Radial spoke head 1 homolog

Overview
NameRadial spoke head 1 homolog
Smed IDSMED30011512
Uniprot Best hitRadial spoke head 1 homolog OS=Mus musculus OX=10090 GN=Rsph1 PE=1 SV=2 (E=6.29755e-68)
Length (bp)1090
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Radial spoke head 1 homolog (SMED30011512) t-SNE clustered cells

Violin plots show distribution of expression levels for Radial spoke head 1 homolog (SMED30011512) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Radial spoke head 1 homolog (SMED30011512) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Radial spoke head 1 homolog (SMED30011512) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011512

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011512SMESG000014300.1 SmedASXL_019391SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011512SMESG000014300.1 dd_Smed_v6_3321_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011512SMESG000014300.1 dd_Smed_v6_3321_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011512SMESG000014300.1 dd_Smed_v4_3321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Match: RSPH1 (radial spoke head component 1 [Source:HGNC Symbol;Acc:HGNC:12371])

HSP 1 Score: 217.624 bits (553), Expect = 6.471e-68
Identity = 120/213 (56.34%), Postives = 137/213 (64.32%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMSMNPKFKTNEGEP 756
            RNE  ERHG G+A LPNGDTYEG YE GKRHG G Y+FKNGARYIGEY  NKKHG G F YPDGS+YEG W +D R+G+G YYYIN D + GEW  H RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD V C+  GEY        E   EEE   VV  KW++ QI  +       PK  T+   P
Sbjct:   24 RNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFD-VGCEQHGEYRLTDMERGEEEEEEELVTVVP-KWKATQITELALWTPTLPKKPTSTDGP 234          
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Match: RSPH1 (radial spoke head component 1 [Source:HGNC Symbol;Acc:HGNC:12371])

HSP 1 Score: 169.474 bits (428), Expect = 1.054e-49
Identity = 95/180 (52.78%), Postives = 111/180 (61.67%), Query Frame = 1
Query:  217 GTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMSMNPKFKTNEGEP 756
            G Y+FKNGARYIGEY  NKKHG G F YPDGS+YEG W +D R+G+G YYYIN D + GEW  H RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD V C+  GEY        E   EEE   VV  KW++ QI  +       PK  T+   P
Sbjct:   19 GIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFD-VGCEQHGEYRLTDMERGEEEEEEELVTVVP-KWKATQITELALWTPTLPKKPTSTDGP 196          
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 87.4261 bits (215), Expect = 3.940e-18
Identity = 51/145 (35.17%), Postives = 81/145 (55.86%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATGSK-YVGVWKEGKMNGYGELVH-SNHKYVGQWKNGVMNGKGK 567
            G G A    G TY G++  G  HG GTY + +G +Y G++ +N    HG++ +PDGS YEG  ++  RNG G +        + G W N  RHG+G+ +Y+  G+  Y G W +    G+G   + S + Y GQW++ + +G+G+
Sbjct:   97 GEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGR 241          

HSP 2 Score: 68.9366 bits (167), Expect = 4.489e-12
Identity = 48/165 (29.09%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKGKYVFDHVKCQLTG 603
            +NE   ++     T    ++YEG    G   G G   F+ G  Y G +SE   HG G + + DG KYEG ++ +    +G Y + +G  +EGE  N +R+G G +        Y+G W  GK +G G + ++      Y G W   +  G G      ++C  +G
Sbjct:   66 QNEDASQYEESILTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWG------IRCYKSG 224          

HSP 3 Score: 60.077 bits (144), Expect = 3.468e-9
Identity = 35/105 (33.33%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  124 EKDERHGSGKAT-LPNGDTYEGLYENGKRHGHGTYR-FKNGAR---------YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 405
            E + RHG G+   L   + Y G +E G ++G GT+  F    R         YIGE+    +HG G F+Y  G+ Y+G W+ ++++G G+  + NG  +EG + N
Sbjct:  232 EDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN 336          

HSP 4 Score: 56.9954 bits (136), Expect = 3.458e-8
Identity = 39/134 (29.10%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGI---FF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL 504
            + G G     +G+ YEG +E+  RHG G  R       Y G +    ++G G    F        YP  ++Y G +++  R+G GK+YY +G  ++GEW ++ +HG G   +   G  Y G +    + G+ +L
Sbjct:  213 KKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFK-NGRVYEGAFSNDHIAGFPDL 345          
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 87.4261 bits (215), Expect = 3.940e-18
Identity = 51/145 (35.17%), Postives = 81/145 (55.86%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATGSK-YVGVWKEGKMNGYGELVH-SNHKYVGQWKNGVMNGKGK 567
            G G A    G TY G++  G  HG GTY + +G +Y G++ +N    HG++ +PDGS YEG  ++  RNG G +        + G W N  RHG+G+ +Y+  G+  Y G W +    G+G   + S + Y GQW++ + +G+G+
Sbjct:   97 GEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGR 241          

HSP 2 Score: 68.9366 bits (167), Expect = 4.489e-12
Identity = 48/165 (29.09%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKGKYVFDHVKCQLTG 603
            +NE   ++     T    ++YEG    G   G G   F+ G  Y G +SE   HG G + + DG KYEG ++ +    +G Y + +G  +EGE  N +R+G G +        Y+G W  GK +G G + ++      Y G W   +  G G      ++C  +G
Sbjct:   66 QNEDASQYEESILTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWG------IRCYKSG 224          

HSP 3 Score: 60.077 bits (144), Expect = 3.468e-9
Identity = 35/105 (33.33%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  124 EKDERHGSGKAT-LPNGDTYEGLYENGKRHGHGTYR-FKNGAR---------YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 405
            E + RHG G+   L   + Y G +E G ++G GT+  F    R         YIGE+    +HG G F+Y  G+ Y+G W+ ++++G G+  + NG  +EG + N
Sbjct:  232 EDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN 336          

HSP 4 Score: 56.9954 bits (136), Expect = 3.458e-8
Identity = 39/134 (29.10%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGI---FF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL 504
            + G G     +G+ YEG +E+  RHG G  R       Y G +    ++G G    F        YP  ++Y G +++  R+G GK+YY +G  ++GEW ++ +HG G   +   G  Y G +    + G+ +L
Sbjct:  213 KKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFK-NGRVYEGAFSNDHIAGFPDL 345          
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 87.4261 bits (215), Expect = 3.940e-18
Identity = 51/145 (35.17%), Postives = 81/145 (55.86%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATGSK-YVGVWKEGKMNGYGELVH-SNHKYVGQWKNGVMNGKGK 567
            G G A    G TY G++  G  HG GTY + +G +Y G++ +N    HG++ +PDGS YEG  ++  RNG G +        + G W N  RHG+G+ +Y+  G+  Y G W +    G+G   + S + Y GQW++ + +G+G+
Sbjct:   97 GEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGR 241          

HSP 2 Score: 68.9366 bits (167), Expect = 4.489e-12
Identity = 48/165 (29.09%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKGKYVFDHVKCQLTG 603
            +NE   ++     T    ++YEG    G   G G   F+ G  Y G +SE   HG G + + DG KYEG ++ +    +G Y + +G  +EGE  N +R+G G +        Y+G W  GK +G G + ++      Y G W   +  G G      ++C  +G
Sbjct:   66 QNEDASQYEESILTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWG------IRCYKSG 224          

HSP 3 Score: 60.077 bits (144), Expect = 3.468e-9
Identity = 35/105 (33.33%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  124 EKDERHGSGKAT-LPNGDTYEGLYENGKRHGHGTYR-FKNGAR---------YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 405
            E + RHG G+   L   + Y G +E G ++G GT+  F    R         YIGE+    +HG G F+Y  G+ Y+G W+ ++++G G+  + NG  +EG + N
Sbjct:  232 EDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN 336          

HSP 4 Score: 56.9954 bits (136), Expect = 3.458e-8
Identity = 39/134 (29.10%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGI---FF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL 504
            + G G     +G+ YEG +E+  RHG G  R       Y G +    ++G G    F        YP  ++Y G +++  R+G GK+YY +G  ++GEW ++ +HG G   +   G  Y G +    + G+ +L
Sbjct:  213 KKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFK-NGRVYEGAFSNDHIAGFPDL 345          
BLAST of Radial spoke head 1 homolog vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 57.7658 bits (138), Expect = 6.293e-9
Identity = 46/148 (31.08%), Postives = 72/148 (48.65%), Query Frame = 1
Query:  148 GKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHG---HGIFFYPDGSKYEGSWIDDQRNG-----NGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYG-ELVHSNHKYVGQWKNGVMNGKG 564
            G+    +G TY G +E GK HGHG      G +  GEY+    +G    G++ +P G+ Y+G W + +R+G      G++ Y      +GEW    +   G      + ++Y G W  G  +GYG E+   +  Y GQW  G+ +G G
Sbjct:    4 GRFDFDDGGTYVGGWEEGKAHGHGVC---TGPQAKGEYAGAWHYGFEVSGVYTWPSGNTYQGQWQNGKRHGLGIEQRGRWLY------KGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYG 142          

HSP 2 Score: 53.9138 bits (128), Expect = 1.255e-7
Identity = 32/95 (33.68%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  145 SGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDG-SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQG 426
            SG  T P+G+TY+G ++NGKRHG G  + +    Y GE+++  K  +G+    +  ++Y+G+W     +G G   Y++   ++G+W   +RHG G
Sbjct:   49 SGVYTWPSGNTYQGQWQNGKRHGLGIEQ-RGRWLYKGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYG 142          
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Match: CG5458 (gene:FBgn0032478 transcript:FBtr0080437)

HSP 1 Score: 120.553 bits (301), Expect = 7.246e-31
Identity = 68/176 (38.64%), Postives = 92/176 (52.27%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYD------ATGSKYVGVWKEGKMNGYGELVHSNHKYV----GQWKNGVMNGKGKYVFDHVKCQLTGEYAP 615
            RN   +R G G A LPNGD Y+G Y  G+RHG G Y FK+G+RY G+Y   K+ G GIF YPDGS YEG+W  + ++G G+Y Y+NGD + G+W    RHG G Y ++          +    W      G  EL   N        G W N   +G   + F++ +  L G + P
Sbjct:   31 RNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILHGIWDNLYPSGPAVFSFNN-RYLLLGYFLP 205          

HSP 2 Score: 50.447 bits (119), Expect = 1.064e-6
Identity = 36/119 (30.25%), Postives = 61/119 (51.26%), Query Frame = 1
Query:  253 GEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVFDHVK--CQLT 600
            G  +  ++ G G    P+G +Y+G++   +R+G G Y + +G  + G+++   R G+G + Y   GS Y G W++   +G G   + N   Y G W  G  +G G Y F+  K  C L+
Sbjct:   30 GRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIY-PDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDGCCLS 147          
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Match: CG14490 (gene:FBgn0034281 transcript:FBtr0086801)

HSP 1 Score: 86.6557 bits (213), Expect = 9.050e-20
Identity = 53/131 (40.46%), Postives = 76/131 (58.02%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFK--NGAR---YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN 516
            HG G     +G  YEG ++ G+RHG G+ R K  +G     Y+G++ ENK+ G G  FYPDGS Y G W+ DQR+G G  +  +G  + GEW     H +G  F  ATG++YVG ++ G  +G G   H++
Sbjct:   32 HGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLF-TATGNRYVGQFEGGCKSGSGVFYHAS 161          

