SH2 domain-containing protein

Overview
NameSH2 domain-containing protein
Smed IDSMED30011506
Length (bp)1948
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SH2 domain-containing protein (SMED30011506) t-SNE clustered cells

Violin plots show distribution of expression levels for SH2 domain-containing protein (SMED30011506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SH2 domain-containing protein (SMED30011506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SH2 domain-containing protein (SMED30011506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000006496.1 Contig48167newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000006496.1 Contig48167uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000020950.1 SMESG000006496.1 Contig39270newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000020950.1 SMESG000006496.1 Contig39270uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000006496.1 Contig47451newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011506SMESG000006496.1 Contig47451uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30011506SMESG000006496.1 dd_Smed_v6_7305_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30011506SMESG000006496.1 dd_Smed_v6_7305_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30011506SMESG000006496.1 dd_Smed_v4_7305_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SH2 domain-containing protein vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 100.908 bits (250), Expect = 2.784e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1089 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1343          
BLAST of SH2 domain-containing protein vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 100.908 bits (250), Expect = 2.838e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1154 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1408          
BLAST of SH2 domain-containing protein vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 100.908 bits (250), Expect = 3.131e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1164 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1418          
BLAST of SH2 domain-containing protein vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 100.908 bits (250), Expect = 3.138e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1057 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1311          
BLAST of SH2 domain-containing protein vs. Ensembl Human
Match: TNS2 (tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737])

HSP 1 Score: 100.523 bits (249), Expect = 3.219e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1030 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1284          
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 69.707 bits (169), Expect = 5.988e-13
Identity = 75/301 (24.92%), Postives = 128/301 (42.52%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAV---DKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGL-NSDFLSARE--VKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            L +K  G+F++R        S  G  F L LKV   P   +       ++ F IE +PKG+KL G   EPVF +L + V QH    L LP  L LP              +  P  +                      ++   T A  ++      ++++G V V+ LTG   ++ ++    +  ING      + V+ F  S  G+++ DN R +F+++   V S+++  +DP+ R   N+  L   +  +  A++F  + +       EN   VFAE   E P  +++ F+    L +
Sbjct:    2 LRDKPPGTFVVR-----DSNSFPGA-FGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAAT---------------------PEHLSATQAL-LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGD--SRAVSVH-FKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPS--SSENACHVFAELEPEQPGSAVVNFINKVMLAQ 255          
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 70.4774 bits (171), Expect = 6.738e-13
Identity = 76/307 (24.76%), Postives = 130/307 (42.35%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAV---DKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGL-NSDFLSARE--VKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+    L +K  G+F++R        S  G  F L LKV   P   +       ++ F IE +PKG+KL G   EPVF +L + V QH    L LP  L LP              +  P                     +   ++   T A  ++      ++++G V V+ LTG   ++ ++    +  ING      + V+ F  S  G+++ DN R +F+++   V S+++  +DP+ R   N+  L   +  +  A++F  + +       EN   VFAE   E P  +++ F+    L +
Sbjct:   54 EQAINMLRDKPPGTFVVR-----DSNSFPGA-FGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDP---------------------AATPEHLSATQAL-LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDS--RAVSVH-FKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPS--SSENACHVFAELEPEQPGSAVVNFINKVMLAQ 313          
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 69.707 bits (169), Expect = 2.269e-12
Identity = 76/307 (24.76%), Postives = 131/307 (42.67%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAV---DKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGL-NSDFLSARE--VKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+    L +K  G+F++R  +     S  G  F L LKV   P   +       ++ F IE +PKG+KL G   EPVF +L + V QH    L LP  L LP              +  P  +                      ++   T A  ++      ++++G V V+ LTG   ++ ++    +  ING      + V+ F  S  G+++ DN R +F+++   V S+++  +DP+ R   N+  L   +  +  A++F  + +       EN   VFAE   E P  +++ F+    L +
Sbjct:  154 EQAINMLRDKPPGTFVVRDSN-----SFPGA-FGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAAT---------------------PEHLSATQAL-LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAING--DSRAVSVH-FKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPS--SSENACHVFAELEPEQPGSAVVNFINKVMLAQ 413          
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 69.707 bits (169), Expect = 2.269e-12
Identity = 76/307 (24.76%), Postives = 131/307 (42.67%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAV---DKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGL-NSDFLSARE--VKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+    L +K  G+F++R  +     S  G  F L LKV   P   +       ++ F IE +PKG+KL G   EPVF +L + V QH    L LP  L LP              +  P  +                      ++   T A  ++      ++++G V V+ LTG   ++ ++    +  ING      + V+ F  S  G+++ DN R +F+++   V S+++  +DP+ R   N+  L   +  +  A++F  + +       EN   VFAE   E P  +++ F+    L +
Sbjct:  154 EQAINMLRDKPPGTFVVRDSN-----SFPGA-FGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAAT---------------------PEHLSATQAL-LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAING--DSRAVSVH-FKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPS--SSENACHVFAELEPEQPGSAVVNFINKVMLAQ 413          
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 70.0922 bits (170), Expect = 2.515e-12
Identity = 73/301 (24.25%), Postives = 127/301 (42.19%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAV---DKTLINGYQPKNCIEVNAFFD-SLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGL-NSDFLSARE--VKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L +K  G+F++R  +           F L LKV   P   +       ++ F IE +PKG+KL G   EPVF +L + V QH    L LP  L LP              +  P                     +   ++   T A  ++      ++++G V V+ LTG   ++ ++    +  ING    +   V+  F  S  G+++ DN R +F+++   V S+++  +DP+ R   N+  L   +  +  A++F  + +       EN   VFAE   E P  +++ F+
Sbjct:  307 EQAINMLRDKPPGTFVVRDSNSFP------GAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDP---------------------AATPEHLSATQAL-LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAING----DSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPS--SSENACHVFAELEPEQPGSAVVNFI 559          
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 100.138 bits (248), Expect = 1.758e-21
Identity = 77/293 (26.28%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKE------FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L ++D G+F+IR     +        + L +KV   P       +   +         IET+PKG++L G   EP F  L + V QH   PL LPC L +P     +           P ++ P N        +         + +   +A          +L++  V ++ LTG  AI  A+ +T+     P     +  F  S  GI++ DN+R LF+++  P+G++ +CD+DP  R  N       E   AK FG + +K+     +N   +FAE   + P  +I+ FV
Sbjct:  457 LKDQDPGAFVIRDSHSFR------GAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEE---------SPEIATPTN------PAADMLKQGAGQKSSADGHA--------CNVLYINSVDMESLTGPQAIAKAISETM--NASPAPSATIVHFKVSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKP-----EGGTAKFFGFVARKQGSTT-DNVSHLFAEMDPDQPATAIVNFV 712          
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Match: tns3.2 (tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-081031-95])

