Sodium/potassium-transporting ATPase subunit beta

Overview
NameSodium/potassium-transporting ATPase subunit beta
Smed IDSMED30011504
Length (bp)788
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011504

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
oviductSMED30011504h1SMcG0000634 GDAG01007492.1SmedSxl_ww_GDAG01PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30011504h1SMcG0000634 Contig8162newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011504h1SMcG0000634 Contig8162uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 45.4394 bits (106), Expect = 4.111e-7
Identity = 35/143 (24.48%), Postives = 68/143 (47.55%), Query Frame = 3
Query:  231 IKFKDGKRYSFANYLHDLIGFTANYERHKIGNHL--EDC-------LGQGYFSFR--PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQ-LKNATRD-----------IKIKCDGVSSTDQELIGIICYY 584
            I F+     S+  Y+ +++ F   Y+     + +  EDC         +G F+     RK C F L++   C+    + +GY E KPC++IK+N++ G+ P+  KN + +           + ++C G    D++ +G + Y+
Sbjct:   88 ISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF 230          

HSP 2 Score: 27.7202 bits (60), Expect = 4.111e-7
Identity = 11/36 (30.56%), Postives = 19/36 (52.78%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Y QP + ++F +L  +  IR+ C    EN+    K+
Sbjct:  254 YLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 45.4394 bits (106), Expect = 4.111e-7
Identity = 35/143 (24.48%), Postives = 68/143 (47.55%), Query Frame = 3
Query:  231 IKFKDGKRYSFANYLHDLIGFTANYERHKIGNHL--EDC-------LGQGYFSFR--PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQ-LKNATRD-----------IKIKCDGVSSTDQELIGIICYY 584
            I F+     S+  Y+ +++ F   Y+     + +  EDC         +G F+     RK C F L++   C+    + +GY E KPC++IK+N++ G+ P+  KN + +           + ++C G    D++ +G + Y+
Sbjct:   88 ISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF 230          

HSP 2 Score: 27.7202 bits (60), Expect = 4.111e-7
Identity = 11/36 (30.56%), Postives = 19/36 (52.78%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Y QP + ++F +L  +  IR+ C    EN+    K+
Sbjct:  254 YLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 49.6766 bits (117), Expect = 1.887e-6
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCLGQGYF-----SFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY--QYGRISNL 638
            ++ +Y+  L GF   Y          DC    YF         +K+C F   F   C+      FGYS  +PC+L+K+N+I G+ P+L +    +K+ C  V   D+  I  I YY  +  ++  Y   YG+++++
Sbjct:  131 TWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDP---VKVSCK-VQRGDENDIRSISYYPESASFDLRYYPYYGKLTHV 262          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 49.6766 bits (117), Expect = 1.895e-6
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCLGQGYF-----SFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY--QYGRISNL 638
            ++ +Y+  L GF   Y          DC    YF         +K+C F   F   C+      FGYS  +PC+L+K+N+I G+ P+L +    +K+ C  V   D+  I  I YY  +  ++  Y   YG+++++
Sbjct:  170 TWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDP---VKVSCK-VQRGDENDIRSISYYPESASFDLRYYPYYGKLTHV 301          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 49.6766 bits (117), Expect = 2.000e-6
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCLGQGYF-----SFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY--QYGRISNL 638
            ++ +Y+  L GF   Y          DC    YF         +K+C F   F   C+      FGYS  +PC+L+K+N+I G+ P+L +    +K+ C  V   D+  I  I YY  +  ++  Y   YG+++++
Sbjct:  174 TWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDP---VKVSCK-VQRGDENDIRSISYYPESASFDLRYYPYYGKLTHV 305          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 55.4546 bits (132), Expect = 3.573e-13
Identity = 41/138 (29.71%), Postives = 64/138 (46.38%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKS-----CYFGLD-FGVGCTIQKLFGYSELKPCVLIKINKIYGWVP---QLKNATRDIK---------IKCDGVSSTDQELIGIICY 581
            S+LIK+    + S+  YL  +  +   Y+ +       +C G G  +    K+     C F L  F  GC+ +  FGY   KPCV+I +N++ GW P   Q  +   ++K         I C G ++ DQE IG + Y
Sbjct:  110 STLIKYNLRDQKSYKAYLEQMKTYLTKYDSN--ATETREC-GAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY 244          

HSP 2 Score: 37.3502 bits (85), Expect = 3.573e-13
Identity = 17/49 (34.69%), Postives = 25/49 (51.02%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY     Y+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  255 YPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMV 303          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 55.4546 bits (132), Expect = 3.573e-13
Identity = 41/138 (29.71%), Postives = 64/138 (46.38%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKS-----CYFGLD-FGVGCTIQKLFGYSELKPCVLIKINKIYGWVP---QLKNATRDIK---------IKCDGVSSTDQELIGIICY 581
            S+LIK+    + S+  YL  +  +   Y+ +       +C G G  +    K+     C F L  F  GC+ +  FGY   KPCV+I +N++ GW P   Q  +   ++K         I C G ++ DQE IG + Y
Sbjct:  110 STLIKYNLRDQKSYKAYLEQMKTYLTKYDSN--ATETREC-GAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY 244          

HSP 2 Score: 37.3502 bits (85), Expect = 3.573e-13
Identity = 17/49 (34.69%), Postives = 25/49 (51.02%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY     Y+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  255 YPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMV 303          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 55.4546 bits (132), Expect = 3.573e-13
Identity = 41/138 (29.71%), Postives = 64/138 (46.38%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKS-----CYFGLD-FGVGCTIQKLFGYSELKPCVLIKINKIYGWVP---QLKNATRDIK---------IKCDGVSSTDQELIGIICY 581
            S+LIK+    + S+  YL  +  +   Y+ +       +C G G  +    K+     C F L  F  GC+ +  FGY   KPCV+I +N++ GW P   Q  +   ++K         I C G ++ DQE IG + Y
Sbjct:  110 STLIKYNLRDQKSYKAYLEQMKTYLTKYDSN--ATETREC-GAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY 244          