HSP 2 Score: 62.3882 bits (150), Expect = 3.560e-11
Identity = 48/145 (33.10%), Postives = 74/145 (51.03%), Query Frame = 1
Query:  169 GDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYP--DGSK---YEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVFDHV 585
            G  Y+G +   + HG G  +  +G  Y G + + ++HG G       DG     Y G W +++R+G GK +Y +G  + G+W    R G+G   + A G  YVG W   KM+  G L  +  ++YVGQ++ G  +G G  VF H 
Sbjct:   19 GGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGI-LWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSG--VFYHA 160          

HSP 3 Score: 47.3654 bits (111), Expect = 5.354e-6
Identity = 25/84 (29.76%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  124 EKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYIN 375
             +++R G GK   P+G  Y G +   +R G G     +G  Y+GE+  +K H  G+ F   G++Y G +    ++G+G +Y+ +
Sbjct:   78 RENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHAS 161          
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Match: CG30429 (gene:FBgn0050429 transcript:FBtr0072450)

HSP 1 Score: 64.6994 bits (156), Expect = 1.960e-11
Identity = 37/119 (31.09%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  130 DERHGSGKATLPNGD----TYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWK 474
            ++R G G      G      Y G + +  + G G   + +G  Y G++ +N++HG GI +Y DG+ Y G W  D R+G G  +Y NG+ +EG +    ++G+G +++  TG    G+W+
Sbjct:   76 NKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWE 194          
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Match: Als2 (gene:FBgn0037116 transcript:FBtr0078462)

HSP 1 Score: 60.4622 bits (145), Expect = 1.528e-9
Identity = 41/159 (25.79%), Postives = 73/159 (45.91%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFY-----PDGSKYEGSWIDDQRNGNG-----KYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYV-GQWKNGVMNGKGKYVFDH 582
            HG+     P+G  Y G  ++G   G G         Y+G +   + HGHG++       P+   YEG++ +   +G+G     +Y Y+      GE++ + R G G      +G KY+G++ + K +G G  + +   Y  G +    + G G  VF++
Sbjct:  753 HGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNNRYIYV------GEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFEN 905          
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Match: rtp (gene:FBgn0087005 transcript:FBtr0078825)

HSP 1 Score: 57.3806 bits (137), Expect = 2.017e-9
Identity = 35/101 (34.65%), Postives = 60/101 (59.41%), Query Frame = 1
Query:  217 GTYRFKNGARYIGEYSEN-KKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN 516
            G +R+++ +RYIGE+++  +KHG G   + DG++Y+G + +    G G  ++ +G  +EGE+     HG G  F+ A G KY G ++ GK+ G G L   +
Sbjct:   54 GGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGI-FWRADGMKYEGEFRGGKIWGLGLLTFQD 153          

HSP 2 Score: 56.225 bits (134), Expect = 5.207e-9
Identity = 27/68 (39.71%), Postives = 41/68 (60.29%), Query Frame = 1
Query:  121 NEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEG 324
            N++ ++HG G     +G  Y+G ++ G   G G   F +GA+Y GE+ +   HG+GIF+  DG KYEG
Sbjct:   69 NQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEG 136          

HSP 3 Score: 51.2174 bits (121), Expect = 2.742e-7
Identity = 25/70 (35.71%), Postives = 43/70 (61.43%), Query Frame = 1
Query:  193 ENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWK 402
            + G++HG G  +F +G RY G++ E    G G  ++ DG+KYEG +     +GNG ++  +G  +EGE++
Sbjct:   70 QRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFR 139          
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Match: CT573248.3 (radial spoke head component 1 [Source:NCBI gene;Acc:100003444])

HSP 1 Score: 211.075 bits (536), Expect = 1.562e-66
Identity = 119/220 (54.09%), Postives = 143/220 (65.00%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI-PTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            MSD GSE+ +EE+G         RNE  ERHG GKA LPNGDTY+G YENGKR   GTY+FKNGARY GE+  N KHG G F+YPDGSKYEG+W+DDQR G G Y Y NGD ++GEW +H RHGQG Y Y  TGS+YVG W  GKM   GEL++ NH+Y G + N   +G GKYVFD + C+  GEY  I    GD    E     ++  KW+   I  +
Sbjct:    1 MSDVGSEEFDEERGSLGEYEGD-RNEAGERHGQGKAVLPNGDTYQGAYENGKRSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTWIMGKMESAGELIYLNHRYQGNFINNNPSGPGKYVFD-IGCEQHGEYLQIEQVKGDAEEEEPAMTTIL--KWKPKAITAL 216          
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:100003444])

HSP 1 Score: 211.075 bits (536), Expect = 1.562e-66
Identity = 119/220 (54.09%), Postives = 143/220 (65.00%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI-PTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            MSD GSE+ +EE+G         RNE  ERHG GKA LPNGDTY+G YENGKR   GTY+FKNGARY GE+  N KHG G F+YPDGSKYEG+W+DDQR G G Y Y NGD ++GEW +H RHGQG Y Y  TGS+YVG W  GKM   GEL++ NH+Y G + N   +G GKYVFD + C+  GEY  I    GD    E     ++  KW+   I  +
Sbjct:    1 MSDVGSEEFDEERGSLGEYEGD-RNEAGERHGQGKAVLPNGDTYQGAYENGKRSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTWIMGKMESAGELIYLNHRYQGNFINNNPSGPGKYVFD-IGCEQHGEYLQIEQVKGDAEEEEPAMTTIL--KWKPKAITAL 216          
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 84.7297 bits (208), Expect = 2.033e-18
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  130 DERHGSGKATLPN-GDTYEGLYENGKRHGHGTY-----RFKNGAR-YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGV 549
            +++HG GK      G  Y+G +  GKR G GT        K   R Y+G +  +KK G G +FY   + YEG W  D+R+G G+  Y NG+ +EGEW     HG+G     A G+++VG W +GK NG+G+L  +     Y G W + V
Sbjct:   45 NKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGSWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILL-ANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDV 192          

HSP 2 Score: 50.0618 bits (118), Expect = 1.263e-6
Identity = 27/78 (34.62%), Postives = 40/78 (51.28%), Query Frame = 1
Query:  364 YYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-------HKYVGQWKNGVMNGKGKYVF 576
            Y +NGD + GEW ++ +HG+G   +   G  Y G W+ GK +G+G L   +         YVG W+N    G G Y +
Sbjct:   31 YSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGSWRNDKKEGAGSYFY 108          
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 84.3445 bits (207), Expect = 2.403e-18
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  130 DERHGSGKATLPN-GDTYEGLYENGKRHGHGTY-----RFKNGAR-YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGV 549
            +++HG GK      G  Y+G +  GKR G GT        K   R Y+G +  +KK G G +FY   + YEG W  D+R+G G+  Y NG+ +EGEW     HG+G     A G+++VG W +GK NG+G+L  +     Y G W + V
Sbjct:   45 NKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGTWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILL-ANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDV 192          

HSP 2 Score: 50.0618 bits (118), Expect = 1.436e-6
Identity = 27/78 (34.62%), Postives = 40/78 (51.28%), Query Frame = 1
Query:  364 YYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-------HKYVGQWKNGVMNGKGKYVF 576
            Y +NGD + GEW ++ +HG+G   +   G  Y G W+ GK +G+G L   +         YVG W+N    G G Y +
Sbjct:   31 YSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGTWRNDKKEGAGSYFY 108          
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Match: BX571704.1 (alsin Rho guanine nucleotide exchange factor ALS2 a [Source:NCBI gene;Acc:557014])

HSP 1 Score: 83.9593 bits (206), Expect = 4.458e-17
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  178 YEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGS-----KYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTY-----FYDATGSKYVGVWKEGKMNGYG--ELVHSNHKYVGQWKNGVMNGKG 564
            YEG + +GK HG G  ++ +G  Y G +    + G G F  P  +     +Y+G W + + +G G ++Y +G+ +EG ++ ++RHG G          ++ S +VG W +GK  GYG  +      KY+G W +   +G G
Sbjct: 1019 YEGRWLSGKPHGKGNLKWPDGTMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDG 1159          

HSP 2 Score: 77.7962 bits (190), Expect = 5.340e-15
Identity = 49/159 (30.82%), Postives = 73/159 (45.91%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTY-----RFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYY------INGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHS-NHKYVGQWKNGVMNGKGKYVFD 579
            HG G    P+G  Y G +++G   G G +      F    RY G + E K HG G F+Y  G  YEGS+ ++ R+G+G           +   F G+W    R G G     + G KY+G+W + + +G G ++      Y G + N  M G G  + D
Sbjct: 1029 HGKGNLKWPDGTMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHGMLRSGKVASPSSSSVFVGQWVQGKRTGYGVCDDFSRGEKYMGIWHDDQRHGDGVVITQFGLYYEGNFCNNRMMGNGTLLCD 1187          

HSP 3 Score: 54.299 bits (129), Expect = 1.754e-7
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  310 SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATG----SKYVGVWKEGKMNGYGELVH-SNHKYVGQWKNGVMNGKG 564
            +KYEG W+  + +G G   + +G  + G +K+ L  G G +   +T      +Y G WKEGKM+G+G   + S   Y G ++  + +G G
Sbjct: 1017 AKYEGRWLSGKPHGKGNLKWPDGTMYCGTFKSGLEDGFGDFMTPSTTFNKFERYQGHWKEGKMHGFGTFWYASGEVYEGSFRENMRHGHG 1106          
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Match: ENSXETT00000020980.1 (radial spoke head component 1 [Source:NCBI gene;Acc:100489385])

HSP 1 Score: 108.612 bits (270), Expect = 1.385e-27
Identity = 53/96 (55.21%), Postives = 64/96 (66.67%), Query Frame = 1
Query:  322 GSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEY 609
            G W+DDQR G G YYY NGD + G+W +H RHGQG Y Y  TGSKYVG W  GK  G GELVH NH+Y G++    + G GKY+FD + C+  G Y
Sbjct:    7 GDWVDDQRQGQGVYYYPNGDTYSGDWLSHQRHGQGVYTYTETGSKYVGTWVNGKQEGSGELVHLNHRYQGKFVGNSLLGPGKYIFD-IGCEQHGAY 101          

HSP 2 Score: 53.1434 bits (126), Expect = 9.799e-8
Identity = 27/81 (33.33%), Postives = 51/81 (62.96%), Query Frame = 1
Query:  202 KRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPD-GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYD 441
            +R G G Y + NG  Y G++  +++HG G++ Y + GSKY G+W++ ++ G+G+  ++N  Y +G++  +   G G Y +D
Sbjct:   13 QRQGQGVYYYPNGDTYSGDWLSHQRHGQGVYTYTETGSKYVGTWVNGKQEGSGELVHLNHRY-QGKFVGNSLLGPGKYIFD 92          

HSP 3 Score: 51.2174 bits (121), Expect = 3.934e-7
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYY 369
            D+R G G    PNGDTY G + + +RHG G Y + + G++Y+G +   K+ G G   + +  +Y+G ++ +   G GKY +
Sbjct:   12 DQRQGQGVYYYPNGDTYSGDWLSHQRHGQGVYTYTETGSKYVGTWVNGKQEGSGELVHLN-HRYQGKFVGNSLLGPGKYIF 91          
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 85.8853 bits (211), Expect = 9.791e-18
Identity = 47/128 (36.72%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  166 NGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVH-SNHKYVGQWKNG 546
            +G+ Y G ++ G+ HGHG  ++K+G RY GE+    K GHG+    +G  Y G++ ++++ G G+  ++NGD++EG+W    R G G       GS Y G W+    NG G ++H S   Y G W NG
Sbjct:   81 SGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGV-LQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWING 207          