HSP 1 Score: 95.5153 bits (236), Expect = 6.640e-20
Identity = 82/301 (27.24%), Postives = 128/301 (42.52%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSE--------CKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L +K+ GSFIIR             K+ +    + +   KV D     ++   +F     IE  PKG++L G   EP F +L + V QH   PL LPC L +P     +                 FN                 +Q +  + A+ ++      + FLG V ++ LTG+  ++ A   T+     P     V  F  S  GI++ DN+R LF+++   V ++++C +DP  R    D  +A     AKIFG + +K      EN   +FAE   E P  +I+ FV
Sbjct:  590 EQAISVLKDKEPGSFIIRDSHSFRGAYGLAMKVATPPPTVLQTSRKVGD---LSNELVRHF----LIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLIIPSRDPLEE----------------FN--------------ESPTQTSTNSAAELLKQGAACNVWFLGSVDLESLTGVQGVQKAT--TVTFNKDPPPTSTVVHFKVSAQGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKWKRDGCTA-----AKIFGFIARKSGSST-ENVCHLFAEHDPEQPASAIVNFV 845          
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 95.9005 bits (237), Expect = 7.174e-20
Identity = 80/293 (27.30%), Postives = 124/293 (42.32%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYD------DCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L ++D G+F+IR        S  G  + L +KV   P          D          IET+PKG++L G   EP F  L + V QH   PL LPC L +P     +           P ++ P N                         A  ++      +L++  V ++ LTG  AI  A+ +T+     P     +  F  S  GI++ DN+R LF+++  P+G++ +CD+DP  R  N       E   AK FG + +K+     +N   +FAE   + P  +I+ FV
Sbjct: 1451 LKDQDPGAFVIR-----DSHSFRGA-YGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEE---------SPEIATPTN-----------------------PAADMLKQGAACNVLYINSVDMESLTGPQAIAKAISETM--NASPAPSATIVHFKVSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKP-----EGGTAKFFGFVARKQGS-TTDNVSHLFAEMDPDQPATAIVNFV 1697          
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Match: tns2a (tensin 2a [Source:ZFIN;Acc:ZDB-GENE-090312-163])

HSP 1 Score: 86.6557 bits (213), Expect = 4.747e-17
Identity = 79/304 (25.99%), Postives = 125/304 (41.12%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYP------ACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            E+   +L  ++ G+F+IR  +    Q   G    L LKV   P      +   D  E       IET P+G+K+ G   EP F +L + V QH   P+ LPC L++P+                     P   + +    S            ++T A  ++      +L+L  V  + LTG  AI  A   TL     P+    V  F  S  GI++ D++R +F+++  P+ S+ Y  +DP  R               ++FG +  KK   + EN   +FAE   E P  +I+ F+    L
Sbjct: 1335 EQAIAALKEREPGAFLIRDSNS--FQGAYG----LALKVASPPPNVNNHSSKGDPLEQLVRHFLIETGPRGVKIKGCQNEPYFGSLSALVYQHSITPISLPCALRIPEKD-------------------PIGDVVEVQPVS-----------NMSTAADLLKQGAACNVLYLNSVETESLTGPQAIAKATGATL--SRSPRPSATVVHFKVSAQGITLTDSQRRVFFRRHYPINSVTYSSIDPQDR---------------RVFGFV-AKKPGSVAENVCHLFAELDPEQPATAIVNFINKVML 1584          
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Match: tns2b (tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5])

HSP 1 Score: 82.4185 bits (202), Expect = 5.791e-16
Identity = 73/298 (24.50%), Postives = 118/298 (39.60%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKE------FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            L +K+ G F+IR  +  +        + L LKV   PA  +   E  S +E       IE+  KG+K+ G   E  F +L + V QH   P+ LPC L++P   +                                           +T A  ++      +L+L  V  + LTG  A+      TL    +P+    V  F  S  GI++ DN+R LF+++  P+ S+ +  VDPL               + ++FG + ++   L   N   +FAE   E P  +I+ F+    L
Sbjct:  287 LKDKEAGCFLIRDSNSFQ------GAYGLALKVSTAPAHTNSHTEPGSAQEQLVRHFLIESGAKGVKIKGCQNETYFGSLSALVYQHSITPVSLPCVLRIPDRDLVGELQDLQSGT------------------------------NTSTAADLLKQGAACNVLYLNSVETESLTGPQAVSKTTKCTLTQ--EPRPSPTVVHFKVSTQGITLTDNQRRLFFRRHYPIHSVTFSSVDPL---------------DQRMFGFVARRSGAL--GNVCHLFAELDPEQPATAIVNFINKVML 529          
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Match: epb41l1 (erythrocyte membrane protein band 4.1-like 1 [Source:Xenbase;Acc:XB-GENE-877327])

HSP 1 Score: 99.3673 bits (246), Expect = 7.450e-21
Identity = 81/293 (27.65%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L   + GSF+IR  +  +        + L LKV   P          D  E       IET PKG+K+ G  IEP F +L + V QH   PL LPC L++P   + + S           + +P N+                     +T A  ++      +L+LG V  + LTG  AI  A +  L     P++      F  S  GI++ D++R LF+++  PV S+ +C+ DP  R   +      +   +K+FG + +K      EN   +FAE   E P  +I+ F+
Sbjct:  982 LRGAEPGSFLIRDSNSFR------GAYGLALKVASPPPNVAAQPYKGDSTEQLVRHFLIETGPKGVKIKGSPIEPHFGSLSALVSQHSVTPLSLPCRLQIPSRDLIEQSS---------EVMVPTNM---------------------STAADLLRQGAACSVLYLGSVDTESLTGPQAISRASNAILT---PPRSSATTVHFKVSDQGITLTDSQRKLFFRRHYPVSSVTFCNSDPQDRRWTNP-----DRTTSKVFGFVARKAGT-AAENVCHLFAELDPEQPASAIVNFI 1229          
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Match: epb41l1 (erythrocyte membrane protein band 4.1-like 1 [Source:Xenbase;Acc:XB-GENE-877327])

HSP 1 Score: 98.5969 bits (244), Expect = 1.246e-20
Identity = 81/293 (27.65%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L   + GSF+IR  +  +        + L LKV   P          D  E       IET PKG+K+ G  IEP F +L + V QH   PL LPC L++P   + + S           + +P N+                     +T A  ++      +L+LG V  + LTG  AI  A +  L     P++      F  S  GI++ D++R LF+++  PV S+ +C+ DP  R   +      +   +K+FG + +K      EN   +FAE   E P  +I+ F+
Sbjct:  799 LRGAEPGSFLIRDSNSFR------GAYGLALKVASPPPNVAAQPYKGDSTEQLVRHFLIETGPKGVKIKGSPIEPHFGSLSALVSQHSVTPLSLPCRLQIPSRDLIEQSS---------EVMVPTNM---------------------STAADLLRQGAACSVLYLGSVDTESLTGPQAISRASNAILT---PPRSSATTVHFKVSDQGITLTDSQRKLFFRRHYPVSSVTFCNSDPQDRRWTNP-----DRTTSKVFGFVARKAGT-AAENVCHLFAELDPEQPASAIVNFI 1046          
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Match: epb41l1 (erythrocyte membrane protein band 4.1-like 1 [Source:Xenbase;Acc:XB-GENE-877327])