HSP 2 Score: 37.3502 bits (85), Expect = 3.573e-13
Identity = 17/49 (34.69%), Postives = 25/49 (51.02%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY     Y+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  255 YPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMV 303          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 48.521 bits (114), Expect = 1.661e-11
Identity = 39/145 (26.90%), Postives = 60/145 (41.38%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVG------CTIQKLFGYSELKPCVLIKINKIYGWVP----------QLKNATR--DIKIKCDGVSSTDQELIGIICYYDYT 593
            N  S+LIKF      S+  Y+  L  + + Y   K  N   DC            +  F   F +G      C  +  +GY   KPCV + +N++ GW P          ++K   +   I I C+G +S D+E +G + Y   T
Sbjct:  104 NPDSTLIKFNLQDSKSWEPYVKQLDNYLSKY---KNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPET 245          

HSP 2 Score: 38.1206 bits (87), Expect = 1.661e-11
Identity = 18/49 (36.73%), Postives = 26/49 (53.06%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY    SY+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  252 YPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMV 300          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 48.521 bits (114), Expect = 1.910e-11
Identity = 39/145 (26.90%), Postives = 60/145 (41.38%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVG------CTIQKLFGYSELKPCVLIKINKIYGWVP----------QLKNATR--DIKIKCDGVSSTDQELIGIICYYDYT 593
            N  S+LIKF      S+  Y+  L  + + Y   K  N   DC            +  F   F +G      C  +  +GY   KPCV + +N++ GW P          ++K   +   I I C+G +S D+E +G + Y   T
Sbjct:   90 NPDSTLIKFNLQDSKSWEPYVKQLDNYLSKY---KNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPET 231          

HSP 2 Score: 38.1206 bits (87), Expect = 1.910e-11
Identity = 18/49 (36.73%), Postives = 26/49 (53.06%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY    SY+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  238 YPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMV 286          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100382)

HSP 1 Score: 50.8322 bits (120), Expect = 9.909e-13
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  107 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 257          

HSP 2 Score: 40.4318 bits (93), Expect = 9.909e-13
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  266 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079381)

HSP 1 Score: 50.8322 bits (120), Expect = 9.909e-13
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  107 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 257          

HSP 2 Score: 40.4318 bits (93), Expect = 9.909e-13
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  266 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0332369)

HSP 1 Score: 50.8322 bits (120), Expect = 9.909e-13
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  107 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 257          

HSP 2 Score: 40.4318 bits (93), Expect = 9.909e-13
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  266 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079382)

HSP 1 Score: 50.8322 bits (120), Expect = 1.041e-12
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  106 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 256          

HSP 2 Score: 40.817 bits (94), Expect = 1.041e-12
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  265 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 315          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079383)

HSP 1 Score: 50.8322 bits (120), Expect = 1.041e-12
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  106 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 256          

HSP 2 Score: 40.817 bits (94), Expect = 1.041e-12
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  265 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 315          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 45.8246 bits (107), Expect = 3.076e-7
Identity = 34/129 (26.36%), Postives = 53/129 (41.09%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCL--------GQGYFSFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            S+  Y+  L  F   Y   +   + +DC           G     P++SC F       C+    + +GY + KPC+LIK+N++ G  P     +    + C G    D E IG I Y+     +N  Y
Sbjct:   65 SWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPGKDGQSP--YVTC-GAKKEDAESIGEIAYFPPNGTFNLMY 190          

HSP 2 Score: 26.9498 bits (58), Expect = 3.076e-7
Identity = 15/47 (31.91%), Postives = 24/47 (51.06%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            +PY   K   +Y QP V +KF ++  N  + V C + + N   +F E
Sbjct:  191 YPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKINS-NTITEFSE 236          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 45.8246 bits (107), Expect = 3.958e-7
Identity = 34/129 (26.36%), Postives = 53/129 (41.09%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCL--------GQGYFSFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            S+  Y+  L  F   Y   +   + +DC           G     P++SC F       C+    + +GY + KPC+LIK+N++ G  P     +    + C G    D E IG I Y+     +N  Y
Sbjct:   98 SWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPGKDGQSP--YVTC-GAKKEDAESIGEIAYFPPNGTFNLMY 223          

HSP 2 Score: 26.9498 bits (58), Expect = 3.958e-7
Identity = 15/47 (31.91%), Postives = 24/47 (51.06%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            +PY   K   +Y QP V +KF ++  N  + V C + + N   +F E
Sbjct:  224 YPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKINS-NTITEFSE 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 41.9726 bits (97), Expect = 5.243e-6
Identity = 36/134 (26.87%), Postives = 54/134 (40.30%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCL--------GQGYFSFRPRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVP----QLKNATRDIKIKCDGVS-STDQELIGIICYYDYTTKYNCDY 614
            S+  Y+  L  F   Y   +   + +DC           G     P++SC F       C+    + +GY + KPC+LIK+N++ G  P    Q    T   K   +G     D E IG I Y+     +N  Y
Sbjct:   44 SWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPGKDGQSPYVTCGAKRYKEGDEWKEDAESIGEIAYFPPNGTFNLMY 177          

HSP 2 Score: 26.9498 bits (58), Expect = 5.243e-6
Identity = 15/47 (31.91%), Postives = 24/47 (51.06%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            +PY   K   +Y QP V +KF ++  N  + V C + + N   +F E
Sbjct:  178 YPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKINS-NTITEFSE 223          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Zebrafish
Match: atp1b1a (ATPase Na+/K+ transporting subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-001127-3])