HSP 2 Score: 79.7221 bits (195), Expect = 1.069e-15
Identity = 52/154 (33.77%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  133 ERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQ 594
            E HG G     +G  YEG +  G + GHG    K G  Y G +  NKK+G G   + +G  YEG WI DQR G+G     +G  +EG+W+N + +GQG   +  +G  Y G+W    +NG+  +       +G+     + G    V  HV+ Q
Sbjct:   93 EIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIH-CSGVIYDGLW----INGHPAVAAKKMVIIGEDIINFIQGSRSTV--HVQIQ 239          

HSP 3 Score: 56.225 bits (134), Expect = 4.640e-8
Identity = 32/116 (27.59%), Postives = 68/116 (58.62%), Query Frame = 1
Query:  232 KNGARYIGEYSENKKHGHGIFFYPDGS-KYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYV 573
            +N   Y G   +  + G+G++ Y +   +YEG W   +++G+GK  + +G Y+EGE+ +    G G  ++ ++G+KY G ++ G+++G+G + + +  +Y G++  G+  G G  +
Sbjct:    9 RNSRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLM 124          
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Match: ENSXETT00000041392.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 85.8853 bits (211), Expect = 1.062e-17
Identity = 54/145 (37.24%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATGSK-YVGVWKEGKMNGYG-ELVHSNHKYVGQWKNGVMNGKGK 567
            G G A   +G+ Y G++  G  HG G Y +K+G  Y G++  N   GHGI+ + DGS+YEG      R+G+G +   N    + G+W    RHG+G  +Y+  G+  Y G W   K  G+G +   S + Y GQWKN + +G GK
Sbjct:    3 GEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGK 147          

HSP 2 Score: 82.8037 bits (203), Expect = 8.764e-17
Identity = 57/185 (30.81%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPD--------------------------GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHS-------------NHKYVGQWKNGVMNGKGKYVF 576
            HG GK T  +G TYEG +      GHG Y++ +G++Y GE  +  +HGHGIF   +                           S YEG WI +++ G G   +I+G+ +EG+WKN++ HG G   +  +  +Y G W+ G  NG G   H+              ++YVG + NG+  G+G++ +
Sbjct:   25 HGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSG--THTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYY 207          

HSP 3 Score: 53.5286 bits (127), Expect = 3.611e-7
Identity = 37/125 (29.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHG---HGIFF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQ------GTYFYDATGS 453
            +++ G G     +G+ YEG ++N   HG G  R   +   Y G++    ++G   H  F        Y   ++Y G++++  R G G++YY NG  ++GEWKN+ +HG       GT+ + + GS
Sbjct:  117 NKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLVSLALFGTFVFFSAGS 241          
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Match: ENSXETT00000041404.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 85.5001 bits (210), Expect = 1.339e-17
Identity = 55/145 (37.93%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATG-SKYVGVWKEGKMNGYG-ELVHSNHKYVGQWKNGVMNGKGK 567
            G G A   +G+ Y G++  G  HG G Y +K+G  Y G++  N   GHGI+ + DGS+YEG      R+G+G +   N    + G+W    RHG+G  +Y+  G S Y G W   K  G+G +   S + Y GQWKN + +G GK
Sbjct:    3 GEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGK 147          

HSP 2 Score: 82.4185 bits (202), Expect = 1.369e-16
Identity = 57/185 (30.81%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPD--------------------------GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHS-------------NHKYVGQWKNGVMNGKGKYVF 576
            HG GK T  +G TYEG +      GHG Y++ +G++Y GE  +  +HGHGIF   +                           S YEG WI +++ G G   +I+G+ +EG+WKN++ HG G   +  +  +Y G W+ G  NG G   H+              ++YVG + NG+  G+G++ +
Sbjct:   25 HGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSG--THTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYY 207          

HSP 3 Score: 56.9954 bits (136), Expect = 2.310e-8
Identity = 40/133 (30.08%), Postives = 69/133 (51.88%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHG---HGIFF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGY 495
            +++ G G     +G+ YEG ++N   HG G  R   +   Y G++    ++G   H  F        Y   ++Y G++++  R G G++YY NG  ++GEWKN+ +HG G + +   G  YVG + E ++  Y
Sbjct:  117 NKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLGKFVFK-NGQIYVGEFVEDQIAEY 248          
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Match: ENSXETT00000041411.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 85.1149 bits (209), Expect = 1.677e-17
Identity = 55/145 (37.93%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY-FEGEWKNHLRHGQGTYFYDATG-SKYVGVWKEGKMNGYG-ELVHSNHKYVGQWKNGVMNGKGK 567
            G G A   +G+ Y G++  G  HG G Y +K+G  Y G++  N   GHGI+ + DGS+YEG      R+G+G +   N    + G+W    RHG+G  +Y+  G S Y G W   K  G+G +   S + Y GQWKN + +G GK
Sbjct:    3 GEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGK 147          

HSP 2 Score: 82.0333 bits (201), Expect = 1.580e-16
Identity = 57/185 (30.81%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPD--------------------------GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHS-------------NHKYVGQWKNGVMNGKGKYVF 576
            HG GK T  +G TYEG +      GHG Y++ +G++Y GE  +  +HGHGIF   +                           S YEG WI +++ G G   +I+G+ +EG+WKN++ HG G   +  +  +Y G W+ G  NG G   H+              ++YVG + NG+  G+G++ +
Sbjct:   25 HGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSG--THTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYY 207          

HSP 3 Score: 52.7582 bits (125), Expect = 5.843e-7
Identity = 37/125 (29.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHG---HGIFF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQ------GTYFYDATGS 453
            +++ G G     +G+ YEG ++N   HG G  R   +   Y G++    ++G   H  F        Y   ++Y G++++  R G G++YY NG  ++GEWKN+ +HG       GT+ + + GS
Sbjct:  117 NKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLVSLALFGTFVFFSAGS 241          
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Match: Rsph1 (radial spoke head 1 homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1194909])

HSP 1 Score: 219.164 bits (557), Expect = 9.003e-69
Identity = 115/196 (58.67%), Postives = 133/196 (67.86%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            RNE  ERHG GKA LPNGDTYEG YE GKRHG GTY+FKNGARY G+Y +NKKHG G F YPDGS+YEG W DDQR+G G YYY+N D + GEW NH RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD + C+  GEY    T   E   EEE    +  KW++  I  +
Sbjct:   24 RNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFD-IGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITEL 218          
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Match: Rsph1 (radial spoke head 1 homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1194909])

HSP 1 Score: 218.394 bits (555), Expect = 1.121e-68
Identity = 115/196 (58.67%), Postives = 133/196 (67.86%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            RNE  ERHG GKA LPNGDTYEG YE GKRHG GTY+FKNGARY G+Y +NKKHG G F YPDGS+YEG W DDQR+G G YYY+N D + GEW NH RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD + C+  GEY    T   E   EEE    +  KW++  I  +
Sbjct:    7 RNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFD-IGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITEL 201          
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Match: Rsph1 (radial spoke head 1 homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1194909])

HSP 1 Score: 170.629 bits (431), Expect = 1.624e-50
Identity = 89/163 (54.60%), Postives = 107/163 (65.64%), Query Frame = 1
Query:  217 GTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            GTY+FKNGARY G+Y +NKKHG G F YPDGS+YEG W DDQR+G G YYY+N D + GEW NH RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD + C+  GEY    T   E   EEE    +  KW++  I  +
Sbjct:   19 GTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFD-IGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITEL 180          
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 89.3521 bits (220), Expect = 4.589e-19
Identity = 51/128 (39.84%), Postives = 70/128 (54.69%), Query Frame = 1
Query:  166 NGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVH-SNHKYVGQWKNG 546
            +G+TY G +  G+  GHG  ++K G RY GE S+  + G G     DG  Y+GS+ D++R+G G+  + NGD +EG+W    R G G     A GS Y G W     +G G LVH S   Y G + NG
Sbjct:   82 SGNTYSGQFVLGEPQGHGVMKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGV-LCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFING 208          

HSP 2 Score: 71.2478 bits (173), Expect = 3.821e-13
Identity = 39/116 (33.62%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  133 ERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEG 480
            E  G G      G  YEG    G R G G    ++G  Y G + +NK+HG G   + +G KYEG W+ DQR G+G     +G  ++G+W + +  G G+  +  +G  Y G++  G
Sbjct:   94 EPQGHGVMKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCADGSTYKGQWHSDVFSGLGSLVH-CSGVTYCGMFING 208          
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 89.3521 bits (220), Expect = 7.515e-19
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 1
Query:  148 GKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFYPD--GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYG-------ELVHSNH----KYVGQWKNGVMNGKGKYVF 576
            G  T P+G TYEG   NG R+G G ++       YIG +   K+HG G  +Y     S YEG W+ + + G G   Y +G+ +EG+W+N++RHG+G   +  T  +Y G W++G  NG+G        + +S +    +Y+G++ NG  +G+GK+ +
Sbjct:  145 GVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYY 301          

HSP 2 Score: 59.3066 bits (142), Expect = 4.475e-9
Identity = 36/105 (34.29%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  124 EKDERHGSGKAT-LPNGDTYEGLYENGKRHGHGTY-----RFKNGA-----RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 405
            E + RHG G+   L   + Y G +E G ++G GT+     R  N        YIGE+    +HG G F+Y  G+ YEG W  +++ G G+  + NG  +EG + N
Sbjct:  232 ENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFKNGHVYEGLFSN 336          

HSP 3 Score: 55.4546 bits (132), Expect = 7.356e-8
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGI---FF-------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNG 546
            + G G     +G+ YEG +EN  RHG G  R       Y G + +  ++G G    F        YP  ++Y G +++  R+G GK+YY +G  +EGEW ++ + G+G   +   G  Y G++    +  + E      + + +W + 
Sbjct:  213 KKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFK-NGHVYEGLFSNDHIAQFFETEMDYSQSLDRWSDA 359          
BLAST of Radial spoke head 1 homolog vs. UniProt
Match: sp|Q8VIG3|RSPH1_MOUSE (Radial spoke head 1 homolog OS=Mus musculus OX=10090 GN=Rsph1 PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 6.298e-68
Identity = 115/196 (58.67%), Postives = 133/196 (67.86%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPI 705
            RNE  ERHG GKA LPNGDTYEG YE GKRHG GTY+FKNGARY G+Y +NKKHG G F YPDGS+YEG W DDQR+G G YYY+N D + GEW NH RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD + C+  GEY    T   E   EEE    +  KW++  I  +
Sbjct:   24 RNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFD-IGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITEL 218          
BLAST of Radial spoke head 1 homolog vs. UniProt
Match: sp|Q8WYR4|RSPH1_HUMAN (Radial spoke head 1 homolog OS=Homo sapiens OX=9606 GN=RSPH1 PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 3.108e-67
Identity = 120/213 (56.34%), Postives = 137/213 (64.32%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMSMNPKFKTNEGEP 756
            RNE  ERHG G+A LPNGDTYEG YE GKRHG G Y+FKNGARYIGEY  NKKHG G F YPDGS+YEG W +D R+G+G YYYIN D + GEW  H RHGQGTY Y  TGSKYVG W  G+  G  EL+H NH+Y G++ N    G GKYVFD V C+  GEY        E   EEE   VV  KW++ QI  +       PK  T+   P
Sbjct:   24 RNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFD-VGCEQHGEYRLTDMERGEEEEEEELVTVVP-KWKATQITELALWTPTLPKKPTSTDGP 234          
BLAST of Radial spoke head 1 homolog vs. UniProt
Match: sp|Q6VTH5|RSPH1_CYPCA (Radial spoke head 1 homolog OS=Cyprinus carpio OX=7962 GN=rsph1 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.101e-63
Identity = 111/190 (58.42%), Postives = 133/190 (70.00%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI 618
            MSDAG+E+ +EEQG         RNE  ERHG GKA LP GDTY+G YENGKR G GTY+FKNGARY GE+  N KHG G+ +YPDGSKYEGSW+DDQR G+G Y Y NGD ++GEW +H RHGQGTY +  TGS+Y G W  G M   GEL+  NH+Y G + N   +G GKYVFD + C+  GEY  +
Sbjct:    1 MSDAGTEEFDEEQGSLGEYEGD-RNEAGERHGQGKAVLPRGDTYQGAYENGKRCGQGTYKFKNGARYTGEWYMNLKHGQGVLYYPDGSKYEGSWVDDQRQGHGVYTYPNGDTYDGEWLHHQRHGQGTYTHQETGSQYRGTWVVGNMESTGELIQLNHRYHGNFVNNNPSGPGKYVFD-IGCEQHGEYFQL 188          
BLAST of Radial spoke head 1 homolog vs. UniProt
Match: sp|Q8L796|PI5K2_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 3.408e-25
Identity = 59/147 (40.14%), Postives = 88/147 (59.86%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
            +GSGK    +G  YEG ++ GK  G G + + +GA Y GE+   +  G G F   DG  Y GSW+ D++ G+G+  Y NGDY+EG W+ +L+ G+G Y +   G++Y G W+ G + G G L   N ++Y GQW+NGV  G G + +
Sbjct:   92 NGSGKYLWKDGCMYEGEWKRGKASGKGKFSWPSGATYEGEFKSGRMEGSGTFVGVDGDTYRGSWVADRKQGHGQKRYANGDYYEGTWRRNLQDGRGRYVW-MNGNQYTGEWRNGVICGKGVLAWPNGNRYEGQWENGVPKGSGVFTW 237          