HSP 1 Score: 97.4413 bits (241), Expect = 2.792e-20
Identity = 81/293 (27.65%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L   + GSF+IR  +  +        + L LKV   P          D  E       IET PKG+K+ G  IEP F +L + V QH   PL LPC L++P   + + S           + +P N+                     +T A  ++      +L+LG V  + LTG  AI  A +  L     P++      F  S  GI++ D++R LF+++  PV S+ +C+ DP  R   +      +   +K+FG + +K      EN   +FAE   E P  +I+ F+
Sbjct:  677 LRGAEPGSFLIRDSNSFR------GAYGLALKVASPPPNVAAQPYKGDSTEQLVRHFLIETGPKGVKIKGSPIEPHFGSLSALVSQHSVTPLSLPCRLQIPSRDLIEQSS---------EVMVPTNM---------------------STAADLLRQGAACSVLYLGSVDTESLTGPQAISRASNAILT---PPRSSATTVHFKVSDQGITLTDSQRKLFFRRHYPVSSVTFCNSDPQDRRWTNP-----DRTTSKVFGFVARKAGT-AAENVCHLFAELDPEQPASAIVNFI 924          
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 89.3521 bits (220), Expect = 1.058e-17
Identity = 79/298 (26.51%), Postives = 125/298 (41.95%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPAC-----------YDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +K+ GSFI+R     K        + L +KV   P              ++   +F     IE   KG++L G   EP F +L + V QH   PL LPC L +P              +  P   +P                +   Q    + A+ ++      + +L  V ++ LTG  A++ A+  T +   +P     V  F  S  GI++ DN+R LF+++  PV ++++C +DP  R    D LS      AK+FG +   +K     N   +FAE   E P  +I+ FV
Sbjct: 1046 LKDKEPGSFIVRDSHSFK------GAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHF----LIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIP--------------DKDPLEEIP----------------AATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQ--EPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS------AKVFGFV--ARKGAGNHNICHLFAEHDPEQPASAIVNFV 1293          
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 89.3521 bits (220), Expect = 1.101e-17
Identity = 79/298 (26.51%), Postives = 125/298 (41.95%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY-----------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +K+ GSFI+R     K        + L +KV   P              ++   +F     IE   KG++L G   EP F +L + V QH   PL LPC L +P              +  P   +P                +   Q    + A+ ++      + +L  V ++ LTG  A++ A+  T +   +P     V  F  S  GI++ DN+R LF+++  PV ++++C +DP  R    D LS      AK+FG +   +K     N   +FAE   E P  +I+ FV
Sbjct: 1035 LKDKEPGSFIVRDSHSFK------GAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHF----LIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIP--------------DKDPLEEIP----------------AATPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQ--EPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS------AKVFGFV--ARKGAGNHNICHLFAEHDPEQPASAIVNFV 1282          
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Match: Tns2 (tensin 2 [Source:MGI Symbol;Acc:MGI:2387586])

HSP 1 Score: 99.3673 bits (246), Expect = 5.405e-21
Identity = 81/296 (27.36%), Postives = 122/296 (41.22%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P     +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1145 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAAL--SCSPVPVPAIVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGAT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLLGQR 1399          
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Match: Tns2 (tensin 2 [Source:MGI Symbol;Acc:MGI:2387586])

HSP 1 Score: 99.3673 bits (246), Expect = 6.209e-21
Identity = 81/296 (27.36%), Postives = 122/296 (41.22%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P     +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1145 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAAL--SCSPVPVPAIVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGAT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLLGQR 1399          
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Match: Tns2 (tensin 2 [Source:MGI Symbol;Acc:MGI:2387586])

HSP 1 Score: 99.3673 bits (246), Expect = 6.330e-21
Identity = 81/296 (27.36%), Postives = 122/296 (41.22%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P     +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1152 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAAL--SCSPVPVPAIVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGAT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLLGQR 1406          
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Match: Tns2 (tensin 2 [Source:MGI Symbol;Acc:MGI:2387586])

HSP 1 Score: 98.9821 bits (245), Expect = 6.994e-21
Identity = 81/296 (27.36%), Postives = 122/296 (41.22%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P     +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1137 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAAL--SCSPVPVPAIVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGAT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLLGQR 1391          
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 93.9745 bits (232), Expect = 1.380e-19
Identity = 80/295 (27.12%), Postives = 126/295 (42.71%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPAC-------YDDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +++ G+FIIR     +        + L +KV   P          D  +E   ++ F IET P+G+KL G   EP F +L + V QH  IPL LPC L +P    +  S            S P N  +                         ++      +LF+  V ++ LTG  AI  A  +TL     P     +  F  S  GI++ DN+R LF+++  P+ ++ +CD+DP  R     ++       AK+FG + +K+     +N   +FAE     P  +I+ FV
Sbjct:  366 LKDQEPGAFIIRDSHSFR------GAYGLAMKVSSPPPTITQQGKKGDMTHEL--VRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDS---------SGPANSTTDL-----------------------LKQGAACNVLFVNSVDMESLTGPQAISKATSETLA--ADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQER----KWMKTEGGAPAKLFGFVARKQGSTT-DNACHLFAELDPNQPASAIVNFV 613          
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q63HR2|TNS2_HUMAN (Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 1.363e-20
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1154 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1408          
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CGB6|TNS2_MOUSE (Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.781e-20
Identity = 81/296 (27.36%), Postives = 122/296 (41.22%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   P+ LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P     +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1145 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEET---------PEAPVPTNM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAAL--SCSPVPVPAIVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGAT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLLGQR 1399          
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68CZ2|TENS3_HUMAN (Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 4.564e-18
Identity = 81/301 (26.91%), Postives = 131/301 (43.52%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSE--------CKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L +K+ GSFI+R             K+ +    + +L  K  D     ++   +F     IE  PKG++L G   EP F +L + V QH   PL LPC L +P+                     P   I++              Q    + A+ ++      + +L  V ++ LTG  AI+ A+  TL+   +P     V  F  S  GI++ DN+R LF+++  PV S+++C +DP  R    D  S      +K+FG + +K+     +N   +FAE   E P  +I+ FV
Sbjct: 1180 EQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLA---NELVRHF----LIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERD-------------------PLEEIAESSP-----------QTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQ--EPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKWIKDGPS------SKVFGFVARKQGS-ATDNVCHLFAEHDPEQPASAIVNFV 1434          
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HBL0|TENS1_HUMAN (Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.461e-17
Identity = 85/306 (27.78%), Postives = 131/306 (42.81%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY-------DDCYEYFSLKEF-IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            E+    L +++ G+FIIR        S  G  + L +KV   P          D  +E   ++ F IET P+G+KL G   EP F +L + V QH  IPL LPC L +P    +  S            S P N                       + A  ++      +LF+  V ++ LTG  AI  A  +TL     P     +  F  S  GI++ DN+R LF+++  P+ ++ +CD+DP  R     ++       AK+FG + +K+     +N   +FAE     P  +I+ FV    L
Sbjct: 1471 EQAIALLKDQEPGAFIIR-----DSHSFRGA-YGLAMKVSSPPPTIMQQNKKGDMTHEL--VRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDS---------SGPAN-----------------------STADLLKQGAACNVLFVNSVDMESLTGPQAISKATSETL--AADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQER----KWMKTEGGAPAKLFGFVARKQGS-TTDNACHLFAELDPNQPASAIVNFVSKVML 1729          
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SSZ5|TENS3_MOUSE (Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.202e-17
Identity = 82/300 (27.33%), Postives = 126/300 (42.00%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY-------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L +K  GSFI+R        S  G  + L +KV   P           D          IE  PKG++L G   EP F +L + V QH   PL LPC L +P+                P   +  N                  Q    + A+ ++      + +L  V ++ LTG  A++ A+  TL+   +P     V  F  S  GI++ DN+R LF+++  PV S+++C +DP  R    D  S      +K+FG + +K+     +N   +FAE   E P  +I+ FV
Sbjct: 1175 EQAIAMLKDKAPGSFIVR-----DSHSFRGA-YGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPER--------------DPLEEIAEN----------------SPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQ--EPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDRKWIKDGPS------SKVFGFVARKQGS-ATDNVCHLFAEHDPEQPASAIVNFV 1429          
BLAST of SH2 domain-containing protein vs. TrEMBL
Match: S7MY45 (Tensin-like C1 domain-containing phosphatase OS=Myotis brandtii OX=109478 GN=D623_10023013 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 9.852e-20
Identity = 84/296 (28.38%), Postives = 125/296 (42.23%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   PL LPCCL++P     + +         P + +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L  G  P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1109 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPLEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEET---------PEIPVPANM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--GCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1363          
BLAST of SH2 domain-containing protein vs. TrEMBL
Match: L5MA98 (Tensin-like C1 domain-containing phosphatase OS=Myotis davidii OX=225400 GN=MDA_GLEAN10015465 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.098e-19
Identity = 84/296 (28.38%), Postives = 125/296 (42.23%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++            D  E       IET PKG+K+ G   EP F +L + V QH   PL LPCCL++P     + +         P + +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L  G  P+    V  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1150 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPWKGDPLEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEET---------PEIPVPANM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--GCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1404          
BLAST of SH2 domain-containing protein vs. TrEMBL
Match: A0A2U3WCS7 (tensin-2 OS=Odobenus rosmarus divergens OX=9708 GN=TNS2 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.158e-19
Identity = 84/296 (28.38%), Postives = 124/296 (41.89%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD GSF+IR       Q   G+  ++         C  D  E       IET PKG+K+ G   EP F +L + V QH   PL LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1153 LKDKDPGSFLIRDSH--SFQGAYGLALKVATPPPSAQPCKGDPLEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPNKDPLEET---------PEAPVPANM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAIIHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWANPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1407          
BLAST of SH2 domain-containing protein vs. TrEMBL
Match: A0A183ILL2 (PID domain-containing protein OS=Soboliphyme baturini OX=241478 GN=SBAD_LOCUS4508 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.033e-19
Identity = 73/245 (29.80%), Postives = 109/245 (44.49%), Query Frame = 2
Query: 1181 FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPK-NCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
             IET  KG+KL G   EPVF +L + V QH   PL LPC L LP                      P + +                   +T+    ++      +++L  +  + LTG  A+R  VD+ L+   Q K + + V+    SL GI++ DN R LF+++   V S+ YCD+DP HR       SA   + A+IFG +  +K +    N   VFAE   + P  +I+ FV    +  N
Sbjct:   39 LIETTSKGVKLKGCSNEPVFGSLAALVYQHSITPLALPCKLILPDYD-------------------PVSAVE-----------------NITSGQALLEQGAACNVIYLYSLDTECLTGREALRRTVDEALLLASQKKLDPVSVHFKVSSL-GITVTDNTRKLFFRRHYAVNSVTYCDIDPEHRS-----WSATGTRTAEIFGFI-ARKSVSTPGNACHVFAELEPKQPATAIVNFVTKVMMAPN 240          
BLAST of SH2 domain-containing protein vs. TrEMBL
Match: A0A3Q7PY93 (tensin-2 OS=Callorhinus ursinus OX=34884 GN=TNS2 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.425e-19
Identity = 83/296 (28.04%), Postives = 124/296 (41.89%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKN 1912
            L +KD G+F+IR       Q   G+  ++         C  D  E       IET PKG+K+ G   EP F +L + V QH   PL LPCCL++P     + +         P   +P N+                     +T A  ++      +L+L  V  + LTG  A+  A    L     P+    +  F  S  GI++ DN+R LF+++  PV SI +   DP   R  N D  +      +KIFG +  KK     EN   +FAE   + P  +I+ F+    L + 
Sbjct: 1153 LKDKDPGAFLIRDSH--SFQGAYGLALKVATPPPSAQPCKGDPLEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPNKDPLEET---------PEAPVPANM---------------------STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAAL--SCSPRPTPAIIHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWANPDGTT------SKIFGFV-AKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQR 1407          
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036434.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001063.1:374077:386605:1 gene:ENSAMXG00000039082.1 transcript:ENSAMXT00000036434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 9.235e-19
Identity = 68/236 (28.81%), Postives = 104/236 (44.07%), Query Frame = 2
Query: 1181 FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
             IE  PKG++L G   EP F +L + V QH   PL LPC L +P             + L+  +  P                   SQ    + A+ ++      + FLG V ++ LTG  A++ A    L     P     V  F  S  GI++ DN+R LF+++   V ++++C +DP  R    D   +     AKIFG + +K    + +N   +FAE   E P  +I+ FV
Sbjct:   29 LIECTPKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLIIPDR-----------DPLEDAVETP-------------------SQSITNSAAELLKQGAACNVWFLGSVEMESLTGFQAVQKATSDVLSLEAPPTPT--VVHFKVSSQGITLTDNQRKLFFRRHYAVNTVIFCALDPQERKWKRDGYPS-----AKIFGFVARKTGTAM-DNVCHLFAEHDPEQPASAIVNFV 226          
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:103027377])