HSP 1 Score: 36.5798 bits (83), Expect = 8.118e-6
Identity = 23/89 (25.84%), Postives = 43/89 (48.31%), Query Frame = 3
Query:  372 RKSCYFGLDFGVGCT-----IQKLFGYSELKPCVLIKINKIYGWVPQ-------LKNATRD------IKIKCDGVSSTDQELIGIICYY 584
            RK+C F  ++   C+      QK +G+ + +PC+++K+N+I  ++P+       +  A R       I I C      +  L+G I Y+
Sbjct:  145 RKACRFRREWLGECSGQKDEKQKNYGFDDGQPCLIVKLNRIVNFMPRPPASNDSIPEAVRPKLQGNVIPIHCSSKREEEANLLGQIKYF 233          

HSP 2 Score: 31.5722 bits (70), Expect = 8.118e-6
Identity = 14/38 (36.84%), Postives = 22/38 (57.89%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESA 778
            Y QP V IKF ++  +V +RV C +  EN+    K+ +
Sbjct:  255 YLQPLVAIKFYNITTDVDVRVECKVYGENIDYSEKDRS 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 45.8246 bits (107), Expect = 6.590e-8
Identity = 28/85 (32.94%), Postives = 42/85 (49.41%), Query Frame = 3
Query:  369 PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIY----GWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYN 605
            P+K+C F       C+      +GYS   PC+LIK+NKI     G +P L N +  I I C G ++   +++G   YY  +   N
Sbjct:  147 PKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVIPSLSNTS--ITINCTGTTANMDQMLGSRTYYPSSNPSN 229          

HSP 2 Score: 30.0314 bits (66), Expect = 6.590e-8
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVD 763
            FPY   +   +Y QP V +KF +L  N  + V C   A N+  +
Sbjct:  245 FPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQCRANAVNINTN 288          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Xenopus
Match: tpst2 (tyrosylprotein sulfotransferase 2 [Source:Xenbase;Acc:XB-GENE-962493])

HSP 1 Score: 43.8986 bits (102), Expect = 4.520e-7
Identity = 38/148 (25.68%), Postives = 63/148 (42.57%), Query Frame = 3
Query:  216 SLSSLIKFKDGKRYSFANYLHDLIGFTANYE-RHKIGNHLEDCLGQGYFSFRPR----------KSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGW--VPQLKNATRD----------IKIKCDGVSSTDQELIGIICYY 584
            ++ + I F      S+ +Y+  +  F + Y   +++ +  EDC G     +R R          KSC F   +   C+    + FG++E KPCV++K+N+I  +  VP   N+             I I C G    D   I  + YY
Sbjct:   84 AVKTEINFSPNDPDSYNDYVQSMEKFISKYSNENQVSDKFEDC-GTMPGQYRERGGLNKDGGQKKSCVFRRQWLQNCSGIDDQTFGFAEGKPCVIVKLNRIVAFKPVPPQNNSLPPEMTANYNPYVIPIHCQGKRDEDIPNIREVKYY 230          

HSP 2 Score: 29.261 bits (64), Expect = 4.520e-7
Identity = 12/36 (33.33%), Postives = 19/36 (52.78%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Y QP + ++F +L  N  IR+ C    EN+    K+
Sbjct:  254 YLQPLIAVQFTNLTFNTEIRIECKAYGENIDYHDKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 46.9802 bits (110), Expect = 1.003e-7
Identity = 41/159 (25.79%), Postives = 68/159 (42.77%), Query Frame = 3
Query:  231 IKFKDGKRYSFANYLHDLIGFTANYERHKIGNHL--EDCLGQGYFSFRP------------RKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQ-LKNATRD------------IKIKCDGVSSTDQELIGIICYYDYTTKYNCDYQY 620
            I F+     S+  Y+ ++I F   Y+     + +  EDC   G     P            RK C F LD+   C+      +GY E KPC++IK+N++ G+ P+  KN + +            + ++C G    D++ +G I Y+     Y    QY
Sbjct:   88 ISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDC---GNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQY 243          

HSP 2 Score: 27.7202 bits (60), Expect = 1.003e-7
Identity = 12/36 (33.33%), Postives = 19/36 (52.78%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Y QP + ++F +L  +  IRV C    EN+    K+
Sbjct:  255 YLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKD 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.501e-12
Identity = 41/138 (29.71%), Postives = 64/138 (46.38%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKS-----CYFGLD-FGVGCTIQKLFGYSELKPCVLIKINKIYGWVP---QLKNATRDIK---------IKCDGVSSTDQELIGIICY 581
            S+LIK+    + S+  YL  +  +   Y+ +       +C G G  +    K+     C F L  F  GC+ +  FGY   KPCV+I +N++ GW P   Q  +   ++K         I C G ++ DQE IG + Y
Sbjct:  110 STLIKYNLRDQKSYKAYLEQMKTYLTKYDSN--ATETREC-GAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY 244          

HSP 2 Score: 37.3502 bits (85), Expect = 3.501e-12
Identity = 17/49 (34.69%), Postives = 25/49 (51.02%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY     Y+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  255 YPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMV 303          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Match: sp|Q24048|ATPB2_DROME (Sodium/potassium-transporting ATPase subunit beta-2 OS=Drosophila melanogaster OX=7227 GN=nrv2 PE=1 SV=2)

HSP 1 Score: 50.8322 bits (120), Expect = 7.234e-12
Identity = 38/154 (24.68%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKI----GNHLEDCLGQGYFSFRPR-KSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD--------------------------IKIKCDGVSSTDQELIGIICY 581
            N  S+LI +K  +  ++ ++   L  F A Y+   +    G ++ +C    Y    P+ + C   +     CT +  + Y +  PC+ +K+NKIYGW+P+  N + D                          I + C+G +  DQE IG + Y
Sbjct:  107 NVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNC---DYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNY 257          