HSP 2 Score: 85.5001 bits (210), Expect = 9.820e-17
Identity = 46/133 (34.59%), Postives = 78/133 (58.65%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQW 537
            G GK + P+G TYEG +++G+  G GT+   +G  Y G +  ++K GHG   Y +G  YEG+W  + ++G G+Y ++NG+ + GEW+N +  G+G   +   G++Y G W+ G   G G    ++   ++G W
Sbjct:  116 GKGKFSWPSGATYEGEFKSGRMEGSGTFVGVDGDTYRGSWVADRKQGHGQKRYANGDYYEGTWRRNLQDGRGRYVWMNGNQYTGEWRNGVICGKGVLAW-PNGNRYEGQWENGVPKGSGVFTWADGSSWIGSW 247          
BLAST of Radial spoke head 1 homolog vs. UniProt
Match: sp|Q56YP2|PI5K1_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 7.455e-25
Identity = 57/147 (38.78%), Postives = 90/147 (61.22%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
            HGSGK    +G  YEG ++ GK  G G + + +GA Y GE+   +  G G F   DG  Y G+W+ D+++G+G+  Y NGD++EG W+ +L+ G+G Y +   G++Y G W+ G ++G G LV  N ++Y G W+NG+  G G + +
Sbjct:   91 HGSGKYLWKDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRMEGFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVW-RNGNQYTGEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTW 236          

HSP 2 Score: 86.6557 bits (213), Expect = 3.683e-17
Identity = 48/133 (36.09%), Postives = 78/133 (58.65%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQW 537
            G GK + P+G TYEG +++G+  G GT+   +G  Y G +  ++KHGHG   Y +G  YEG+W  + ++G G+Y + NG+ + GEW++ +  G+G   +   G++Y G+W+ G   G G    S+    VG W
Sbjct:  115 GKGKFSWPSGATYEGEFKSGRMEGFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGNQYTGEWRSGVISGKGLLVW-PNGNRYEGLWENGIPKGNGVFTWSDGSSCVGAW 246          

HSP 3 Score: 72.0182 bits (175), Expect = 2.419e-12
Identity = 46/128 (35.94%), Postives = 71/128 (55.47%), Query Frame = 1
Query:  229 FKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK-YVGQWKNGVMNGKGKYVFDHVKCQLTGEY 609
              NG  YIG +S    HG G + + DG  YEG W   + +G GK+ + +G  +EGE+K+    G GT F  A G  Y G W   + +G+G+  ++N   Y G W+  + +G+G+YV+ +   Q TGE+
Sbjct:   75 LPNGDLYIGSFSGGFPHGSGKYLWKDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRMEGFGT-FTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGN-QYTGEW 200          
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Match: gnl|BL_ORD_ID|18251384 (tr|A0A267H5Z6|A0A267H5Z6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030471g1 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 3.484e-87
Identity = 135/199 (67.84%), Postives = 158/199 (79.40%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDD 714
            RNE+DERHG GKATLPNGDTY G YENGKRHG G YRFKNGARY G+Y +NKKHG G+F YPDGS+YEGSWI+DQR+G GKY Y+NGDY+EGEW  H RHG+GTYF+  TGSKYVG+WKEGKM+GYGELVH+NHKYVG W+ G M+GKGKYVFD V CQ  GEY  +    D+   EEEE  ++  KW++  I  I +D
Sbjct:   22 RNERDERHGHGKATLPNGDTYVGEYENGKRHGSGLYRFKNGARYEGQYQKNKKHGKGVFIYPDGSRYEGSWIEDQRSGTGKYMYVNGDYYEGEWHQHQRHGRGTYFFRETGSKYVGMWKEGKMDGYGELVHANHKYVGLWRKGYMDGKGKYVFD-VGCQQHGEYQAVEQAADDKGEEEEEAAIIVPKWKAGAITKITED 219          
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Match: gnl|BL_ORD_ID|15792512 (tr|A0A267ER11|A0A267ER11_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015025g1 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 7.461e-87
Identity = 135/199 (67.84%), Postives = 158/199 (79.40%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDD 714
            RNE+DERHG GKATLPNGDTY G YENGKRHG G YRFKNGARY G+Y +NKKHG G+F YPDGS+YEGSWI+DQR+G GKY Y+NGDY+EGEW  H RHG+GTYF+  TGSKYVG+WKEGKM+GYGELVH+NHKYVG W+ G M+GKGKYVFD V CQ  GEY  +    D+   EEEE  ++  KW++  I  I +D
Sbjct:   22 RNERDERHGHGKATLPNGDTYVGEYENGKRHGSGLYRFKNGARYEGQYQKNKKHGKGVFIYPDGSRYEGSWIEDQRSGTGKYMYVNGDYYEGEWHQHQRHGRGTYFFSETGSKYVGMWKEGKMDGYGELVHANHKYVGLWRKGYMDGKGKYVFD-VGCQQHGEYQAVEQAADDKGEEEEEAAIIVPKWKAGAITKITED 219          
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Match: gnl|BL_ORD_ID|15739808 (tr|R7TW37|R7TW37_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173803 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.061e-83
Identity = 140/224 (62.50%), Postives = 174/224 (77.68%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXX-XXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXX-XNVVATKWRSNQIQPIIDD 714
            MSD GSE+ ++E+        EG RNE+DERHG GKA LPNGDTYEG+YEN KRHGHGTYRFKNGA+Y GE+ +NKKHG G F YPDGSKYEG+W+DDQR+G GKY+Y+NGD ++GEW+ H+RHGQGTY+Y  TG++YVG WKEGK  G+GEL+H+NHKYVG +K+    GKGKYVFD + CQ  GEY PI   GD++  EEEE +N V  KW+++ I  I+ D
Sbjct:    1 MSDIGSEEYDDEKDGQYLGEYEGERNERDERHGHGKARLPNGDTYEGMYENNKRHGHGTYRFKNGAQYDGEWMKNKKHGSGNFIYPDGSKYEGNWVDDQRSGTGKYFYVNGDIYDGEWQRHVRHGQGTYYYKETGTRYVGTWKEGKRQGHGELIHANHKYVGPFKDDRPEGKGKYVFD-IGCQQHGEYIPIEQAGDDNKMEEEEGQNKVIPKWKASHITEIMMD 223          
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Match: gnl|BL_ORD_ID|20309708 (tr|A0A1S3I8G0|A0A1S3I8G0_LINUN radial spoke head 1 homolog isoform X4 OS=Lingula unguis OX=7574 GN=LOC106161999 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.225e-83
Identity = 130/198 (65.66%), Postives = 154/198 (77.78%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXN-VVATKWRSNQIQPII 708
            RN+KDERHG GKATLPNGDTYEG+YENGKRHG GTYRFKNGARYIGEY +NKKHG+G F YPDGSKYEG+W++DQR G GKY+YIN D +EGEW++H RHGQG Y Y  TG+KY G WKEGK  G G+L+H+NHKYVGQWK     GKGKYVFD + C+  GEY P+    D+  GEEEE+  V+  KW++  +  I 
Sbjct:   23 RNDKDERHGYGKATLPNGDTYEGMYENGKRHGQGTYRFKNGARYIGEYMKNKKHGYGTFIYPDGSKYEGNWVEDQRCGQGKYFYINADTYEGEWRDHKRHGQGVYTYAETGTKYTGTWKEGKREGAGDLIHANHKYVGQWKEDRPEGKGKYVFD-IGCEQHGEYIPVEQVKDDKGGEEEEQQAVIIPKWKAGVVTAIT 219          
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Match: gnl|BL_ORD_ID|20343194 (tr|A0A1S3I8M4|A0A1S3I8M4_LINUN radial spoke head 1 homolog isoform X5 OS=Lingula unguis OX=7574 GN=LOC106161999 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.444e-82
Identity = 130/198 (65.66%), Postives = 154/198 (77.78%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXN-VVATKWRSNQIQPII 708
            RN+KDERHG GKATLPNGDTYEG+YENGKRHG GTYRFKNGARYIGEY +NKKHG+G F YPDGSKYEG+W++DQR G GKY+YIN D +EGEW++H RHGQG Y Y  TG+KY G WKEGK  G G+L+H+NHKYVGQWK     GKGKYVFD + C+  GEY P+    D+  GEEEE+  V+  KW++  +  I 
Sbjct:   23 RNDKDERHGYGKATLPNGDTYEGMYENGKRHGQGTYRFKNGARYIGEYMKNKKHGYGTFIYPDGSKYEGNWVEDQRCGQGKYFYINADTYEGEWRDHKRHGQGVYTYAETGTKYTGTWKEGKREGAGDLIHANHKYVGQWKEDRPEGKGKYVFD-IGCEQHGEYIPVEQVKDDKGGEEEEQQAVIIPKWKAGVVTAIT 219          
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:103045259])

HSP 1 Score: 194.897 bits (494), Expect = 1.120e-60
Identity = 110/190 (57.89%), Postives = 133/190 (70.00%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI 618
            MSD+GSE I E++    GEY G RNE  ERHGSGKA LPNGD YEG YE+GKR G GTY F+N ARYIGEY  N KHG GIF+YPDGSKYEG W++DQR G+G Y Y NGD ++GEW  H RHGQG Y Y  TG KY G W +GKM   GE +H +++Y G + N    G+GKY++D+   +  GEY  +
Sbjct:    1 MSDSGSE-ILEDEQKSAGEYSGERNEAGERHGSGKAVLPNGDIYEGQYEHGKRSGKGTYIFRNRARYIGEYYLNLKHGQGIFYYPDGSKYEGFWVEDQRQGHGVYTYSNGDTYDGEWVQHQRHGQGVYTYHDTGLKYTGTWVKGKMESAGEFIHLSYRYQGNFFNNKPIGQGKYIYDN-GFEQHGEYVQV 188          
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 90.1225 bits (222), Expect = 2.876e-19
Identity = 59/174 (33.91%), Postives = 83/174 (47.70%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYE------------------------GSWIDDQRNGNGKYYY--INGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGVMNGKGKYVF 576
            HG G A    G  Y+G + NG  HGHG Y + +G +Y GE+  N   GHGI+ + DGS YE                        G W   +R+G G   Y      ++EG+WKN+ R G G   Y  +G+ Y G WK    +G G +  +  N +Y GQW  GV +G+G + +
Sbjct:   79 HGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCY-PSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTW 251          