HSP 1 Score: 89.7373 bits (221), Expect = 4.233e-18
Identity = 83/301 (27.57%), Postives = 128/301 (42.52%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSE--------CKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L +K+ GSFI+R             K+ +    I +   KV D     ++   +F     IE   KG++L G   EP F +L + V QH   PL LPC L +P                 P   L                +  + Q +  +  + ++      + FLG V ++ LTG+ AI+ A   T+I G  P     +  F  S  GI++ DN+R LF+++   V ++++C +DP  R    D   A     AKIFG + +K      EN   +FAE   E P  +I+ FV
Sbjct:  933 EQAITVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSILQQSKKVGDLT---NELVRHF----LIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPSR--------------DPLEDL----------------TESQQQTSTNSATELLKQGAACNVWFLGSVELESLTGVQAIQKA--STVILGQNPPATSTIVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCALDPQDRRWTKDGCLA-----AKIFGFVARKSGS-STENVCHLFAEHDPEQPASAIVNFV 1188          
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 89.3521 bits (220), Expect = 6.453e-18
Identity = 80/298 (26.85%), Postives = 124/298 (41.61%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYP-----ACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            E+    L  ++ G+FIIR        S  G  + L +KV   P     A   D          IET+PKG+KL G   EP F  L + V QH   PL LPC L +P     +           P ++ P N                          + ++      +L++  V ++ LTG  A+  A+ +T+     P        F  S  GI++ DN+R LF+++  P+ ++ +CD+DP  R  N       E   AK FG + +K+     +N   +FAE   + P  +I+ FV
Sbjct: 1449 EQAINILKEREPGAFIIR-----DSHSFRGA-YGLAMKVSSPPPTAQQAKKGDITNELVRHFLIETSPKGVKLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTKDPHEEV---------PEVATPVN-----------------------PATELLKQGAACNVLYINSVDMESLTGPQAVAKAISETM--AASPMPTATTVHFKVSSQGITLTDNQRKLFFRRHYPISTVTFCDLDPQERKWNK-----AEGGTAKFFGFVARKQGS-TTDNVSHLFAEMDPDQPATAIVNFV 1700          
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Match: tns2a (tensin 2 [Source:NCBI gene;Acc:103022390])

HSP 1 Score: 85.5001 bits (210), Expect = 9.812e-17
Identity = 78/305 (25.57%), Postives = 125/305 (40.98%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYD-------DCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            E+   +L  K+ G+F+IR  +    Q   G    L LKV   P   +       D  E       IET P+G+K+ G   EP F +L + V QH   P+ LPC L+LP    +    +    +                               ++T A  ++      +L+L  V  + LTG  AI  AV  T++    P+    V  F  S  GI++ D++R +F+++  P+ S+ +  +DP  R               ++FG +  KK   + EN   +FAE   E P  +I+ F+    L
Sbjct: 1423 EQAIVALKEKEPGAFLIRDSNS--FQGAYG----LALKVATPPPNANNHSGKGGDPQEQLVRHFLIETGPRGVKIKGCQNEPHFGSLSALVYQHSITPISLPCALRLPDKDPTGEMQEVQVAS------------------------------NMSTAADLLKQGAACNVLYLNSVETESLTGPQAIAKAVGATVVR--SPRPSATVVHFKVSAQGITLTDSQRRVFFRRHYPINSVTFSSLDPQDR---------------RVFGFV-AKKPGSVAENVCHLFAELDPEQPATAIVNFINKVML 1673          
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Match: tns2a (tensin 2 [Source:NCBI gene;Acc:103022390])