HSP 2 Score: 40.4318 bits (93), Expect = 7.234e-12
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY+    Y  P V + FQ   R ++I V C   A N+  D KE  GSV
Sbjct:  266 YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSV 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Match: sp|P25169|AT1B1_ARTSF (Sodium/potassium-transporting ATPase subunit beta OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.533e-11
Identity = 43/153 (28.10%), Postives = 69/153 (45.10%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYER-HKIGNHLEDCLGQGYFSFRPR--KSCYFGLDF-GVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIK--------------------------IKCDGVSSTDQELIGIICYYDY 590
            S+LI+FK G +  +  ++H L  F   YE     G    +C     F   P+  K+C F ++  G  CT +  FGY   KPCVLIK+   +GW P++ N++ ++                           + C+G ++ D+E IG I Y  +
Sbjct:  105 STLIQFKHGIKGDWQYWVHSLTEFLEPYETLTSSGQEFTNC----DFDKPPQEGKACNFNVELLGDHCTKENNFGYELGKPCVLIKLTD-FGWRPEVYNSSAEVPEDMPADLKSYIKDIETGNKTHMNMVWLSCEGETANDKEKIGTITYTPF 252          

HSP 2 Score: 31.9574 bits (71), Expect = 1.533e-11
Identity = 16/51 (31.37%), Postives = 23/51 (45.10%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            + +PY     Y  P V ++F SL     + V C   A N+  D +   GSV
Sbjct:  258 YYYPYLNVPGYLTPVVALQFGSLQNGQAVNVECKAWANNISRDRQRRLGSV 308          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 1.628e-10
Identity = 39/145 (26.90%), Postives = 60/145 (41.38%), Query Frame = 3
Query:  213 NSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVG------CTIQKLFGYSELKPCVLIKINKIYGWVP----------QLKNATR--DIKIKCDGVSSTDQELIGIICYYDYT 593
            N  S+LIKF      S+  Y+  L  + + Y   K  N   DC            +  F   F +G      C  +  +GY   KPCV + +N++ GW P          ++K   +   I I C+G +S D+E +G + Y   T
Sbjct:  104 NPDSTLIKFNLQDSKSWEPYVKQLDNYLSKY---KNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPET 245          

HSP 2 Score: 38.1206 bits (87), Expect = 1.628e-10
Identity = 18/49 (36.73%), Postives = 26/49 (53.06%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY    SY+QP   +KF ++ RN L+ V C   A N++ D     G V
Sbjct:  252 YPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMV 300          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Match: sp|Q24046|ATPB1_DROME (Sodium/potassium-transporting ATPase subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=nrv1 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 9.530e-10
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  225 SLIKFKDGKRYSFANYLHDLIG-FTANYERHKIGNHLEDC-LGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQL-----KNATRDIKIKCDGVSSTDQELIGIIC 578
            S+I F DGK+ + ++Y  +LI  F  +Y  H  G  ++ C  GQ      P   C    D   GC+    +GY   +PC+ +K+NKI+GW+P++     K+   D+K   +   + +++ + + C
Sbjct:  106 SVIAF-DGKKPAESDYWIELIDDFLRDY-NHTEGRDMKHCGFGQ---VLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSC 225          

HSP 2 Score: 27.335 bits (59), Expect = 9.530e-10
Identity = 10/41 (24.39%), Postives = 21/41 (51.22%), Query Frame = 2
Query:  635 FVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVK 757
            + +P+     Y  P V ++F S  +  ++ V C   A+N++
Sbjct:  250 YYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQ 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Match: G4VSU9 (Putative sodium/potassium-dependent atpase beta subunit OS=Schistosoma mansoni OX=6183 GN=Smp_163170 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.970e-25
Identity = 69/199 (34.67%), Postives = 108/199 (54.27%), Query Frame = 3
Query:   72 LMLVSVGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHK-IGNHLEDCLGQG-----YFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYD--YTTKYNCDYQYGRISNLFF 644
            ++L+S+ + +   VL+  ++   D P  +G+ + L  TP LSI+P +++  +LI +KDGK  +F  +   LI F + YE +   GN++ DCL Q       +      SC F LD+   C I   FGY    PCV+IK+N++YGW+P +++    IKI C G +  D  L+G IC YD    T+  C  Q   I + +F
Sbjct:   49 VLLLSIVICLMKLVLYKIID--ADKPYLTGSYSSLENTPGLSIVPVISTEMNLIAYKDGKPDTFLIFQDMLIAFLSQYEYYSYTGNNMRDCLMQNDSQALTYETLVETSCLFNLDWSYACNINNYFGYDSGSPCVIIKLNRLYGWLPDIRSNENGIKICCKGANPNDDILLGTICLYDAYIHTEEGCGRQCAFIPHQYF 245          

HSP 2 Score: 41.9726 bits (97), Expect = 3.970e-25
Identity = 14/31 (45.16%), Postives = 24/31 (77.42%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHC 733
            FPY    SY+ P +F++FQ++ +NVL+++HC
Sbjct:  245 FPYLNQESYQSPLIFLQFQNVRKNVLMQIHC 275          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Match: A0A564Z4P2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12195 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.157e-24
Identity = 57/195 (29.23%), Postives = 97/195 (49.74%), Query Frame = 3
Query:   96 TIGTYVLHSYLNYSV------DYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQ-LKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNC---DYQYGRISNLFFHT 650
            TI  +V   YLN+ +      D+P  +G ++ L + P LS IPN +  S+L+ F+  +   +     +L  F   Y+ +     LEDC+ +G     P + C + L+ G  C I   FG+   + C ++K+ +IYGW+P  +      + +KC GV+  D   +G I YYD   K++        G+++N  FH+
Sbjct:   65 TILGFVFVGYLNWYMYFQVPRDHPALTGMHSALQMNPGLSHIPNPDIFSTLLYFRTREPLPYYRKSDELSAFLHAYQDNTGSTELEDCVQEGGIKQDPERPCTYDLNAGGPCNIMNGFGFDTAQACFVLKMGRIYGWLPDPIDEFATGVLVKCSGVTEDDTYNLGTIRYYDMDFKFSAIAPAKNPGKLTNGSFHS 259          