HSP 2 Score: 81.6481 bits (200), Expect = 1.720e-16
Identity = 53/147 (36.05%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  172 DTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKGKYVFDHVKCQLTG 603
            D YEG       HG G   F  G  Y G ++    HGHG + + DG KYEG ++ +   G+G Y +++G  +EGE    +RHG GTY    T S Y G W +GK +G G + ++  +   Y G WKN    G G      V+C  +G
Sbjct:   67 DRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWG------VRCYPSG 207          

HSP 3 Score: 79.337 bits (194), Expect = 9.861e-16
Identity = 53/159 (33.33%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFY--PDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMN-----------GYGELVHSNHKYVGQWKNGVMNGKGKYVF 576
            G G  T  +G  YEG    G RHG GTY   K  + Y G++ + K+HG GI  Y     S YEG W ++ R G G   Y +G+ ++G+WKN  RHG+GT  +     +Y G W  G  +           G G     +++Y G++  G+ +G+G +++
Sbjct:  126 GHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLY 284          

HSP 4 Score: 63.1586 bits (152), Expect = 1.673e-10
Identity = 39/134 (29.10%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGIFF----------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL 504
            R G G    P+G+ Y+G ++N  RHG GT R  +   +Y G++    +HG G             YP  ++Y+G ++   R+G G + Y +G  + G W+++ +HGQG   +   G  + G + E +M  + E 
Sbjct:  196 REGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFK-NGRIFEGEFIEDRMAEFPEF 328          
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 89.7373 bits (221), Expect = 3.554e-19
Identity = 59/174 (33.91%), Postives = 83/174 (47.70%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYE------------------------GSWIDDQRNGNGKYYY--INGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGVMNGKGKYVF 576
            HG G A    G  Y+G + NG  HGHG Y + +G +Y GE+  N   GHGI+ + DGS YE                        G W   +R+G G   Y      ++EG+WKN+ R G G   Y  +G+ Y G WK    +G G +  +  N +Y GQW  GV +G+G + +
Sbjct:   79 HGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCY-PSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTW 251          

HSP 2 Score: 81.6481 bits (200), Expect = 2.048e-16
Identity = 53/147 (36.05%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  172 DTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKGKYVFDHVKCQLTG 603
            D YEG       HG G   F  G  Y G ++    HGHG + + DG KYEG ++ +   G+G Y +++G  +EGE    +RHG GTY    T S Y G W +GK +G G + ++  +   Y G WKN    G G      V+C  +G
Sbjct:   67 DRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWG------VRCYPSG 207          

HSP 3 Score: 79.337 bits (194), Expect = 1.196e-15
Identity = 53/159 (33.33%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFY--PDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMN-----------GYGELVHSNHKYVGQWKNGVMNGKGKYVF 576
            G G  T  +G  YEG    G RHG GTY   K  + Y G++ + K+HG GI  Y     S YEG W ++ R G G   Y +G+ ++G+WKN  RHG+GT  +     +Y G W  G  +           G G     +++Y G++  G+ +G+G +++
Sbjct:  126 GHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLY 284          

HSP 4 Score: 62.7734 bits (151), Expect = 2.278e-10
Identity = 39/134 (29.10%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGIFF----------YPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL 504
            R G G    P+G+ Y+G ++N  RHG GT R  +   +Y G++    +HG G             YP  ++Y+G ++   R+G G + Y +G  + G W+++ +HGQG   +   G  + G + E +M  + E 
Sbjct:  196 REGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFK-NGRIFEGEFIEDRMAEFPEF 328          
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Match: morn3 (MORN repeat-containing protein 3 [Source:NCBI gene;Acc:103031534])

HSP 1 Score: 85.1149 bits (209), Expect = 1.474e-18
Identity = 59/176 (33.52%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  127 KDERHGSGKATLPN-GDTYEGLYENGKRHGHGTYRFKNGAR------YIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN--HKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTT 627
            ++ +HG G       G  Y+G +  GKR G GT   ++         Y GE+  +KK G G+  Y   S YEG W++ +R+G+G+ +Y NGD +EGEW     HGQG     A G++Y G WK+G+ NG G   + +    Y G W + V             C    E+A  PT 
Sbjct:   34 QNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKPHGQGVLTL-ANGNRYEGSWKDGRKNGPGCFFYLDKGQLYEGFWVDDVAKCG-------TMCDFGREHAATPTV 201          
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000015895.2 (ankyrin repeat and MYND domain containing 1 [Source:NCBI gene;Acc:103035247])

HSP 1 Score: 82.8037 bits (203), Expect = 7.866e-17
Identity = 39/113 (34.51%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  133 ERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVW 471
            +R+G G    P+G  YEG +    +HGHG Y + NG  Y G + ++ +HG G + +PDGS++ G +  +++ G G + + +G  F+G +    R G G   Y   G + VGVW
Sbjct:   14 KRNGEGVQQWPDGSRYEGQFVEDLKHGHGVYTWPNGQSYEGSFYKDFRHGSGTYIWPDGSRFTGKFYLNRKEGYGVHVFRDGTTFQGLFHADKRFGPGVITY-VDGRQDVGVW 125          

HSP 2 Score: 77.7962 bits (190), Expect = 3.603e-15
Identity = 35/91 (38.46%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  127 KDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEW 399
            +D +HG G  T PNG +YEG +    RHG GTY + +G+R+ G++  N+K G+G+  + DG+ ++G +  D+R G G   Y++G    G W
Sbjct:   35 EDLKHGHGVYTWPNGQSYEGSFYKDFRHGSGTYIWPDGSRFTGKFYLNRKEGYGVHVFRDGTTFQGLFHADKRFGPGVITYVDGRQDVGVW 125          
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 77.7962 bits (190), Expect = 5.686e-16
Identity = 55/159 (34.59%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFYPDG--SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGE---LVHS--------NHKYVGQWKNGVMNGKGKYVF 576
            G G    P+G  Y G  ENG RHG GT    K    Y G +  +++HG GI +Y +   S Y G W  + R+G G   Y +G+ +EG+W N+ RHG+G   +     +Y G WK GK +G G    LV           ++Y G+W  G  +G+G++++
Sbjct:    3 GHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLY 161          

HSP 2 Score: 67.0106 bits (162), Expect = 1.674e-12
Identity = 45/136 (33.09%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGH--------------GIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGE 501
            RHG G    P+G+ YEG + N +RHG G  R+      + EY+   KHG               G   YP  ++Y G W    R+G G++ Y +G  ++GEW+   +HG GT F   +G  Y G + E  M G  +
Sbjct:   73 RHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWIT---LMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGT-FTCKSGQIYEGSFVEDVMVGCSQ 204          
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 75.8702 bits (185), Expect = 1.980e-15
Identity = 55/159 (34.59%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFYPDG--SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGE---LVHS--------NHKYVGQWKNGVMNGKGKYVF 576
            G G    P+G  Y G  ENG RHG GT    K    Y G +  +++HG GI +Y +   S Y G W  + R+G G   Y +G+ +EG+W N+ RHG+G   +     +Y G WK GK +G G    LV           ++Y G+W  G  +G+G++++
Sbjct:   42 GHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLY 200          

HSP 2 Score: 70.4774 bits (171), Expect = 1.255e-13
Identity = 51/158 (32.28%), Postives = 79/158 (50.00%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDG-SKYEGSWIDDQRNGNGKYYY--INGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGVMNGKG--KYVFDHVKC 591
            HG GK    +G  +EG +      GHGTY++ +G++Y G      +HG G          Y G W   +R+G G  YY      ++ GEW +++RHG G   Y  +G+ Y G W   + +G G +  +    +Y GQWK+G  +G+G  K++   V C
Sbjct:   18 HGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYP-SGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGC 174          

HSP 3 Score: 65.855 bits (159), Expect = 4.642e-12
Identity = 45/136 (33.09%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGH--------------GIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGE 501
            RHG G    P+G+ YEG + N +RHG G  R+      + EY+   KHG               G   YP  ++Y G W    R+G G++ Y +G  ++GEW+   +HG GT F   +G  Y G + E  M G  +
Sbjct:  112 RHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWIT---LMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGT-FTCKSGQIYEGSFVEDVMVGCSQ 243          

HSP 4 Score: 51.6026 bits (122), Expect = 1.713e-7
Identity = 33/115 (28.70%), Postives = 57/115 (49.57%), Query Frame = 1
Query:  229 FKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK---YVGQWKNGVMNGKG 564
            ++ G  Y G +  N  HG G + + DG ++EG +  +   G+G Y + +G  + G  +N +RHGQGT         Y G W   + +G G + +   +   Y G+W + + +G G
Sbjct:    2 YEGGNVYSGSFCNNMMHGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWG 116          
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.256e-13
Identity = 32/86 (37.21%), Postives = 51/86 (59.30%), Query Frame = 1
Query:  148 GKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 405
            G  T   G+ Y+G ++ G+RHG G  RF +G  Y+G++      G G+  +PDGS++EG +   + +G G +   +G  FEGE+KN
Sbjct:    6 GSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKN 91          

HSP 2 Score: 55.8398 bits (133), Expect = 5.849e-10
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDY 384
            RHG G+    +G  Y G +ENG   G G   F +G+R+ GE+S+ K HG G+F   DG  +EG + +    G G   + +G +
Sbjct:   25 RHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGSH 107          

HSP 3 Score: 52.373 bits (124), Expect = 1.086e-8
Identity = 32/97 (32.99%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  217 GTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELV 507
            G++ +  G  Y GE+ E ++HG G   + DG+ Y G + +   +G G   + +G  FEGE+     HG G  F  + G  + G +K G + GYG L 
Sbjct:    6 GSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGV-FSRSDGMMFEGEFKNGHVEGYGLLT 101          

HSP 4 Score: 51.2174 bits (121), Expect = 2.507e-8
Identity = 31/98 (31.63%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  286 GIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
            G F Y  G +Y+G W + +R+G G+  + +G ++ G+++N L  G G   +   GS++ G + +GK +G G    S+   + G++KNG + G G   F
Sbjct:    6 GSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFP-DGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTF 102          
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002910.1 (pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 gene:ENSPMAG00000002661.1 transcript:ENSPMAT00000002910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.313e-13
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYR-----FKNGARYIGEYSENKKHGHGIF-FYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYF 435
            HG G     NGD YEG + NG RHGHG  R       + + YIG+++ + K G+G+F     G KY G W++D R+GNG      G Y+E  + ++   GQG   
Sbjct:   37 HGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLL 141          