HSP 1 Score: 85.5001 bits (210), Expect = 9.918e-17
Identity = 78/305 (25.57%), Postives = 125/305 (40.98%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYD-------DCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            E+   +L  K+ G+F+IR  +    Q   G    L LKV   P   +       D  E       IET P+G+K+ G   EP F +L + V QH   P+ LPC L+LP    +    +    +                               ++T A  ++      +L+L  V  + LTG  AI  AV  T++    P+    V  F  S  GI++ D++R +F+++  P+ S+ +  +DP  R               ++FG +  KK   + EN   +FAE   E P  +I+ F+    L
Sbjct: 1437 EQAIVALKEKEPGAFLIRDSNS--FQGAYG----LALKVATPPPNANNHSGKGGDPQEQLVRHFLIETGPRGVKIKGCQNEPHFGSLSALVYQHSITPISLPCALRLPDKDPTGEMQEVQVAS------------------------------NMSTAADLLKQGAACNVLYLNSVETESLTGPQAIAKAVGATVVR--SPRPSATVVHFKVSAQGITLTDSQRRVFFRRHYPINSVTFSSLDPQDR---------------RVFGFV-AKKPGSVAENVCHLFAELDPEQPATAIVNFINKVML 1687          
BLAST of SH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003653.1 (pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-1 gene:ENSPMAG00000003337.1 transcript:ENSPMAT00000003653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 6.218e-22
Identity = 79/297 (26.60%), Postives = 124/297 (41.75%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEF-----IETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL 1903
            L  +D G+F+IR  S  +        + L LKV   P    D  +     E      IE+ PKG++L G   EPVF +L + V QH   PL LPC L +P+                     P +                    +V + ++ ++      +LFLG V ++ LTG  AI  A  + L    +P+       F  S  GI++ DN+R +      PV ++ +C+VDP  R     ++ A     +++FG +  +K     +N   +FAE   E P  +I+ FV    L
Sbjct:  547 LKGRDPGAFVIRDSSSFR------GAYGLALKVATPPGPSLDSKKGDPASELVRHFLIESTPKGVRLKGCSNEPVFGSLSALVYQHSITPLALPCKLLVPEHD-------------------PLDT------------------SSVNSASELLKQGAACNVLFLGSVEMESLTGPQAIGKATAEILD--MKPRPVATTVHFKVSAQGITLTDNQRSILPPTHNPVSTVTFCNVDPETR----TWVQAEGTPGSRVFGFV-ARKPGSSSDNLCHLFAELDPEQPAAAIVNFVSKVLL 793          
BLAST of SH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005743.1 (pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1 gene:ENSPMAG00000005205.1 transcript:ENSPMAT00000005743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 9.553e-20
Identity = 82/293 (27.99%), Postives = 122/293 (41.64%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L + + GSFIIR        S  G  + L +KV   P          D          IE+ PKG++L G   EP F +L + V QH   PL LPC L +P     + S   S                                 T  + ++ ++      +LFLG V ++ LTG  AI  AV + L           V+ F  S  GI++ DN+R LF+++  P  ++ +CD+DP  R   ++        +A IFG +  KK+    +N   +FAE   E P  +I+ FV
Sbjct:    5 LKDSEPGSFIIR-----DSHSFRGA-YGLAVKVAMPPPSVLQQTKKGDLANELVRHYLIESTPKGVRLKGCPNEPFFGSLSALVYQHSITPLALPCQLIIPDKDPMECSETDSSE-----------------------------ANTANSASELLKQGAACNVLFLGSVEMESLTGPQAIAKAVGEVLEASAATPAATAVH-FKVSAQGITLTDNQRKLFFRRHYPSITVTFCDLDPQERKWQNN-----GSNSANIFGFV-AKKQASTTDNLCHLFAELEPEQPAGAIVNFV 255          
BLAST of SH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 91.2781 bits (225), Expect = 2.986e-19
Identity = 86/296 (29.05%), Postives = 129/296 (43.58%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY-------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNA--ELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +K+ GSF+IR        S  G  + L +KV   P           D          IE   KG++L G   EP F +L + V QH   PL LPC + +P     + S   S        S P N                         A P   K  A   +L+LG V ++ LTG  A+  AV + L +G  P +  +V+ F  S  G+++ DN+R LF+++  P  ++ YCD DP +R    D  S+     A IFG +  KK+  + +N+  +FAE   + P  +I+ F+
Sbjct: 1417 LKDKEPGSFVIR-----DSHSFRGA-YGLAMKVSSPPPNIPQQGKKKGDVSSELVRHYLIECTSKGVRLKGCPNEPYFGSLSALVYQHSITPLALPCKIVIPHEDPLEHSEVDSIQ------SHPVN-------------------------ATPELLKQGAACNVLYLGSVEMESLTGPQAVAKAVGQAL-SGSAPPSPTQVH-FKVSQQGVTLTDNQRKLFFRRHYPADTVTYCDQDPQNRKWKKDSGSS-----ANIFGFV-AKKQGSVTDNQCHLFAELDPKQPASAIVSFI 1667          
BLAST of SH2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001958.1 (pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 gene:ENSPMAG00000001775.1 transcript:ENSPMAT00000001958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.177e-9
Identity = 72/289 (24.91%), Postives = 115/289 (39.79%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPA---------CYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNC-IEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAE 1846
            E+    L  ++ G+F+IR  S           F L +KV + P            D+   +F     IET  +G++L G   EP F +L + V QH   PL LP CL+LP      +      + L                               T  ++P +A   A   FL  V ++ LTG  A+  A   ++I G   ++  I V+       GI++ D  R  F+++  P  SI +C + P      + +  A +   AK+FG + +K    +  N   +FAE
Sbjct:   19 EQAVTLLCPREAGAFVIRNSSSFHGD------FGLAMKVENLPPGVPVQAGRDTVDELVRHF----LIETKAQGVRLKGCPNEPFFGSLSALVNQHTVTPLALPGCLRLPDRDFDLTKAHDLCDALT---------------------------GGSTGSSQPPEAVGTA--FFLDSVEMESLTGPQAVARAT--SVIMGMATRSMPIHVHLRVTG-QGITLTDIYRKRFFRRHYPAESISFCAMVP----DVTRWPMAEDKPAAKMFGFVARKAGS-VSHNVCHLFAE 260          
BLAST of SH2 domain-containing protein vs. Ensembl Nematostella
Match: EDO45783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM1])

HSP 1 Score: 71.2478 bits (173), Expect = 1.275e-13
Identity = 63/241 (26.14%), Postives = 105/241 (43.57%), Query Frame = 2
Query: 1181 FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPR--LSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNH 1897
             IE+  KG+KL G   EPVF +L +FV QH   PL LP  L +P                 PR   SL F                    Y V      +   L  +++F+G+  V+ L+G  A++  V+  L     P+      +F  +  G++I D ER +F++K  P+ SI++C +DPL +    D         ++ FG++   ++I    N   +FAE   +  + +++  V  +
Sbjct:   70 LIESTKKGVKLKGCDNEPVFGSLAAFVFQHTITPLSLPLRLVIPN------------EGTWPRRCFSLTF-------------------MYAVNV----VSFFLAMKVMFVGESNVEMLSGSTAVQRTVEDLLKYKATPR--FTPASFKVTREGVTITDLERKVFFRKHFPMTSILHCGIDPLDQ--RWDLHLPDYTGKSRTFGMVV--RRIGEAGNDCHLFAEVDDDHSVNTVINLVNKY 269          
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Match: tns2a (tensin 2 [Source:NCBI gene;Acc:101156086])