HSP 2 Score: 60.8474 bits (146), Expect = 1.157e-24
Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            FPYK   +Y QP VF+ F  + RN  IRV CW+ A+N+KVDF +  GS 
Sbjct:  262 FPYKNQLAYLQPLVFVLFDGVKRNTFIRVRCWLIAKNIKVDFDKGEGST 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Match: A0A183TJ60 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS16508 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.397e-24
Identity = 51/179 (28.49%), Postives = 93/179 (51.96%), Query Frame = 3
Query:  123 YLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNC---DYQYGRISNLFFHT 650
            Y   S +YP  +G  + L + P LS +PN N  +SL++F+  +   ++ Y  +++ F   Y+ +     +EDC+ +G F     + C + L+ G  C I   +G+   +PC  +K+ KIYGW+P+       + +KC+G +  D   +G I Y+D   K++        G+++N  FH+
Sbjct:   91 YFQVSRNYPKLTGWQSALQMNPGLSQVPNPNIYNSLVRFRTREPLPYSKYQDEIVAFLHAYQDNTGCWEMEDCVQEGGFKQDVDRPCAYDLNAGGPCNIMNGYGFDTAQPCFALKMGKIYGWLPEPVEFATGVLVKCEGATEDDTNNLGTIRYFDMDYKFSAIAPGKNPGKVTNGSFHS 269          

HSP 2 Score: 53.1434 bits (126), Expect = 1.397e-24
Identity = 23/49 (46.94%), Postives = 30/49 (61.22%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            FPY+    Y QP VF++F    RN LIRV C++ A+N+KVD     GS 
Sbjct:  272 FPYRNQFCYHQPLVFVQFDGARRNRLIRVQCYLIAKNIKVDISRLEGST 320          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Match: A0A3P7PWL6 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS14064 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.557e-24
Identity = 52/156 (33.33%), Postives = 86/156 (55.13%), Query Frame = 3
Query:  123 YLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCL-GQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYD 587
            Y     DYP  +G  +LL L P LS +PN + L+SLI F+  +  S++  + +++ F   Y++ K+   ++DC+ G G      R+ C F L+    C +   FGY+   PCV +K+N+IYGW+P+       + +KC+G +  D   +G + YYD
Sbjct:    2 YFQIRTDYPKLTGRQSLLQLHPGLSRVPNPDVLTSLIHFRPYEPLSYSKLIDEMLAFLYGYQK-KLCTMMKDCVHGTGGDIIDMRRPCAFDLNAVGPCNLANTFGYTTASPCVALKMNRIYGWLPEPVEFATGVLVKCEGETEADTLNMGTVHYYD 156          

HSP 2 Score: 55.0694 bits (131), Expect = 1.557e-24
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            FPY     Y QP VF++F  + RN LIRV C++ A+N+ V F+ + GSV
Sbjct:  179 FPYLNQVCYHQPLVFLEFAGMRRNTLIRVKCYLIAKNIPVSFERNEGSV 227          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Match: A0A430QRC9 (Sodium/potassium-transporting ATPase subunit beta OS=Schistosoma bovis OX=6184 GN=DC041_0002223 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.774e-24
Identity = 61/155 (39.35%), Postives = 87/155 (56.13%), Query Frame = 3
Query:  123 YLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYD 587
            Y     DYP  +G +  L L P LSIIPN N L+SLI F      S+++ + ++ GF + Y+ H IG   E C          R+ C F LD    C ++  +GY E KPC +IK+N+IYGW+P   N   +I +KC+G++  D + +G ICYYD
Sbjct:   87 YFTILADYPKLTGLHNQLKLNPGLSIIPNSNRLTSLIHFYTSNPVSYSSMIDEMTGFLSYYQYHIIGGMFESCEMNPKL-LNMRRPCRFNLDSSGPCNLKNGYGYYEGKPCFIIKLNRIYGWLPIPLNNYTNILLKCEGLTKLDSDYLGKICYYD 240          

HSP 2 Score: 42.3578 bits (98), Expect = 1.774e-24
Identity = 16/49 (32.65%), Postives = 30/49 (61.22%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            +PY   + Y+ P VF+ F +  R+V+I + C+  A+N+ V+   + GS+
Sbjct:  269 YPYLNQAGYQSPLVFVHFLNPKRHVIIWIKCYALAKNIHVNIHSNEGSI 317          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 45.4394 bits (106), Expect = 7.360e-8
Identity = 36/141 (25.53%), Postives = 59/141 (41.84%), Query Frame = 3
Query:  222 SSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYF------SFR--PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            S  I++      S+  Y+  L  F   Y+  +   + + C    YF      S R  P++SC F       C       +GY + KPC+ IK+N++ G +P     +    + C G    D EL+G + Y+     +N  Y
Sbjct:   86 SMEIQYSKQNTESWDKYVKTLNSFLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKPCIFIKLNRVIGMLPGKDGQS--PYVTC-GAKREDSELLGDMAYFPSNASFNLMY 223          

HSP 2 Score: 29.6462 bits (65), Expect = 7.360e-8
Identity = 16/47 (34.04%), Postives = 24/47 (51.06%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            +PY   K   +Y QP V +KF +L  N  + V C + +  +  DF E
Sbjct:  224 YPYYGKKAQVNYSQPLVAVKFLNLTLNTDVNVECKINSNTIS-DFSE 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 40.817 bits (94), Expect = 3.494e-7
Identity = 23/84 (27.38%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  369 PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            P++SC F       C+    + +GY E KPC++IK+N++ G +P        I      +  TD+  +G + Y+     +N  Y
Sbjct:  159 PKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISC-APKIDDTDK--MGEVAYFPRNGTFNLMY 239          