HSP 2 Score: 62.003 bits (149), Expect = 5.170e-11
Identity = 48/156 (30.77%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  148 GKATLPNG-----DTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIF-----FYPDGSKYEGSWIDDQRNGNGKYYYIN-GDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHS-NHKYVGQWKNGV-MNGKGKYVF 576
            G+  +PN      D Y G ++  + HG G  R+ NG  Y G +S   +HGHG+           S Y G W +D + G G +  I  G+ + G W N  RHG G       G  Y  V+   +M G G L+   + +Y G++   + +NGKG    
Sbjct:   12 GELCVPNQLLGKDDVYCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGV-VVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTADLALNGKGVLTL 166          
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001977.1 (pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-1 gene:ENSPMAG00000001779.1 transcript:ENSPMAT00000001977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.344e-13
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGA-----RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYG 498
            HG G+ T P+G TY G ++ G  HG+G Y   N +     +Y GE+ E K +G+G++ + DG  YEG  +   R+G+G      G++                     G  YVG W  GK  GYG
Sbjct: 1055 HGWGRMTWPDGRTYIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGMLLSSKGEH--------------------AGGVYVGHWASGKRAGYG 1159          

HSP 2 Score: 60.8474 bits (146), Expect = 2.534e-10
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  238 GARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYING-----DYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELV-----HSNHKYVGQWKNGVMNGKGKY 570
            GA Y G++ + K HG G   +PDG  Y G++     +G GKY   N      + + GEW+    +G G Y + A G  Y G    G  +G+G L+     H+   YVG W +G   G G Y
Sbjct: 1042 GAHYYGQWCDGKPHGWGRMTWPDGRTYIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLYKH-ADGEVYEGYLVGGVRHGHGMLLSSKGEHAGGVYVGHWASGKRAGYGVY 1161          
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Match: EDO42910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S069])

HSP 1 Score: 224.942 bits (572), Expect = 1.131e-72
Identity = 126/224 (56.25%), Postives = 159/224 (70.98%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMS 720
            MSD GSE+ EE++G+ LG YEG RNE +ERHG GK TLPN DTYEG YE+GKRHG+GTYRFKNGA+Y+GEYS+ KKHG G F+YPDGS+YEG W++D+RNG+G YYY NGD +EG W  H RHGQGTY Y  T +KY G W  GK +G GEL+H+NH+YVG +      G GKY FD + C+  GEY       +  T E+E+  V   KW+ +++  I   +S
Sbjct:    1 MSDIGSEEFEEDEGINLGTYEGDRNEAEERHGFGKTTLPNSDTYEGQYEHGKRHGNGTYRFKNGAKYVGEYSKGKKHGQGTFWYPDGSRYEGGWVEDRRNGHGTYYYPNGDTYEGNWYEHQRHGQGTYTYANTRTKYQGTWMHGKRDGSGELIHANHRYVGSFAEDNPQGSGKYKFD-MGCEQHGEYKLEEKLQEADTEEDEQITVYTPKWKCHRVTEIAAVLS 223          
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Match: EDO45129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ4])

HSP 1 Score: 197.978 bits (502), Expect = 1.862e-62
Identity = 107/195 (54.87%), Postives = 134/195 (68.72%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEY--APIPTTGDEHTGXXXXXNVVATKWRSNQI 696
            RNE +ERHG GKATLPNGD YEG Y +GKRHG GTY+FK G +Y G Y+  KKHG G F+YPDGS+YEG WI+D+++G G YYY NGD +EGEW  + R+GQG Y Y  TGSKY G W  GKM+G GEL+HSNHK+ G  +  +  GKGKY FD   C+  G+Y    +    D    EE++E V+  +WR  +I
Sbjct:    6 RNEDEERHGKGKATLPNGDVYEGEYSHGKRHGQGTYKFKTGGKYTGSYANGKKHGEGTFWYPDGSRYEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQRNGQGMYTYAETGSKYKGSWVAGKMDGAGELIHSNHKFSGFMQQNLPKGKGKYSFD-FGCEQRGKYEIVEVVIEKDYEAEEEDDEVVLQQRWRCEEI 199          
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Match: EDO33639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL1])

HSP 1 Score: 197.208 bits (500), Expect = 4.146e-62
Identity = 96/158 (60.76%), Postives = 120/158 (75.95%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYA 612
            HG G+A LPNGDTYEG YENGKRHG G YRFKNGARYIG Y +NKK+G G+F+YPDGSKYEG W++DQR+G G Y Y N D FEGEW  + RHGQGTY Y  TGS++ G W +G+M G G+LVH+NH++VG + +    G+G+Y FD + C+  G+Y 
Sbjct:   30 HGQGRAKLPNGDTYEGSYENGKRHGKGIYRFKNGARYIGHYLDNKKNGEGLFYYPDGSKYEGYWVNDQRHGYGTYTYANKDIFEGEWVQNKRHGQGTYTYAETGSRFEGTWFQGRMQGSGQLVHANHRFVGSFTDDHPKGRGRYEFD-LGCEQRGKYT 186          
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Match: EDO39343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAB7])

HSP 1 Score: 170.629 bits (431), Expect = 1.192e-51
Identity = 85/154 (55.19%), Postives = 111/154 (72.08%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFD 579
            RNE  ERHG GKA   NGD Y G Y NGKRHG GTY F+ GARY+G Y  NKK+G G F YPDGS+YEG+W DD+R+G G Y+Y NGD +EGEW+++ RHG+GTY    T  K  G W++GK+NG+ +++HS+H++ G +   +  G GKYVF+
Sbjct:   21 RNELGERHGQGKALHGNGDLYTGSYWNGKRHGKGTYIFRKGARYMGFYENNKKNGKGTFTYPDGSRYEGTWSDDERHGVGTYFYTNGDTYEGEWRSNRRHGKGTYTDAHTNVKLEGTWEKGKLNGHCKIIHSDHRFEGVFAENLPTGPGKYVFE 174          

HSP 2 Score: 61.2326 bits (147), Expect = 4.903e-11
Identity = 40/126 (31.75%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  250 IGEYSENK-----KHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVFDHVKCQLTGEY 609
            IGEY  ++     +HG G   + +G  Y GS+ + +R+G G Y +  G  + G ++N+ ++G+GT+ Y   GS+Y G W + + +G G   ++N   Y G+W++   +GKG Y   H   +L G +
Sbjct:   14 IGEYEGDRNELGERHGQGKALHGNGDLYTGSYWNGKRHGKGTYIFRKGARYMGFYENNKKNGKGTFTY-PDGSRYEGTWSDDERHGVGTYFYTNGDTYEGEWRSNRRHGKGTYTDAHTNVKLEGTW 138          
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Match: EDO45098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTV6])

HSP 1 Score: 158.303 bits (399), Expect = 2.908e-47
Identity = 90/173 (52.02%), Postives = 105/173 (60.69%), Query Frame = 1
Query:  118 RNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFK------NGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI 618
            RNE+ ERHG GKA LPNGD YEG Y NG RHG G Y FK        A YIG Y +NKK+G G F YPDG+KYEGSW DD R G G YYY N D + GEW    R+G GTY Y A+G  Y G W EGK +G G+L      Y+G + +  M G G Y+F +   Q  GEY  +
Sbjct:    9 RNEQGERHGKGKARLPNGDAYEGEYRNGYRHGFGKYVFKKVKGKSRSACYIGYYEKNKKNGQGTFLYPDGAKYEGSWKDDLRQGFGTYYYTNADTYRGEWDKDRRNGHGTYTYAASGMVYEGQWVEGKRSGRGKLTFGKQCYIGNFHDDKMLGPGTYIFPN-GSQQHGEYVIV 180          
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:101161589])

HSP 1 Score: 203.756 bits (517), Expect = 3.560e-64
Identity = 107/190 (56.32%), Postives = 129/190 (67.89%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPI 618
            MS +GSED+ EE           RN+  +RHG G++ LPNGD Y+G YE+G+RHG GTYRFKNGA Y+GEY +N KHG G F+YPDGSKYEGSW++D R G G Y Y NGD +EGEW NH RHGQG Y Y  TGSKYVG W  G M   GE +H+NHKY G + N   +G GK+VFD   C+  GE+   
Sbjct:    1 MSFSGSEDLNEELSKLANYEGD-RNDAGQRHGVGRSVLPNGDIYQGRYEHGERHGQGTYRFKNGAVYVGEYFKNLKHGQGTFYYPDGSKYEGSWVNDLRQGRGVYTYSNGDTYEGEWLNHFRHGQGVYHYHLTGSKYVGSWVNGNMQSAGEYIHANHKYQGNFFNNKPDGPGKFVFD-FGCEQHGEFQQF 188          
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:101169070])

HSP 1 Score: 98.5969 bits (244), Expect = 3.942e-22
Identity = 54/125 (43.20%), Postives = 75/125 (60.00%), Query Frame = 1
Query:  142 GSGKATLPNGDTYEGLYENGKRHGHGTYRF-KNGARYIGEYSENKKHGHGIFFYPDG--SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELV 507
            G GK T P+G TY G   +G RHG GT+   K G  Y GE+S  K+HG G  +Y +   S Y+G W+ + R G G+  Y++G+ + GEWK ++RHG+GT  +   G +YVG W EG  +G G  V
Sbjct:   92 GRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHV 216          

HSP 2 Score: 77.411 bits (189), Expect = 4.599e-15
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  127 KDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYI-NGDYFEGEWKNHLRHGQGTYFY-DATGSKYVGVWKEGKMNGYGELVH-SNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYA 612
            +DE  G  +     G  ++G++  G   G G +   NG  Y GE+  N   G G F +PDGS Y G  +D  R+G G +     G  + GEW    RHG+GT +Y ++  S Y G W      G GE  + S + Y G+WK  V +G+G   +  +  Q  G + 
Sbjct:   41 EDEFSGQREVYFEGGHVHKGMFSKGLMDGWGIFTHLNGLTYEGEFVRNIPTGRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWC 205          

HSP 3 Score: 72.0182 bits (175), Expect = 2.247e-13
Identity = 45/128 (35.16%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  136 RHGSGKATLPNGDTYEGLYENGKRHGHGTYR-FKNGARYIGEYSENKKHGHGI----------FFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKM 486
            R G G+    +G+TY G ++   RHG GT +  K G +Y+G + E  +HG G             Y   ++Y G ++  QR+G+G +YY  G  +EGEWKN+ +HGQG       G  + G +K+ KM
Sbjct:  162 REGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKREGGLQYFQNNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNNKKHGQGK-LTSKNGHIFKGEFKDDKM 288          
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000030376.1 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 91.6633 bits (226), Expect = 4.095e-21
Identity = 68/178 (38.20%), Postives = 90/178 (50.56%), Query Frame = 1
Query:  130 DERHGSGKATLPN-GDTYEGLYENGKRHGHGTYRFKNGA------RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNH--KYVGQWKNGVMNGKGKYVFDHVKCQLTGEY----APIPT 624
            + +HG G     N G  Y G +  GK  G+GTY   +        +Y GE+   KKHG+GI+FY + + YEG W + QR+G GK ++ N D +EGEW     HG+G   Y A GS Y G WK+GK NG G+  +S     YVG W +G             KC    EY    AP P+
Sbjct:   45 NRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLY-ANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG-----------EAKCGTLCEYEKDKAPEPS 210          

HSP 2 Score: 71.2478 bits (173), Expect = 6.011e-14
Identity = 46/122 (37.70%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  235 NGARYIGEYSENKKHGHGIFFYPD-GSKYEGSWIDDQRNGNGKYYYINGDY------FEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK-YVGQWKNGVMNGKGKYVF 576
            NG +Y GE+ +N+KHG GI  + + G+ Y G W   + +G G YY ++ +       ++GEWKN  +HG G YFY+ T + Y G W EG+ +G G++ H N   Y G+W     +G+GK ++
Sbjct:   34 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNT-AVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLY 154          