HSP 1 Score: 97.8265 bits (242), Expect = 1.448e-20
Identity = 86/306 (28.10%), Postives = 137/306 (44.77%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKV-VDYPACYD----DCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPL-HRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L  ++ G+F+IR  +    Q   G    L LKV V  P+ ++    D  E       IET P+G+K+ G   EP F +L + V QH   P+ LPC L++P+  +     +       P +S                         ++T A  ++      +L+L  V  + LTG  AI  A + TL  G QP+    V  F  +  GI++ D++R +F+++  PV S+ +  VDP  HR  N D  + R      +FG + +K   L  EN   +FAE   E P  +I+ F+    L +
Sbjct: 1428 EQAIAALKEREPGTFLIRDSNS--FQGAYG----LALKVAVPPPSVHNNKGGDPLEQLVRHFLIETGPRGVKIKGCQNEPYFGSLSALVYQHSITPISLPCALQIPEKDLLGEVQEA------PPVS------------------------NISTAADLLKQGAACNVLYLNSVETESLTGPQAIAKATEATL--GRQPRPAATVVQFKVTSQGITLTDSQRRVFFRRHYPVNSVTFSSVDPKDHRWTNPDNTTVR------VFGFVAKKPGSL-AENVCHLFAELDPEQPACAIVNFINKVMLAQ 1688          
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Match: tns2a (tensin 2 [Source:NCBI gene;Acc:101156086])

