTATTACAGCAATATCCTTGGAT
TTCAACATACTTGCTAAACAATGCTATTAAGTTAATCAAAATATTTAATT
CTGGATTTGCAAAGTTATTATGTTCATCATTAAACGATATGGGAGTAACT
CTGGGTAAAGAAATTCCGAATTGCCAAGTTAGAATAACTAGTTTACCGTT
TTGCGATGAAATATCAAGAACATCAATTCCGAAATCTGTTGATGTAGGGA
AATTTCTCAGTGTTGCGGCAACCGTTGTTCGCGCAGGCTCTATTCAAGTT
TTGGAATTTCAACGGGAATATATCTGTAAAAAATGCAAGTTTTCAGTCAT
CTGTGAATTCAGTGAATCAGATGCTTCATTTACGATAAATCCACCAAAAT
TCTGTAGCAACTATTCTTCCGGATGTGTGTCGTCAGCTTTTGACATTGTT
GAATCATCGAAATTGTCACCGAAATTCTGTAGAAACAGACAGGAGATAAA
TGTTCAAGAACAAATAAAATATTTGTCGTTCGGATGCATGCCGAGAACAA
TAAAAGTAATTCTTGATGATGATTTGGTAGATCTTGTGAAACCAGGAGAT
GATGTGATTATAAACGGCACTGTGATCCGCCGCTGGAATAATCTGCGTGT
CAATGATGAATGCGTAATTCAACTGGTGATATTAGCCAATGAAATTCAAA
TTGTCAATCATACTATATCTAACAATTACTCTATCAAATCAGAAATGAAA
CTAGATTTCCAACTGTTTTGGGAAAAGTATCACGGAAAAAGTTTCACGGC
AAGAAATCTATTAATTTCACAAATGTGTCCATTAATTTATGGAATGTATT
TTCTGAAATTAGCTCTCGCTCTTGTTTTATGTGGCTCGGAAAATTGCTTT
TTCAACGGAATGAAAGTACGTGGCGAATCACATATGCTAATAGTTGGAGA
TCCTGGAACTGCTAAATCTCAATTTCTTAAGTTTGCACACAAACTGACTC
CTCGTTCTGTGTTAACCACAGGGATCGGATCAACTAATGCAGGTCTTACC
GTTACTGCTGTAAAAGAATCAGGTGGTTGGAGTTTAGAGGCAGGCGCTTT
GGTTTTAGCCGACGGAGGAATATGTTGCATCGATGAATTCACTAGTATTC
GTGAATGTGACAAAGTTGCAATTCATGAAGCAATGGAACAACAGTCAATA
AGTGTTGCAAAAGCTGGAATTGTATGTAAATTGAAAACTCGATGTTCTGT
TATTGCTGCAACTAATCCAAAGGGTAATTATGACATAACTCAATCGATAA
CAGCAAATACCGCCATTGCCAGTCCTTTGTTAAGCCGTTTTGATTTGATA
TTTCTATTACTGGATAATTGCAACGAGTCTTGGGATTCATGCGTGTCAGA
TTTCATTCTCAATCATCAGACCTTTGAAAGTTCAAAAGAGTCATTCAATC
TCGAAAAGTTGAAATCATATTTTGCTTATATTAGAAGCACTTTTCATCCG
AAGATGACTCCGGAAGCTTCAGTTATATTGGAGAAATATTACACGTGGAT
GCGTAAATCAGAAATTACCAATTCACTAGATCGTATAACGATGAGGTTTC
TAGAAAGTCTTATTAGATTAAGCCAAAGTCATGCTCGATTTATGATGAGG
GAATTTGTGAAAGAAGAAGACGCTGTTATGGCAGTAGCCGTAATGGAGTC
AACAGTCTATGGCTCAACGGTATTATCGACTGATCAGCAGCTTCCATCAG
CATTTCCTACAGACCCAGAAGAAGAATATCGTTTACTAAAACTTAATATT
TTCAAAAAATTACAAATAAAATCTTTTATTCCGCCTAATAATCCTGGTAT
TGTTCAAGATAAGCCTTTTGCTAGACCCCCTTTAATATCTAAACCGAAAC
GCCTCACTGCTCTGCCTTCTGTCACACAGAAATCGAATACAAGTATATTA
AACATTACTTTCAACAAAAGCATTCTGGATAATTTTCACGACGTAACCCA
AATTGATTGCAGCCAAGTCAACCAGTCTATTAATATAATTGATGAGATTT
TCAATGAAAACAACAATGACAACGCAATCCATTCAACTGTAAGCGGTCGA
TTAACCGCGTTGCCCATTGTAAGTTCAGGTCGAAATATATTTTCCGATAG
TATTACTGACACAAAAGATTTAACTGATGATGATTTTGAATTGTAAATAT
CATTTGTAAAAAAAATATTTTTCAATTATTAATTTGGTCATTGAAATCTA
GAAGGATAATTTCTTTTTAAAAAGTTGACTGTTATAAGAATTTTTATCCA
CGTTTAATTACCATTTGTGTGCACCTTATTTTACCTCTTGGAAACTTGTA
GTATTGTTAACTTATCAGATATTTTAGAAGTCAAATACATATTTGTTTGC
TGCAAAAATGCAGTTGAGCAGGAGCAACCCTATTAATCCTATTGTCAACT
TCGTTAAATATAGCAAAAAGTCACGGCATCATGAAGATTAGGAACCATTT
TTCCCTTAAAAACATTTTGTAAGAATATAGTTACTCAAGTGGTGAAATGT
CAGATGAATACACAGGTTTGATTAACTCACCACAGGCAAAACCGAATTGA
GTTTTCATGGTTCAATGAAACGCGATCACATTGTTTTGGGTTAGGTTAAT
GCGAGGCGTTATTCAATTCCTTTAAATGTTTAAAGTCCTAGACTAAAAAT
CCACTTTGTTAAACATCAATACAGTCGACGTTTTTGTCAATATCACCAGA
CGCTTTCTAGGCGAGGGCCATCTGTATCTCATCTCTAATTACTATTTCAT
TTATTTAGCGATTTACTGACCCAAACTTAAAATTGTAATCCACTTGCTGT
AATGAGATTTTTTGTGATTAAAAGTGTAAGTTTTCACTTAACATTCTTTA
CACCCAAGGCTGCAAATAGCAGGTTAAAATCTTGTGAATCACGTTTTATG
GGTTTATAGTATTTTCATCTTTTTGACTTTACATTAAACCATTTCAAACG
TTTTTCATTCTAATGGAAAGATATGAGTAATATGGCACAGTGCTTTCTGA
TTGGTTGAATAAATCCATGGCTTATGCGTTGTGTTGAGTTAAAATGCGAT
ACAATGAGTCAAATCAAATACAAACACATTAAAATATATTGGCAAAATTG
TGATTAAAAATAAATATTTTTGAAACAATTCAAAGTATTTCTCCAAATTA
TTAGAAAAGCAAAGAACACGCATTTATTCAATCCAATCACAAATATAGAA
AATATGAATAATTCTGATCACCATAAACCACTGAGACATGCAGATTTGGA
GGCAGTAGGAAATTATATAACCCC
back to top

protein sequence of SMED30011540-orf-1