HSP 2 Score: 31.9574 bits (71), Expect = 3.494e-7
Identity = 17/41 (41.46%), Postives = 22/41 (53.66%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENV 754
            FPY   K   +Y QP V IKF ++  N  I V C + A N+
Sbjct:  240 FPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNI 280          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 40.817 bits (94), Expect = 4.395e-7
Identity = 23/84 (27.38%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  369 PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            P++SC F       C+    + +GY E KPC++IK+N++ G +P        I      +  TD+  +G + Y+     +N  Y
Sbjct:  140 PKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISC-APKIDDTDK--MGEVAYFPRNGTFNLMY 220          

HSP 2 Score: 31.5722 bits (70), Expect = 4.395e-7
Identity = 17/41 (41.46%), Postives = 22/41 (53.66%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENV 754
            FPY   K   +Y QP V IKF ++  N  I V C + A N+
Sbjct:  221 FPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNI 261          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 40.4318 bits (93), Expect = 4.834e-7
Identity = 26/92 (28.26%), Postives = 46/92 (50.00%), Query Frame = 3
Query:  369 PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWV-------PQLKNATRDIKI-KCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            P++SC F       C+    + +GY E KPC++IK+N++ G +       P +  A +  KI K + +  TD+  +G + Y+     +N  Y
Sbjct:  140 PKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISCAPKKYKIGKDEWIDDTDK--MGEVAYFPRNGTFNLMY 229          

HSP 2 Score: 31.5722 bits (70), Expect = 4.834e-7
Identity = 17/41 (41.46%), Postives = 22/41 (53.66%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENV 754
            FPY   K   +Y QP V IKF ++  N  I V C + A N+
Sbjct:  230 FPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNI 270          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Match: atp1b1a (sodium/potassium-transporting ATPase subunit beta-233 [Source:NCBI gene;Acc:103037979])

HSP 1 Score: 38.891 bits (89), Expect = 6.532e-6
Identity = 32/125 (25.60%), Postives = 48/125 (38.40%), Query Frame = 3
Query:  306 ERHKIGNHLEDC---------LGQGYFSFRPRKSCYFGLDFGVGCTIQKL-FGYSELKPCVLIKINKIYGWVP------------QLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            E+    N  EDC          G+       RK+C F   +   C+ +   FG+ + KPC+L+K+N+I  + P            Q K     I I C      D   IG I Y+   + +   Y
Sbjct:  114 EKQTDENQFEDCGENPAIYKNRGELESDVGKRKACRFKKSWLGACSGEDPHFGFKDGKPCILVKLNRIVNFRPKAPANTSLPVNLQGKVQANLIPIHCSSKKEEDAGKIGEIKYHGMGSGFPLQY 238          

HSP 2 Score: 29.6462 bits (65), Expect = 6.532e-6
Identity = 11/36 (30.56%), Postives = 21/36 (58.33%), Query Frame = 2
Query:  665 YRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Y QP V ++F ++ +N  +R+ C +  EN+    K+
Sbjct:  250 YLQPLVAVQFVNITQNTDLRIECKVYGENIDYSEKD 285          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 41.5874 bits (96), Expect = 1.096e-6
Identity = 30/129 (23.26%), Postives = 50/129 (38.76%), Query Frame = 3
Query:  258 SFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFR--------PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            S+  Y   L  F A Y          +C    YF           P++SC F       C+    + +GY E +PC++IK+N++ G +P     T  +          D + +G + Y+     +N  Y
Sbjct:   95 SWDMYAQALDKFLAPYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPSVTC---AAKRDDSDKLGELVYFPPNGTFNLMY 220          

HSP 2 Score: 29.261 bits (64), Expect = 1.096e-6
Identity = 17/54 (31.48%), Postives = 28/54 (51.85%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKV--DFKESAGSV 787
            +PY   K   +Y QP V +KF ++  N  + + C + A N+ +  D  + AG V
Sbjct:  221 YPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKINANNIPLGGDRDKFAGRV 274          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 39.2762 bits (90), Expect = 5.243e-6
Identity = 21/84 (25.00%), Postives = 39/84 (46.43%), Query Frame = 3
Query:  369 PRKSCYFGLDFGVGCT--IQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDY 614
            P++SC F       C+    + +GY E +PC++IK+N++ G +P     T  +          D + +G + Y+     +N  Y
Sbjct:  136 PKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPSVTC---AAKRDDSDKLGELVYFPPNGTFNLMY 216          

HSP 2 Score: 29.261 bits (64), Expect = 5.243e-6
Identity = 17/54 (31.48%), Postives = 28/54 (51.85%), Query Frame = 2
Query:  641 FPY---KRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKV--DFKESAGSV 787
            +PY   K   +Y QP V +KF ++  N  + + C + A N+ +  D  + AG V
Sbjct:  217 YPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKINANNIPLGGDRDKFAGRV 270          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Match: SMESG000015215.1 (SMESG000015215.1)

HSP 1 Score: 360.147 bits (923), Expect = 8.037e-127
Identity = 191/194 (98.45%), Postives = 191/194 (98.45%), Query Frame = 3
Query:   75 MLVSVGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDYQYGRISNLFFHTKE 656
            MLVSVGVTIGTYVLHSYLNYSVDYPPYSGTNTLLNLTPSLSIIPNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDYQYGRISNLFF  K 
Sbjct:    1 MLVSVGVTIGTYVLHSYLNYSVDYPPYSGTNTLLNLTPSLSIIPNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYNCDYQYGRISNLFFPYKR 194          

HSP 2 Score: 106.301 bits (264), Expect = 2.126e-27
Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 2
Query:  641 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV
Sbjct:  190 FPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 238          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Match: SMESG000022447.1 (SMESG000022447.1)