HSP 1 Score: 93.2041 bits (230), Expect = 3.590e-19
Identity = 82/305 (26.89%), Postives = 134/305 (43.93%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKV-VDYPACYD----DCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L  ++ G+F+IR  +    Q   G    L LKV V  P+ ++    D  E       IET P+G+K+ G   EP F +L + V QH   P+ LPC L++P+  +     +       P +S                         ++T A  ++      +L+L  V  + LTG  AI  A + TL  G QP+    V  F  +  GI++ D++R +F+++  PV S+ +  VDP               K+ ++FG + +K   L  EN   +FAE   E P  +I+ F+    L +
Sbjct: 1428 EQAIAALKEREPGTFLIRDSNS--FQGAYG----LALKVAVPPPSVHNNKGGDPLEQLVRHFLIETGPRGVKIKGCQNEPYFGSLSALVYQHSITPISLPCALQIPEKDLLGEVQEA------PPVS------------------------NISTAADLLKQGAACNVLYLNSVETESLTGPQAIAKATEATL--GRQPRPAATVVQFKVTSQGITLTDSQRRVFFRRHYPVNSVTFSSVDP---------------KDHRVFGFVAKKPGSL-AENVCHLFAELDPEQPACAIVNFINKVMLAQ 1678          
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002849.2 (pep primary_assembly:ASM223467v1:2:14075704:14085025:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 4.864e-18
Identity = 72/293 (24.57%), Postives = 124/293 (42.32%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKE------FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +++ G+F+IR     +        + L +KV   P       +   L         IET+PKG++L G   EP F  L + V QH   PL LPC L +P             N     L+ P + + +                        ++ +    +L++  V ++ LTG  AI  A+ +TL     P        F  +  GI++ D++R +F+++  P+ +I YCD+DP +R    +   +      K+FG + +K+     +N   +FAE   + P  +I+ FV
Sbjct:  423 LKDREPGAFVIRDSHSFR------GAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIP---------TKDPNEEALELATPTDPVVEL-----------------------LKQEAACNVLYINSVDMESLTGPQAIAKAISQTLAT--SPLPAATTVHFKVTTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWGKEGGGS-----VKLFGFVARKQGSTT-DNASHLFAELDPDQPASAIVSFV 669          
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002851.2 (pep primary_assembly:ASM223467v1:2:14075704:14087112:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002851.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 7.218e-18
Identity = 72/293 (24.57%), Postives = 124/293 (42.32%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKE------FIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +++ G+F+IR     +        + L +KV   P       +   L         IET+PKG++L G   EP F  L + V QH   PL LPC L +P             N     L+ P + + +                        ++ +    +L++  V ++ LTG  AI  A+ +TL     P        F  +  GI++ D++R +F+++  P+ +I YCD+DP +R    +   +      K+FG + +K+     +N   +FAE   + P  +I+ FV
Sbjct:  729 LKDREPGAFVIRDSHSFR------GAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIP---------TKDPNEEALELATPTDPVVEL-----------------------LKQEAACNVLYINSVDMESLTGPQAIAKAISQTLAT--SPLPAATTVHFKVTTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWGKEGGGS-----VKLFGFVARKQGSTT-DNASHLFAELDPDQPASAIVSFV 975          
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 88.9669 bits (219), Expect = 7.440e-18
Identity = 85/294 (28.91%), Postives = 123/294 (41.84%), Query Frame = 2
Query: 1028 LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACY-------DDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFV 1888
            L +K+ GSFI+R        S  G  + L +KV   P           D          IE  PKG++L G   EP F +L + V QH   PL LPC L LP              +  P   L                S   +Q    + A  ++      + +LG V ++ LTG  A++ A   TL     P +   V  F  S  GI++ DN+R LF+++   V ++++C +DP  R    D  S      AKIFG + +K +    EN   +FAE   E P  +I+ FV
Sbjct:  918 LKDKEPGSFIVR-----DSHSFRGA-YGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILP--------------DRDPVEEL----------------SDSPAQTATNSAADLLKQGAACNVWYLGSVELESLTGHQAVQKATTVTLTMDPPPPST--VVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWTRDSGS-----TAKIFGFVARKSQS-DTENMCHLFAEHDPEQPASAIVNFV 1167          
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000006496.1 (SMESG000006496.1)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 604/605 (99.83%), Postives = 604/605 (99.83%), Query Frame = 2
Query:  104 MSDNGYDNVELNEIINDLKNVANKNSISKNDTRITFQYSNPTRDCRINQDPHSLVNTNPSVTNKVESSSRDQKIILCEPKRNNSQIKLPNSDVDTLQKELSMVKKELAILKRSHSLAGHPIFGENMSDTKTRNYYKQNMDINSNLYPNSGTASSSVTHKKFGASNFAQNNFSSVSNIAYQSQSPSNFQYQSLTRLSAPLTYSAHRENVEKTRQISKTCNLGTRPKNMENYYEDTEDITIQPIGKGIQXXXXXXXXXXKNNHFYNDSMSTVDPMSTICSQSHFDEMXXXXXXXXXXXXXXXXXEECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKNVF 1918
            MSDNGYDNVELNEIINDLKNVANKNSISKNDTRITFQYSNPTRDCRINQDPHSLVNTNPSVTNKVESSSRDQKIILCEPKRNNSQIKLPNSDVDTLQKELSMVKKELAILKRSHSLAGHPIFGENMSDTKTRNYYKQNMDINSNLYPNSGTASSSVTHKKFGASNFAQNNFSSVSNIAYQSQSPSNFQYQSLTRLSAPLTYSAHRENVEKTRQISKTCNLGTRPKNMENYYEDTEDITIQPIGKGIQTLTSSLSSLSKNNHFYNDSMSTVDPMSTICSQSHFDEMKSVKSSKSLWLKLTASSEECKE LSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQISISKSSFKGSKNNLKPRLSLPFNIISKKLSGSLTSLSSVKSQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKNVF
Sbjct:    1 MSDNGYDNVELNEIINDLKNVANKNSISKNDTRITFQYSNPTRDCRINQDPHSLVNTNPSVTNKVESSSRDQKIILCEPKRNNSQIKLPNSDVDTLQKELSMVKKELAILKRSHSLAGHPIFGENMSDTKTRNYYKQNMDINSNLYPNSGTASSSVTHKKFGASNFAQNNFSSVSNIAYQSQSPSNFQYQSLTRLSAPLTYSAHRENVEKTRQISKTCNLGTRPKNMENYYEDTEDITIQPIGKGIQTLTSSLSSLSKNNHFYNDSMSTVDPMSTICSQSHFDEMKSVKSSKSLWLKLTASSEECKEILSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCLKLPQISISKSSFKGSKNNLKPRLSLPFNIISKKLSGSLTSLSSVKSQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKKNVF 605          
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.156e-19
Identity = 85/315 (26.98%), Postives = 143/315 (45.40%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPA-------CYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCL--------KLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L +K+ GSFIIR  S      T    + L LKV   P           D   +F ++   E++  G++L G   EP++P+L   V  H +    LP  L        +L Q+     +    +   + +     +  ++ LS +  S+SS    +  + +  P+   L    L+LGK  VDRL G  AI  A++K L     PK    V    DS +GI+  D  ++LFY +  P   ++  D D   R  +S  L    +   +I GI+ +K KI+++EN V +  E      + +I+ F+K ++L++
Sbjct:  535 EDVINALRDKETGSFIIRNSS------TFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQ-SGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTT-VEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRR 840          
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.346e-19
Identity = 84/315 (26.67%), Postives = 143/315 (45.40%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPA-------CYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPC--------CLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L +K+ GSFIIR  S      T    + L LKV   P           D   +F ++   E++  G++L G   EP++P+L   V  H +    LP          ++L Q+     +    +   + +     +  ++ LS +  S+SS    +  + +  P+   L    L+LGK  VDRL G  AI  A++K L     PK    V    DS +GI+  D  ++LFY +  P   ++  D D   R  +S  L    +   +I GI+ +K KI+++EN V +  E      + +I+ F+K ++L++
Sbjct:  505 EDVINALRDKETGSFIIRNSS------TFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQ-SGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTT-VEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRR 810          
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.504e-19
Identity = 84/315 (26.67%), Postives = 143/315 (45.40%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPA-------CYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLP--------CCLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L +K+ GSFIIR  S      T    + L LKV   P           D   +F ++   E++  G++L G   EP++P+L   V  H +    LP          ++L Q+     +    +   + +     +  ++ LS +  S+SS    +  + +  P+   L    L+LGK  VDRL G  AI  A++K L     PK    V    DS +GI+  D  ++LFY +  P   ++  D D   R  +S  L    +   +I GI+ +K KI+++EN V +  E      + +I+ F+K ++L++
Sbjct:  438 EDVINALRDKETGSFIIRNSS------TFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQ-SGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTT-VEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRR 743          
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.583e-19
Identity = 84/315 (26.67%), Postives = 143/315 (45.40%), Query Frame = 2
Query: 1010 EECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPA-------CYDDCYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPC--------CLKLPQXXXXXXXXXXXXNNLKPRLSLPFNIIXXXXXXXXXXXXXXXXQYTVTTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCIEVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLSAREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFLKK 1909
            E+   +L +K+ GSFIIR  S      T    + L LKV   P           D   +F ++   E++  G++L G   EP++P+L   V  H +    LP          ++L Q+     +    +   + +     +  ++ LS +  S+SS    +  + +  P+   L    L+LGK  VDRL G  AI  A++K L     PK    V    DS +GI+  D  ++LFY +  P   ++  D D   R  +S  L    +   +I GI+ +K KI+++EN V +  E      + +I+ F+K ++L++
Sbjct:  494 EDVINALRDKETGSFIIRNSS------TFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQ-SGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTT-VEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRR 799          
The following BLAST results are available for this feature:
BLAST of SH2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS22.784e-2127.70tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
TNS22.838e-2127.70tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
TNS23.131e-2127.70tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
TNS23.138e-2127.70tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
TNS23.219e-2127.70tensin 2 [Source:HGNC Symbol;Acc:HGNC:19737][more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns-15.988e-1324.92TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-16.738e-1324.76TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-12.269e-1224.76TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-12.269e-1224.76TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-12.515e-1224.25TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns1b1.758e-2126.28tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns3.26.640e-2027.24tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-... [more]
tns1b7.174e-2027.30tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns2a4.747e-1725.99tensin 2a [Source:ZFIN;Acc:ZDB-GENE-090312-163][more]
tns2b5.791e-1624.50tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5][more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l17.450e-2127.65erythrocyte membrane protein band 4.1-like 1 [Sour... [more]
epb41l11.246e-2027.65erythrocyte membrane protein band 4.1-like 1 [Sour... [more]
epb41l12.792e-2027.65erythrocyte membrane protein band 4.1-like 1 [Sour... [more]
TNS31.058e-1726.51tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS31.101e-1726.51tensin 3 [Source:NCBI gene;Acc:100492216][more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tns25.405e-2127.36tensin 2 [Source:MGI Symbol;Acc:MGI:2387586][more]
Tns26.209e-2127.36tensin 2 [Source:MGI Symbol;Acc:MGI:2387586][more]
Tns26.330e-2127.36tensin 2 [Source:MGI Symbol;Acc:MGI:2387586][more]
Tns26.994e-2127.36tensin 2 [Source:MGI Symbol;Acc:MGI:2387586][more]
Tns11.380e-1927.12tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of SH2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63HR2|TNS2_HUMAN1.363e-2027.70Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2[more]
sp|Q8CGB6|TNS2_MOUSE3.781e-2027.36Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=... [more]
sp|Q68CZ2|TENS3_HUMAN4.564e-1826.91Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2[more]
sp|Q9HBL0|TENS1_HUMAN2.461e-1727.78Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2[more]
sp|Q5SSZ5|TENS3_MOUSE3.202e-1727.33Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=... [more]
back to top
BLAST of SH2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S7MY459.852e-2028.38Tensin-like C1 domain-containing phosphatase OS=My... [more]
L5MA981.098e-1928.38Tensin-like C1 domain-containing phosphatase OS=My... [more]
A0A2U3WCS71.158e-1928.38tensin-2 OS=Odobenus rosmarus divergens OX=9708 GN... [more]
A0A183ILL22.033e-1929.80PID domain-containing protein OS=Soboliphyme batur... [more]
A0A3Q7PY932.425e-1928.04tensin-2 OS=Callorhinus ursinus OX=34884 GN=TNS2 P... [more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036434.19.235e-1928.81pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
TNS34.233e-1827.57tensin-3 [Source:NCBI gene;Acc:103027377][more]
tns1b6.453e-1826.85tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns2a9.812e-1725.57tensin 2 [Source:NCBI gene;Acc:103022390][more]
tns2a9.918e-1725.57tensin 2 [Source:NCBI gene;Acc:103022390][more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003653.16.218e-2226.60pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-... [more]
ENSPMAT00000005743.19.553e-2027.99pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1... [more]
TNS12.986e-1929.05tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000001958.11.177e-924.91pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 g... [more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457831.275e-1326.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SH2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns2a1.448e-2028.10tensin 2 [Source:NCBI gene;Acc:101156086][more]
tns2a3.590e-1926.89tensin 2 [Source:NCBI gene;Acc:101156086][more]
ENSORLT00000002849.24.864e-1824.57pep primary_assembly:ASM223467v1:2:14075704:140850... [more]
ENSORLT00000002851.27.218e-1824.57pep primary_assembly:ASM223467v1:2:14075704:140871... [more]
TNS37.440e-1828.91tensin-3 [Source:NCBI gene;Acc:101166465][more]
back to top
BLAST of SH2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006496.10.000e+099.83SMESG000006496.1[more]
SMESG000033851.11.156e-1926.98SMESG000033851.1[more]
SMESG000033851.11.346e-1926.67SMESG000033851.1[more]
SMESG000033851.11.504e-1926.67SMESG000033851.1[more]
SMESG000033851.11.583e-1926.67SMESG000033851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011506 ID=SMED30011506|Name=SH2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1948bp
CTCGTGTTATTTTATTAAGAAATCCAGTTGCACAGAAATTTTTAGCTATT
AATTATTACATAGTTTTTATTAATCTACATTCTAGGATATTGGAAATGAA
AATATGTCTGACAATGGATATGACAATGTTGAATTAAATGAAATCATAAA
TGATCTGAAAAATGTGGCTAACAAAAATTCCATCAGCAAAAATGACACGA
GAATAACCTTTCAATACTCAAATCCTACTCGAGATTGTAGAATCAATCAA
GATCCTCATAGTTTAGTGAACACAAATCCTTCGGTTACCAATAAAGTAGA
AAGTAGTTCCCGAGATCAGAAAATTATATTATGTGAACCTAAAAGAAATA
ATAGTCAGATAAAGTTACCCAATTCAGATGTCGATACGTTGCAAAAAGAA
TTGTCAATGGTTAAAAAAGAATTGGCTATCCTTAAACGATCGCACAGTTT
AGCAGGCCATCCGATTTTCGGCGAAAATATGTCTGATACAAAAACTAGAA
ATTATTATAAACAAAATATGGACATCAATTCCAACTTGTATCCGAACTCT
GGAACGGCCAGTTCGAGTGTCACTCATAAAAAATTTGGAGCCTCGAATTT
TGCTCAGAATAATTTTTCAAGCGTATCAAATATCGCTTATCAATCTCAAA
GTCCGAGCAATTTTCAGTATCAAAGCCTGACGAGGTTAAGTGCCCCATTG
ACGTATTCGGCTCACAGAGAAAATGTTGAGAAAACAAGACAGATTTCTAA
AACATGTAATTTAGGAACAAGGCCGAAAAATATGGAAAACTATTATGAAG
ATACTGAAGATATAACTATTCAACCAATCGGAAAGGGTATACAGACGCTA
ACAAGCAGTTTGTCAAGTTTGTCAAAAAATAATCATTTCTACAATGACTC
AATGTCAACTGTTGATCCAATGTCAACGATTTGTTCTCAATCACATTTCG
ATGAAATGAAATCCGTCAAGTCATCAAAATCATTGTGGCTCAAACTTACG
GCATCAAGTGAAGAATGCAAGGAAAGTTTAAGTAACAAAGATAAAGGTTC
TTTTATCATACGAATTCAATCAGAATGCAAAATCCAAAGTACCAGTGGAA
TGATTTTTGAACTTATTTTAAAAGTCGTTGACTATCCAGCATGTTATGAT
GACTGCTACGAGTACTTTTCTCTGAAAGAATTCATTGAAACTGCTCCAAA
AGGCATCAAACTTATTGGTCATGGCATCGAGCCAGTTTTCCCTACACTGG
ACAGTTTTGTTTTACAACATTTAGAAATACCTCTTGGATTGCCTTGCTGT
CTAAAATTACCTCAAATTTCCATCTCTAAATCTAGCTTTAAAGGCAGCAA
GAATAATTTAAAACCAAGATTATCTCTTCCTTTCAATATTATCAGTAAAA
AACTATCTGGAAGTCTAACCTCTTTATCATCTGTAAAATCACAATATACA
GTAACAACATATGCTAAGCCAATTCAAGCTAAATTAAACGCAGAACTTCT
TTTCCTTGGCAAAGTAACTGTGGATAGGCTTACTGGCTTAAATGCCATAC
GACACGCAGTTGATAAAACACTGATTAATGGCTACCAACCAAAGAACTGC
ATAGAAGTGAATGCATTTTTTGATTCTTTATCGGGAATTTCAATTGTTGA
TAATGAAAGGATACTCTTTTATAAAAAGTTTGTACCAGTTGGTTCCATTA
TGTATTGCGATGTCGACCCATTACACAGAGGACTGAATAGTGACTTTCTA
AGTGCAAGGGAAGTTAAAAATGCAAAAATTTTCGGAATTTTATATCAAAA
AAAGAAAATCCTCATCAAAGAAAACAAAGTTATTGTTTTTGCGGAATTCA
GTTTTGAAACCCCTATGGAAAGTATAATGAAATTTGTTAAAAATCATTTT
TTAAAAAAAAATGTATTTTAAATATATTTTTCGTTGTGTCAAAAAAAA
back to top