>SMED30011540-orf-1 ID=SMED30011540-orf-1|Name=SMED30011540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=778bp
MNLLESIEGRHYFLNILTDYLSKNHIQDIQNIINASFKKSINECETLVLR
IDVMILLQQYPWISTYLLNNAIKLIKIFNSGFAKLLCSSLNDMGVTLGKE
IPNCQVRITSLPFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQ
REYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSK
LSPKFCRNRQEINVQEQIKYLSFGCMPRTIKVILDDDLVDLVKPGDDVII
NGTVIRRWNNLRVNDECVIQLVILANEIQIVNHTISNNYSIKSEMKLDFQ
LFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNGM
KVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAV
KESGGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAK
AGIVCKLKTRCSVIAATNPKGNYDITQSITANTAIASPLLSRFDLIFLLL
DNCNESWDSCVSDFILNHQTFESSKESFNLEKLKSYFAYIRSTFHPKMTP
EASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVK
EEDAVMAVAVMESTVYGSTVLSTDQQLPSAFPTDPEEEYRLLKLNIFKKL
QIKSFIPPNNPGIVQDKPFARPPLISKPKRLTALPSVTQKSNTSILNITF
NKSILDNFHDVTQIDCSQVNQSINIIDEIFNENNNDNAIHSTVSGRLTAL
PIVSSGRNIFSDSITDTKDLTDDDFEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0003682chromatin binding
GO:0019899enzyme binding
GO:0032406MutLbeta complex binding
GO:0032407MutSalpha complex binding
GO:0032408MutSbeta complex binding
GO:0044877macromolecular complex binding
GO:0003677DNA binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0005515protein binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006270DNA replication initiation
GO:0032508DNA duplex unwinding
GO:0036298recombinational interstrand cross-link repair
GO:0070716mismatch repair involved in maintenance of fidelity involved in DNA-dependent DNA replication
GO:0071168protein localization to chromatin
GO:0006260DNA replication
GO:0000724double-strand break repair via homologous recombination
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0007276gamete generation
GO:0007292female gamete generation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033762MCM_OB
IPR041562MCM_lid
IPR001208MCM_dom
IPR003593AAA+_ATPase
IPR031327MCM
IPR012340NA-bd_OB-fold
IPR027417P-loop_NTPase
IPR018525MCM_CS
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0097362MCM8-MCM9 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 439..452
score: 75.35
coord: 411..425
score: 80.43
coord: 463..475
score: 39.29
coord: 353..368
score: 58.33
coord: 489..497
score: 78.85
IPR001208MCM domainPFAMPF00493MCMcoord: 314..518
e-value: 6.5E-74
score: 247.8
IPR001208MCM domainPROSITEPS50051MCM_2coord: 313..515
score: 63.51
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 354..503
e-value: 0.0013
score: 28.0
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 118..615
e-value: 7.0E-88
score: 307.9
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 15..687
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 125..254
e-value: 7.6E-17
score: 61.3
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 531..613
e-value: 3.5E-20
score: 72.2
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 124..273
e-value: 1.8E-28
score: 101.0
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 150..199
e-value: 1.8E-28
score: 101.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 307..619
e-value: 1.6E-110
score: 371.4
NoneNo IPR availablePANTHERPTHR11630:SF48DNA HELICASE MCM9coord: 15..687
NoneNo IPR availableCDDcd17760MCM9coord: 316..614
e-value: 1.40118E-136
score: 403.85
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 419..427
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 40..276
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 354..613