HSP 1 Score: 135.576 bits (340), Expect = 5.865e-38
Identity = 85/219 (38.81%), Postives = 130/219 (59.36%), Query Frame = 3
Query:   66 LILMLVSVGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFG-VGCTIQKLFGYSELKPCVLIKINKIYGWVPQ-----LKNATRD----IKIKCDGVSSTDQELIGIICYYDYTTKYN------------CDYQYGRISNLFFHTKE 656
            L+  ++ +G+ I  + L +Y     D PP SG  +LL L PSLSI+P  +SLSS+IK++  KRY++A+Y+HDL  +  NYERH   + L DC     +   P+ SC F LD G +GC +   +G+ + +PCVLI++N+IYGW+P      + N+T++    IKIKC+GV+  D+E IG +CYYD  +               C  +YG+I N ++  K+
Sbjct:   37 LVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKK 255          

HSP 2 Score: 51.6026 bits (122), Expect = 1.654e-7
Identity = 20/53 (37.74%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  623 QNKQFVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAG 781
            Q + + +PYK+  SY+ PF+++KF  L RNV+I V CW    N+ ++ ++  G
Sbjct:  245 QIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTG 297          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Match: SMESG000022444.1 (SMESG000022444.1)

HSP 1 Score: 135.576 bits (340), Expect = 5.865e-38
Identity = 85/219 (38.81%), Postives = 130/219 (59.36%), Query Frame = 3
Query:   66 LILMLVSVGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFG-VGCTIQKLFGYSELKPCVLIKINKIYGWVPQ-----LKNATRD----IKIKCDGVSSTDQELIGIICYYDYTTKYN------------CDYQYGRISNLFFHTKE 656
            L+  ++ +G+ I  + L +Y     D PP SG  +LL L PSLSI+P  +SLSS+IK++  KRY++A+Y+HDL  +  NYERH   + L DC     +   P+ SC F LD G +GC +   +G+ + +PCVLI++N+IYGW+P      + N+T++    IKIKC+GV+  D+E IG +CYYD  +               C  +YG+I N ++  K+
Sbjct:   37 LVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKK 255          

HSP 2 Score: 51.6026 bits (122), Expect = 1.654e-7
Identity = 20/53 (37.74%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  623 QNKQFVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAG 781
            Q + + +PYK+  SY+ PF+++KF  L RNV+I V CW    N+ ++ ++  G
Sbjct:  245 QIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTG 297          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Match: SMESG000022443.1 (SMESG000022443.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.078e-37
Identity = 78/225 (34.67%), Postives = 127/225 (56.44%), Query Frame = 3
Query:   36 KKFIYSGFHSLILMLVSVGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLD-FGVGCTIQKLFGYSELKPCVLIKINKIYGWVPQLKNATRD---------IKIKCDGVSSTDQELIGIICYYD------------YTTKYNCDYQYGRISNLFF 644
            K+  +  F +LIL+ + + +    ++L  ++    DYPP +G  ++L + PSL+I+P  +SL+S I++++ KRYS+  Y+HDL GFT  YERH   + L DC     +   P+ SC F LD   +GC I   +GY +L PC+L+ +N++ GW+P+ K   ++         IKIKC+G+   D+E +G ICYYD             + K  C+  YG+I   ++
Sbjct:   32 KRIAFLTFQNLILICIGLSM----FLLCEFMVLKRDYPPLTGKRSVLQMRPSLTILPRPDSLTSTIRYRNRKRYSYGKYIHDLYGFTQTYERHLENSELTDCTHFSSYINDPKYSCKFSLDKSSLGCHIGNHYGYEDLNPCILVHLNRVIGWIPEFKENEQNHSSPNRYSTIKIKCEGIHDFDKENVGKICYYDEESGIPGNYAALQSEKNGCNSNYGQIRRYYY 252          

HSP 2 Score: 42.3578 bits (98), Expect = 2.078e-37
Identity = 16/50 (32.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query:  623 QNKQFVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKE 772
            Q +++ +PY +  +Y+ PFV++K     RNV+I + CW    +V+ +  E
Sbjct:  246 QIRRYYYPYIKQINYQTPFVWVKISGTTRNVVIMIQCWAFTNDVESNINE 295          
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Match: SMESG000022450.1 (SMESG000022450.1)

HSP 1 Score: 131.339 bits (329), Expect = 1.946e-36
Identity = 78/212 (36.79%), Postives = 122/212 (57.55%), Query Frame = 3
Query:   87 VGVTIGTYVLHSYLNYSVDYPPYSGTXXXXXXXXXXXXXXNVNSLSSLIKFKDGKRYSFANYLHDLIGFTANYERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFG-VGCTIQKLFGYSELKPCVLIKINKIYGWVPQL---------KNATRDIKIKCDGVSSTDQELIGIICYYDYTTKYN------------CDYQYGRISNLFFHTKE 656
            +G TI  + L  +L    D+PP +G  + LNL P LS++P  +SL+SLI++K G+R+S+ +Y+HDL  F  NYERH+  + L DC     +   P+ SC F LD G +GC +   +G+ E +PC+LI++N++ GW+P           +N    IKIKC+G+S  D++ +G ICYYD  +               C  ++G+I N +F  K+
Sbjct:   44 LGFTILMFTLAIFLYLYRDFPPLTGEQSGLNLQPELSVLPRPDSLTSLIRYKIGQRHSYGSYVHDLYSFIQNYERHRERSRLLDCTHHVSYIDHPKFSCKFSLDVGNIGCNMGNQYGFDEAQPCILIRLNRVIGWMPGFGEDSVNTTNQNGYPTIKIKCEGISDFDKDNVGKICYYDEESALRKTEELLPNQDGGCSEEFGQIRNYYFPYKK 255          