protein sequence of SMED30011506-orf-1

>SMED30011506-orf-1 ID=SMED30011506-orf-1|Name=SMED30011506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=606bp
MSDNGYDNVELNEIINDLKNVANKNSISKNDTRITFQYSNPTRDCRINQD
PHSLVNTNPSVTNKVESSSRDQKIILCEPKRNNSQIKLPNSDVDTLQKEL
SMVKKELAILKRSHSLAGHPIFGENMSDTKTRNYYKQNMDINSNLYPNSG
TASSSVTHKKFGASNFAQNNFSSVSNIAYQSQSPSNFQYQSLTRLSAPLT
YSAHRENVEKTRQISKTCNLGTRPKNMENYYEDTEDITIQPIGKGIQTLT
SSLSSLSKNNHFYNDSMSTVDPMSTICSQSHFDEMKSVKSSKSLWLKLTA
SSEECKESLSNKDKGSFIIRIQSECKIQSTSGMIFELILKVVDYPACYDD
CYEYFSLKEFIETAPKGIKLIGHGIEPVFPTLDSFVLQHLEIPLGLPCCL
KLPQISISKSSFKGSKNNLKPRLSLPFNIISKKLSGSLTSLSSVKSQYTV
TTYAKPIQAKLNAELLFLGKVTVDRLTGLNAIRHAVDKTLINGYQPKNCI
EVNAFFDSLSGISIVDNERILFYKKFVPVGSIMYCDVDPLHRGLNSDFLS
AREVKNAKIFGILYQKKKILIKENKVIVFAEFSFETPMESIMKFVKNHFL
KKNVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005925focal adhesion
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR013625PTB
IPR000980SH2
IPR011993PH-like_dom_sf
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
GO:0008284positive regulation of cell proliferation
GO:0016477cell migration
GO:0048286lung alveolus development
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 93..113
NoneNo IPR availablePANTHERPTHR45734FAMILY NOT NAMEDcoord: 45..601
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 465..596
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 450..604
e-value: 3.5E-23
score: 83.8
IPR013625Tensin/EPS8 phosphotyrosine-binding domainPFAMPF08416PTBcoord: 465..602
e-value: 1.1E-7
score: 32.1
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 291..402
e-value: 1.5E-8
score: 36.9
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 293..410