HSP 3 Score: 50.0618 bits (118), Expect = 1.139e-6
Identity = 29/81 (35.80%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  364 YYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-------HKYVGQWKNGVMNGKGKYVFDHV 585
            + +NGD + GEW+++ +HG G   +  TG+ Y G W+ GK +GYG     +        KY G+WKNG  +G G Y +++ 
Sbjct:   31 FSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNT 111          
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000010654.2 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 90.1225 bits (222), Expect = 1.173e-20
Identity = 68/178 (38.20%), Postives = 90/178 (50.56%), Query Frame = 1
Query:  130 DERHGSGKATLPN-GDTYEGLYENGKRHGHGTYRFKNGA------RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNH--KYVGQWKNGVMNGKGKYVFDHVKCQLTGEY----APIPT 624
            + +HG G     N G  Y G +  GK  G+GTY   +        +Y GE+   KKHG+GI+FY + + YEG W + QR+G GK ++ N D +EGEW     HG+G   Y A GS Y G WK+GK NG G+  +S     YVG W +G             KC    EY    AP P+
Sbjct:   39 NRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLY-ANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG-----------EAKCGTLCEYEKDKAPEPS 204          

HSP 2 Score: 70.8626 bits (172), Expect = 8.242e-14
Identity = 46/122 (37.70%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  235 NGARYIGEYSENKKHGHGIFFYPD-GSKYEGSWIDDQRNGNGKYYYINGDY------FEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK-YVGQWKNGVMNGKGKYVF 576
            NG +Y GE+ +N+KHG GI  + + G+ Y G W   + +G G YY ++ +       ++GEWKN  +HG G YFY+ T + Y G W EG+ +G G++ H N   Y G+W     +G+GK ++
Sbjct:   28 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNT-AVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLY 148          

HSP 3 Score: 49.6766 bits (117), Expect = 1.453e-6
Identity = 29/81 (35.80%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  364 YYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-------HKYVGQWKNGVMNGKGKYVFDHV 585
            + +NGD + GEW+++ +HG G   +  TG+ Y G W+ GK +GYG     +        KY G+WKNG  +G G Y +++ 
Sbjct:   25 FSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNT 105          
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 [Source:NCBI gene;Acc:101169837])

HSP 1 Score: 85.8853 bits (211), Expect = 8.934e-18
Identity = 56/173 (32.37%), Postives = 87/173 (50.29%), Query Frame = 1
Query:  142 GSGKATLPN-----GDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFF-----YPDGSKYEGSWIDDQRNGNGKYYYIN-GDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELV-HSNHKYVGQWKNG-VMNGKGKYVF---DHVKCQLTGEYA 612
            G G+   PN      D Y+G +++GK HG GTYR+ +G  Y G + +  +HGHG+           S + G W+ D++ G G +  I  G+ F G W++HLR G G       G  Y G +K+ KM G G LV   +  Y G + +   ++GKG       D+++   +GE+ 
Sbjct:  949 GFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGV-VVTQFGLYYEGAFKDNKMAGTGVLVSEDDTTYEGDFSDDWTLSGKGVLTLANGDYLEGSFSGEWG 1120          

HSP 2 Score: 82.4185 bits (202), Expect = 1.415e-16
Identity = 43/144 (29.86%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  175 TYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPD-----GSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTY----FYDATGSKYVGVWKEGKMNGYGEL--VHSNHKYVGQWKNGVMNGKGKYV 573
            TYEG + +GK HG G  ++ +G  Y G +    + G G F  P+        Y+G W D + +G G Y Y +G+ ++G +++ +RHG G         ++ S ++G W + K  GYG    +    K++G W++ +  G G  V
Sbjct:  914 TYEGGWVSGKPHGSGVLKWPDGRIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVV 1057          

HSP 3 Score: 70.0922 bits (170), Expect = 1.401e-12
Identity = 48/161 (29.81%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  139 HGSGKATLPNGDTYEGLYENGKRHGHGTYR-----FKNGARYIGEYSENKKHGHGIF-FYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEG-KMNGYGELVHSNHKYV-----GQWKNGVMNGKGKYVFDHV 585
            HG G     +G+ Y+G +++G RHGHG  R       + + +IG++ ++KK G+G+F     G K+ G W D  R G G      G Y+EG +K++   G G        + Y G + +   ++G G L  +N  Y+     G+W +G +   G Y   H+
Sbjct:  976 HGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGV-LVSEDDTTYEGDFSDDWTLSGKGVLTLANGDYLEGSFSGEWGSG-LKVTGSYFKPHL 1134          

HSP 4 Score: 67.3958 bits (163), Expect = 1.047e-11
Identity = 42/126 (33.33%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  241 ARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYIN-----GDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGEL------VHSNHKYVGQWKNGVMNGKGKYVFDHV 585
            A Y G +   K HG G+  +PDG  Y G++ +   +G G++   N      D ++G WK+   HG GTY Y A+G  Y G +++G  +G+G L        S   ++GQW      G G  VFD +
Sbjct:  913 ATYEGGWVSGKPHGSGVLKWPDGRIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRY-ASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYG--VFDDI 1035          
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Match: SMESG000014300.1 (SMESG000014300.1)

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 308/310 (99.35%), Postives = 308/310 (99.35%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMSMNPKFKTNEGEPDIEDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIEDEPDNFDNTDNIEKSLDANESQEQENVEPSADQNS 978
            MSDAGSEDIEEEQGLYLGEYEGGRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGEEEEENVVATKWRSNQIQPI DDMSMNPKFKTNEGEPDIEDGELEKEVNENLEENDETKNEEEK PESENIENVIEDEPDNFDNTDNIEKSLDANESQEQENVEPSADQNS
Sbjct:    1 MSDAGSEDIEEEQGLYLGEYEGGRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGEEEEENVVATKWRSNQIQPITDDMSMNPKFKTNEGEPDIEDGELEKEVNENLEENDETKNEEEKTPESENIENVIEDEPDNFDNTDNIEKSLDANESQEQENVEPSADQNS 310          
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Match: SMESG000047536.1 (SMESG000047536.1)

HSP 1 Score: 231.106 bits (588), Expect = 1.078e-74
Identity = 128/233 (54.94%), Postives = 157/233 (67.38%), Query Frame = 1
Query:   49 MSDAGSEDIXXXXXXXXXXXXXXRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGXXXXXNVVATKWRSNQIQPIIDDMSMNPKFKTNE 747
            MSDA  E++EEE  + LG Y G RNEK ERHG GKA LPNGD YEG Y+NGKRHG+GTY FKNGARYIG+Y EN K G G+F+Y DGSKYEG W +D+RNG G Y YINGDY++GEW++  RHGQGTYFY    SKY GVW  G M GYG+++H+NHKYVG WK+  +   GK+VF HV CQ  GE        ++             +W++ +  PI DD+   P F  +E
Sbjct:    1 MSDAEDENMEEEGFINLGTYVGERNEKKERHGFGKARLPNGDVYEGFYQNGKRHGYGTYIFKNGARYIGDYVENIKSGKGLFYYLDGSKYEGEWANDERNGKGVYSYINGDYYDGEWRDAKRHGQGTYFYAVNASKYEGVWNNGSMEGYGQIIHANHKYVGYWKDNKIIRNGKFVFPHVHCQQNGEMKKGRKKEEDEE-------EPKIRWKAEKFGPINDDIP--PDFVDHE 224          
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.331e-18
Identity = 54/149 (36.24%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  124 EKDERHGSGKATLPNGDTYEGLYENGKRHGHG-TYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKG 564
            +K ++HG G+  + +G  YEG ++NG+  G G  Y  K G  Y GE+   +  G G  FY +G +Y G W  + R GNG+  Y NGD +EGE+  H  HG+G       GS Y G W  G  +G+G++   +   Y GQ+   + +G+G
Sbjct:   23 QKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRL-MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEG 170          

HSP 2 Score: 75.0998 bits (183), Expect = 1.243e-14
Identity = 43/115 (37.39%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  133 ERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKE 477
            E  G+G     NGD Y G + +  R G+G   + NG  Y GE+ ++K HG GI    +GS Y G WI   ++G+GK    +G  +EG++  +L HG+GT F+   G  Y G+W++
Sbjct:   73 EMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFH-ICGILYTGLWEQ 186          

HSP 3 Score: 70.8626 bits (172), Expect = 3.089e-13
Identity = 38/94 (40.43%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHL 411
            + R G+G+ T  NGD YEG +   K HG G  R  NG+ Y G +    KHGHG    PDGS YEG +  +  +G G  ++I G  + G W+ +L
Sbjct:   95 NSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 188          

HSP 4 Score: 59.3066 bits (142), Expect = 2.006e-9
Identity = 46/130 (35.38%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  205 RHGHGTYRFKNGA-RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNG-KYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN----------HKYVGQWKNGVMNG 558
            R G G Y ++N   +Y GE+ + KKHGHG F   DGS YEG + + +  G G +Y+   G+ + GE+ N    G G  FY   G +Y G W      G G+L ++N          HK  G+    +MNG
Sbjct:    3 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFY-GNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNG 131          

HSP 5 Score: 53.1434 bits (126), Expect = 1.667e-7
Identity = 31/103 (30.10%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  274 KHGHGIFFYPDGS-KYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
            + G G++ Y +   KYEG W   +++G+G++   +G ++EGE++N    G+G  ++  TG+ Y G +  G+M G G + + N  +Y G W +    G G+  +
Sbjct:    3 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTY 105          

HSP 6 Score: 51.6026 bits (122), Expect = 5.319e-7
Identity = 26/68 (38.24%), Postives = 35/68 (51.47%), Query Frame = 1
Query:  127 KDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSW 330
            K + HG G   L NG  Y G +  G +HGHG     +G+ Y G+++ N  HG G  F+  G  Y G W
Sbjct:  117 KHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW 184          
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 85.1149 bits (209), Expect = 7.534e-18
Identity = 54/149 (36.24%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  124 EKDERHGSGKATLPNGDTYEGLYENGKRHGHG-TYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKG 564
            +K ++HG G+  + +G  YEG ++NG+  G G  Y  K G  Y GE+   +  G G  FY +G +Y G W  + R GNG+  Y NGD +EGE+  H  HG+G       GS Y G W  G  +G+G++   +   Y GQ+   + +G+G
Sbjct:   39 QKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRL-MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEG 186          

HSP 2 Score: 75.0998 bits (183), Expect = 1.394e-14
Identity = 43/115 (37.39%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  133 ERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKE 477
            E  G+G     NGD Y G + +  R G+G   + NG  Y GE+ ++K HG GI    +GS Y G WI   ++G+GK    +G  +EG++  +L HG+GT F+   G  Y G+W++
Sbjct:   89 EMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFH-ICGILYTGLWEQ 202          

HSP 3 Score: 70.8626 bits (172), Expect = 3.389e-13
Identity = 38/94 (40.43%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  130 DERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHL 411
            + R G+G+ T  NGD YEG +   K HG G  R  NG+ Y G +    KHGHG    PDGS YEG +  +  +G G  ++I G  + G W+ +L
Sbjct:  111 NSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 204          

HSP 4 Score: 59.3066 bits (142), Expect = 1.860e-9
Identity = 35/112 (31.25%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  247 YIGEYSENKKHGHGIFFYPDGS-KYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
            YIGE ++  + G G++ Y +   KYEG W   +++G+G++   +G ++EGE++N    G+G  ++  TG+ Y G +  G+M G G + + N  +Y G W +    G G+  +
Sbjct:   10 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTY 121          