HSP 2 Score: 55.4546 bits (132), Expect = 8.205e-9
Identity = 22/55 (40.00%), Postives = 37/55 (67.27%), Query Frame = 2
Query:  623 QNKQFVFPYKRDSSYRQPFVFIKFQSLMRNVLIRVHCWMEAENVKVDFKESAGSV 787
            Q + + FPYK+  SY+ PFV++KF  + RNV++ V CW   +N+KV+ ++  G +
Sbjct:  245 QIRNYYFPYKKQLSYQTPFVWVKFNEVRRNVVVMVQCWPIVDNIKVNSEDGTGYI 299          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B14.111e-724.48ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B14.111e-724.48ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B41.887e-627.94ATPase Na+/K+ transporting family member beta 4 [S... [more]
ATP1B41.895e-627.94ATPase Na+/K+ transporting family member beta 4 [S... [more]
ATP1B42.000e-627.94ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-13.573e-1329.71Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-13.573e-1329.71Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-13.573e-1329.71Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-31.661e-1126.90Probable sodium/potassium-transporting ATPase subu... [more]
nkb-31.910e-1126.90Probable sodium/potassium-transporting ATPase subu... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv29.909e-1324.68gene:FBgn0015777 transcript:FBtr0100382[more]
nrv29.909e-1324.68gene:FBgn0015777 transcript:FBtr0079381[more]
nrv29.909e-1324.68gene:FBgn0015777 transcript:FBtr0332369[more]
nrv21.041e-1224.68gene:FBgn0015777 transcript:FBtr0079382[more]
nrv21.041e-1224.68gene:FBgn0015777 transcript:FBtr0079383[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp1b2a3.076e-726.36ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b2a3.958e-726.36ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b2a5.243e-626.87ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b1a8.118e-625.84ATPase Na+/K+ transporting subunit beta 1a [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam151a6.590e-832.94family with sequence similarity 151 member A [Sour... [more]
tpst24.520e-725.68tyrosylprotein sulfotransferase 2 [Source:Xenbase;... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atp1b11.003e-725.79ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93235|AT1B1_CAEEL3.501e-1229.71Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|Q24048|ATPB2_DROME7.234e-1224.68Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|P25169|AT1B1_ARTSF1.533e-1128.10Sodium/potassium-transporting ATPase subunit beta ... [more]
sp|Q9XUY5|AT1B3_CAEEL1.628e-1026.90Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q24046|ATPB1_DROME9.530e-1028.80Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VSU93.970e-2534.67Putative sodium/potassium-dependent atpase beta su... [more]
A0A564Z4P21.157e-2429.23Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A183TJ601.397e-2428.49Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7PWL61.557e-2433.33Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A430QRC91.774e-2439.35Sodium/potassium-transporting ATPase subunit beta ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2a7.360e-825.53sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b3.494e-727.38sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b4.395e-727.38sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b4.834e-728.26sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1a6.532e-625.60sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp1b2b1.096e-623.26ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b2b5.243e-625.00ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015215.18.037e-12798.45SMESG000015215.1[more]
SMESG000022447.15.865e-3838.81SMESG000022447.1[more]
SMESG000022444.15.865e-3838.81SMESG000022444.1[more]
SMESG000022443.12.078e-3734.67SMESG000022443.1[more]
SMESG000022450.11.946e-3636.79SMESG000022450.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011504 ID=SMED30011504|Name=Sodium/potassium-transporting ATPase subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=788bp
TTTATTTTATTAATCGCAATTTTAAAATGAAATACAAAAAATTCATTTAT
TCTGGCTTTCATTCATTAATTTTAATGTTAGTTTCTGTTGGTGTCACAAT
TGGAACTTATGTTCTACATTCCTATTTAAATTATTCGGTCGACTATCCCC
CTTATTCTGGAACTAATACCCTACTAAATCTAACTCCAAGTTTGTCCATA
ATTCCCAACGTCAATTCTCTCTCTTCTTTAATAAAATTCAAGGATGGAAA
GCGTTACAGTTTTGCGAATTATTTGCACGATTTGATTGGATTTACGGCAA
ATTATGAGCGCCACAAAATCGGTAATCACCTTGAAGACTGTTTGGGTCAA
GGATATTTTTCTTTCAGGCCTCGGAAATCGTGCTATTTTGGTTTAGACTT
TGGAGTTGGATGTACAATCCAAAAACTGTTCGGATATTCAGAATTGAAAC
CTTGTGTGTTGATAAAAATTAATAAAATATATGGCTGGGTCCCGCAGTTA
AAAAATGCAACTCGAGATATTAAAATAAAGTGTGATGGAGTTTCTTCTAC
AGATCAAGAATTGATTGGGATTATTTGCTATTATGATTATACGACTAAAT
ACAACTGTGATTATCAGTATGGCAGAATAAGCAATTTGTTTTTCCATACA
AAAGAGATTCAAGCTATCGGCAGCCTTTTGTCTTCATCAAATTTCAAAGT
CTAATGAGGAATGTTCTAATAAGAGTTCATTGTTGGATGGAAGCAGAGAA
TGTTAAAGTAGATTTCAAAGAGTCAGCTGGAAGTGTAG
back to top

protein sequence of SMED30011504-orf-1

>SMED30011504-orf-1 ID=SMED30011504-orf-1|Name=SMED30011504-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
YFINRNFKMKYKKFIYSGFHSLILMLVSVGVTIGTYVLHSYLNYSVDYPP
YSGTNTLLNLTPSLSIIPNVNSLSSLIKFKDGKRYSFANYLHDLIGFTAN
YERHKIGNHLEDCLGQGYFSFRPRKSCYFGLDFGVGCTIQKLFGYSELKP
CVLIKINKIYGWVPQLKNATRDIKIKCDGVSSTDQELIGIICYYDYTTKY
NCDYQYGRISNLFFHTKEIQAIGSLLSSSNFKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000205oviduct
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006813potassium ion transport
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 46..233
e-value: 2.7E-27
score: 95.7
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 32..233
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 50..234
e-value: 1.6E-31
score: 111.7
NoneNo IPR availableTMHMMTMhelixcoord: 16..38