HSP 5 Score: 59.3066 bits (142), Expect = 2.145e-9
Identity = 46/130 (35.38%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  205 RHGHGTYRFKNGA-RYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNG-KYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN----------HKYVGQWKNGVMNG 558
            R G G Y ++N   +Y GE+ + KKHGHG F   DGS YEG + + +  G G +Y+   G+ + GE+ N    G G  FY   G +Y G W      G G+L ++N          HK  G+    +MNG
Sbjct:   19 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFY-GNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNG 147          

HSP 6 Score: 51.6026 bits (122), Expect = 5.663e-7
Identity = 26/68 (38.24%), Postives = 35/68 (51.47%), Query Frame = 1
Query:  127 KDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSW 330
            K + HG G   L NG  Y G +  G +HGHG     +G+ Y G+++ N  HG G  F+  G  Y G W
Sbjct:  133 KHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW 200          
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Match: SMESG000011788.1 (SMESG000011788.1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.773e-18
Identity = 55/146 (37.67%), Postives = 84/146 (57.53%), Query Frame = 1
Query:  160 LPNGDTYEGLYENGKRHGHGT-YRFKNGARYIGEYSENKKHGHGIFFYPDGSK-----YEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 576
              NGD Y G + N  ++G GT Y    G  Y G++ ++KK+G G+     G       Y G W ++ R+G G+ +Y + +++EGEW    R+G G   Y+A G+ Y G W+  +M G G L + N ++Y GQWKNG+ NG+GKY +
Sbjct:   37 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGR-MYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYY 181          

HSP 2 Score: 76.6406 bits (187), Expect = 6.901e-16
Identity = 46/119 (38.66%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  130 DERHGSGKATLPNG-DTYEGLY----ENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVW 471
            D+++G G  ++  G DTYE +Y    +N  RHG G   + +   Y GE+ E K++G G  +  DG+ YEG W +DQ  G G     NG+ +EG+WKN +R+G+G Y+Y   G    G+W
Sbjct:   74 DKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 192          

HSP 3 Score: 51.6026 bits (122), Expect = 2.459e-7
Identity = 32/90 (35.56%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 WIDDQRNGNGK-----YYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK------YVGQWKNGVMNGKG 564
            W D  +  N K      Y++NGD + G+W N++++G+GT +  + G  Y G WK+ K NG+G L     K      Y G WKN + +G G
Sbjct:   19 WYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFG 108          
The following BLAST results are available for this feature:
BLAST of Radial spoke head 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH16.471e-6856.34radial spoke head component 1 [Source:HGNC Symbol;... [more]
RSPH11.054e-4952.78radial spoke head component 1 [Source:HGNC Symbol;... [more]
RSPH10B23.940e-1835.17radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B23.940e-1835.17radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B23.940e-1835.17radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-16.293e-931.08JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG54587.246e-3138.64gene:FBgn0032478 transcript:FBtr0080437[more]
CG144909.050e-2040.46gene:FBgn0034281 transcript:FBtr0086801[more]
CG304291.960e-1131.09gene:FBgn0050429 transcript:FBtr0072450[more]
Als21.528e-925.79gene:FBgn0037116 transcript:FBtr0078462[more]
rtp2.017e-934.65gene:FBgn0087005 transcript:FBtr0078825[more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT573248.31.562e-6654.09radial spoke head component 1 [Source:NCBI gene;Ac... [more]
RSPH11.562e-6654.09radial spoke head component 1 [Source:NCBI gene;Ac... [more]
morn32.033e-1837.58MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
morn32.403e-1837.58MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
BX571704.14.458e-1730.50alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020980.11.385e-2755.21radial spoke head component 1 [Source:NCBI gene;Ac... [more]
igf29.791e-1836.72insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
ENSXETT00000041392.11.062e-1737.24radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041404.11.339e-1737.93radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041411.11.677e-1737.93radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rsph19.003e-6958.67radial spoke head 1 homolog (Chlamydomonas) [Sourc... [more]
Rsph11.121e-6858.67radial spoke head 1 homolog (Chlamydomonas) [Sourc... [more]
Rsph11.624e-5054.60radial spoke head 1 homolog (Chlamydomonas) [Sourc... [more]
Morn14.589e-1939.84MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
Rsph10b7.515e-1934.39radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VIG3|RSPH1_MOUSE6.298e-6858.67Radial spoke head 1 homolog OS=Mus musculus OX=100... [more]
sp|Q8WYR4|RSPH1_HUMAN3.108e-6756.34Radial spoke head 1 homolog OS=Homo sapiens OX=960... [more]
sp|Q6VTH5|RSPH1_CYPCA1.101e-6358.42Radial spoke head 1 homolog OS=Cyprinus carpio OX=... [more]
sp|Q8L796|PI5K2_ARATH3.408e-2540.14Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Ara... [more]
sp|Q56YP2|PI5K1_ARATH7.455e-2538.78Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Ara... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182513843.484e-8767.84tr|A0A267H5Z6|A0A267H5Z6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157925127.461e-8767.84tr|A0A267ER11|A0A267ER11_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157398081.061e-8362.50tr|R7TW37|R7TW37_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|203097085.225e-8365.66tr|A0A1S3I8G0|A0A1S3I8G0_LINUN radial spoke head 1... [more]
gnl|BL_ORD_ID|203431941.444e-8265.66tr|A0A1S3I8M4|A0A1S3I8M4_LINUN radial spoke head 1... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH11.120e-6057.89radial spoke head component 1 [Source:NCBI gene;Ac... [more]
rsph10b2.876e-1933.91radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b3.554e-1933.91radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
morn31.474e-1833.52MORN repeat-containing protein 3 [Source:NCBI gene... [more]
ENSAMXT00000015895.27.866e-1734.51ankyrin repeat and MYND domain containing 1 [Sourc... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH10B25.686e-1634.59radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B21.980e-1534.59radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
ENSPMAT00000003398.11.256e-1337.21pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
ENSPMAT00000002910.11.313e-1338.10pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 g... [more]
ENSPMAT00000001977.12.344e-1332.80pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429101.131e-7256.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451291.862e-6254.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336394.146e-6260.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393431.192e-5155.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450982.908e-4752.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH13.560e-6456.32radial spoke head component 1 [Source:NCBI gene;Ac... [more]
rsph10b3.942e-2243.20radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
ENSORLT00000030376.14.095e-2138.20MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000010654.21.173e-2038.20MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
als2b8.934e-1832.37alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Radial spoke head 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014300.10.000e+099.35SMESG000014300.1[more]
SMESG000047536.11.078e-7454.94SMESG000047536.1[more]
SMESG000012434.16.331e-1836.24SMESG000012434.1[more]
SMESG000012434.17.534e-1836.24SMESG000012434.1[more]
SMESG000011788.18.773e-1837.67SMESG000011788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011512 ID=SMED30011512|Name=Radial spoke head 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1090bp
TTCCGATCTTATTGCTATAACAAATTATTTAGCAATTAATTGAAAAAAAT
GTCTGACGCTGGATCTGAAGATATTGAAGAAGAACAAGGTTTATATTTAG
GAGAATATGAAGGAGGAAGAAATGAGAAAGATGAGAGACACGGATCAGGT
AAAGCTACTTTACCTAACGGAGACACATATGAGGGGTTGTACGAAAACGG
TAAACGCCATGGACATGGAACATACAGATTCAAAAATGGTGCACGCTATA
TTGGTGAGTATAGTGAAAACAAAAAACATGGTCATGGAATATTTTTCTAT
CCTGATGGTAGTAAATATGAAGGATCATGGATTGATGACCAAAGAAATGG
AAATGGAAAGTATTATTATATCAACGGAGACTATTTTGAAGGTGAGTGGA
AGAATCACCTGAGACATGGACAAGGGACATATTTCTATGACGCTACCGGT
AGCAAATATGTCGGAGTGTGGAAAGAAGGCAAAATGAATGGATATGGAGA
ACTGGTTCATTCAAATCACAAATACGTTGGCCAATGGAAAAATGGAGTGA
TGAATGGTAAAGGAAAATATGTTTTCGACCATGTAAAATGCCAATTAACT
GGTGAGTATGCCCCAATTCCAACAACCGGAGATGAACATACAGGAGAAGA
AGAGGAAGAGAATGTTGTAGCGACAAAGTGGCGGTCAAATCAAATCCAAC
CAATTATAGATGATATGTCAATGAATCCCAAATTTAAAACAAATGAAGGT
GAACCTGACATTGAAGATGGTGAACTCGAAAAAGAAGTTAATGAAAATCT
AGAAGAAAACGATGAAACTAAAAATGAAGAAGAAAAGATACCAGAGAGTG
AAAATATTGAAAATGTAATTGAAGACGAGCCCGATAATTTTGACAATACA
GACAACATTGAAAAGTCATTGGATGCAAACGAATCACAAGAGCAGGAAAA
TGTTGAGCCGTCTGCTGATCAAAACAGTGATAATGTTAATGAAAATGTTG
ATGAATGATGTTGATGTTTTAATTTTGTCGTTTTCTGTAGGATTTGAGAT
TCGAGTTTATGCTATGTTTTAATATCAATTTGAAATATTG
back to top

protein sequence of SMED30011512-orf-1

>SMED30011512-orf-1 ID=SMED30011512-orf-1|Name=SMED30011512-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MSDAGSEDIEEEQGLYLGEYEGGRNEKDERHGSGKATLPNGDTYEGLYEN
GKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRN
GNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYG
ELVHSNHKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYAPIPTTGDEHTGE
EEEENVVATKWRSNQIQPIIDDMSMNPKFKTNEGEPDIEDGELEKEVNEN
LEENDETKNEEEKIPESENIENVIEDEPDNFDNTDNIEKSLDANESQEQE
NVEPSADQNSDNVNENVDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0000794condensed nuclear chromosome
GO:0001520outer dense fiber
GO:0005634nucleus
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005929cilium
GO:0031514motile cilium
GO:0036126sperm flagellum
GO:0042995cell projection
GO:0072687meiotic spindle
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007283spermatogenesis
GO:0030154cell differentiation
GO:0007286spermatid development
GO:0035082axoneme assembly
GO:0051321meiotic cell cycle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 240..264
NoneNo IPR availableGENE3DG3DSA:2.20.110.10coord: 93..239
e-value: 9.1E-17
score: 63.2
coord: 22..92
e-value: 7.1E-18
score: 66.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 209..227
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..312
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..35
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..256
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 191..319
NoneNo IPR availablePANTHERPTHR43215FAMILY NOT NAMEDcoord: 1..228
NoneNo IPR availablePANTHERPTHR43215:SF5coord: 1..228
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 109..179
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 18..130
IPR003409MORN motifSMARTSM00698morncoord: 88..109
e-value: 0.0028
score: 26.9
coord: 111..132
e-value: 0.18
score: 19.7
coord: 65..86
e-value: 7.2E-6
score: 35.5
coord: 14..40
e-value: 38.0
score: 2.3
coord: 135..156
e-value: 0.34
score: 17.6
coord: 42..63
e-value: 9.9E-6
score: 35.0
coord: 157..178
e-value: 0.13
score: 20.8
IPR003409MORN motifPFAMPF02493MORNcoord: 90..111
e-value: 1.7E-5
score: 24.4
coord: 137..155
e-value: 0.011
score: 15.5
coord: 44..66
e-value: 7.8E-7
score: 28.6
coord: 159..176
e-value: 1.3E-5
score: 24.8
coord: 67..88
e-value: 1.5E-6
score: 27.7
coord: 27..43
e-value: 0.25
score: 11.3
coord: 113..130
e-value: 3.4E-5
score: 23.5