Transcriptional regulator ERG homolog

Overview
NameTranscriptional regulator ERG homolog
Smed IDSMED30011493
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcriptional regulator ERG homolog (SMED30011493) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcriptional regulator ERG homolog (SMED30011493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcriptional regulator ERG homolog (SMED30011493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcriptional regulator ERG homolog (SMED30011493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011493SMESG000036336.1 SmedASXL_005979SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011493SMESG000036336.1 SmedASXL_005978SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30011493SMESG000036336.1 SmedASXL_005979SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30011493SMESG000036336.1 dd_Smed_v4_21270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011493SMESG000036336.1 dd_Smed_v6_28005_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011493SMESG000036336.1 dd_Smed_v6_21270_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 195.667 bits (496), Expect = 8.396e-58
Identity = 94/149 (63.09%), Postives = 104/149 (69.80%), Query Frame = 1
Query:  196 ILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            I TRP    S   +  +      L  +  L   +        GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  251 ITTRPAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 399          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 195.667 bits (496), Expect = 8.411e-58
Identity = 94/149 (63.09%), Postives = 104/149 (69.80%), Query Frame = 1
Query:  196 ILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            I TRP    S   +  +      L  +  L   +        GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  244 ITTRPAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 392          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Match: FLI1 (Fli-1 proto-oncogene, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3749])

HSP 1 Score: 189.504 bits (480), Expect = 1.197e-57
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SD+
Sbjct:   86 GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDI 192          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 191.045 bits (484), Expect = 5.505e-57
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  193 GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 299          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 191.045 bits (484), Expect = 8.186e-57
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  217 GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 323          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 179.874 bits (455), Expect = 4.492e-55
Identity = 80/95 (84.21%), Postives = 87/95 (91.58%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMV 606
            GQIQLWQFLLELLAD+ N+  I+WEG+NGEFKL+DPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIMTKV GKRYAYKFDF GLAQA Q  +
Sbjct:   33 GQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQACQSAI 127          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 180.259 bits (456), Expect = 1.038e-54
Identity = 80/95 (84.21%), Postives = 87/95 (91.58%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMV 606
            GQIQLWQFLLELLAD+ N+  I+WEG+NGEFKL+DPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIMTKV GKRYAYKFDF GLAQA Q  +
Sbjct:   71 GQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQACQSAI 165          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 178.718 bits (452), Expect = 1.438e-52
Identity = 78/97 (80.41%), Postives = 85/97 (87.63%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGS 612
            GQ QLWQFLLELL+D R S  I+WEG  GEFKL+DPDEVAR+WGERKSKPNMNYDK+SRALRYYYDKNIM KVHGKRYAYKFDF G+AQA+QP   S
Sbjct:  212 GQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQPPTAS 308          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 121.709 bits (304), Expect = 4.558e-31
Identity = 52/81 (64.20%), Postives = 65/81 (80.25%), Query Frame = 1
Query:  328 IQLWQFLLELLADSRNSGFISW-EGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            I LWQFLLELL   +N   I W  G +GEF+LID + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 121.709 bits (304), Expect = 4.558e-31
Identity = 52/81 (64.20%), Postives = 65/81 (80.25%), Query Frame = 1
Query:  328 IQLWQFLLELLADSRNSGFISW-EGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            I LWQFLLELL   +N   I W  G +GEF+LID + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077055)

HSP 1 Score: 189.889 bits (481), Expect = 3.024e-58
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:   82 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 188          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0273355)

HSP 1 Score: 192.586 bits (488), Expect = 1.368e-56
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 421          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077054)

HSP 1 Score: 192.2 bits (487), Expect = 1.510e-56
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 421          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347000)

HSP 1 Score: 192.586 bits (488), Expect = 2.165e-55
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 421          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347001)

HSP 1 Score: 192.2 bits (487), Expect = 7.901e-55
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 421          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 184.111 bits (466), Expect = 2.179e-56
Identity = 86/114 (75.44%), Postives = 93/114 (81.58%), Query Frame = 1
Query:  301 TSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            T   K  GQIQLWQFLLELL+DS N   I+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP    ++  ++ S+ 
Sbjct:   29 TGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAIYKFQSNF 142          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 184.496 bits (467), Expect = 3.306e-56
Identity = 86/114 (75.44%), Postives = 93/114 (81.58%), Query Frame = 1
Query:  301 TSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            T   K  GQIQLWQFLLELL+DS N   I+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP    ++  ++ S+ 
Sbjct:   49 TGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAIYKFQSNF 162          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 190.274 bits (482), Expect = 6.900e-56
Identity = 85/107 (79.44%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+G I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  287 GQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTMYKYPSEL 393          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 189.889 bits (481), Expect = 8.192e-56
Identity = 85/107 (79.44%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+G I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  278 GQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTMYKYPSEL 384          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Match: erg (ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-GENE-041212-40])

HSP 1 Score: 185.267 bits (469), Expect = 2.204e-54
Identity = 89/142 (62.68%), Postives = 104/142 (73.24%), Query Frame = 1
Query:  211 VNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTS 636
            V+  S+ ++S +    + L  +  L   +        GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y +
Sbjct:  218 VSQSSAAIMSKTEEQRAQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSCNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPDSSIYKYPA 359          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 189.119 bits (479), Expect = 3.081e-55
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  306 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSEL 412          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 188.734 bits (478), Expect = 3.299e-55
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  288 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSEL 394          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 189.119 bits (479), Expect = 4.933e-55
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  315 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSEL 421          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 187.963 bits (476), Expect = 7.428e-55
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  289 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSEL 395          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 187.578 bits (475), Expect = 9.354e-55
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y S+L
Sbjct:  287 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSEL 393          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 194.897 bits (494), Expect = 9.390e-58
Identity = 94/149 (63.09%), Postives = 104/149 (69.80%), Query Frame = 1
Query:  196 ILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            I TRP    S   +  +      L  +  L   +        GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  244 ITTRPAAQPSPSAVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 392          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 194.897 bits (494), Expect = 1.098e-57
Identity = 94/149 (63.09%), Postives = 104/149 (69.80%), Query Frame = 1
Query:  196 ILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            I TRP    S   +  +      L  +  L   +        GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  251 ITTRPAAQPSPSAVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 399          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.045 bits (484), Expect = 7.489e-57
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  217 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 323          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.43 bits (485), Expect = 1.556e-56
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  269 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 375          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.815 bits (486), Expect = 2.105e-56
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  292 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 398          
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Match: sp|Q01414|ERG_LYTVA (Transcriptional regulator ERG homolog (Fragment) OS=Lytechinus variegatus OX=7654 GN=ERG PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.291e-60
Identity = 89/107 (83.18%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP+    S  RY SDL
Sbjct:    2 GQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPVQADPSMYRYQSDL 108          
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Match: sp|P29774|ETS3_DROME (DNA-binding protein D-ETS-3 OS=Drosophila melanogaster OX=7227 GN=Ets65A PE=2 SV=3)

HSP 1 Score: 192.2 bits (487), Expect = 1.514e-55
Identity = 87/108 (80.56%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            GQIQLWQFLLELL+DS N+  I+WEG NGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QP     ++ +Y SDLF
Sbjct:  315 GQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAASDPTY-KYQSDLF 421          
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Match: sp|Q90837|ERG_CHICK (Transcriptional regulator Erg OS=Gallus gallus OX=9031 GN=ERG PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.991e-55
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  308 GQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSMYKYPSDL 414          
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Match: sp|P11308|ERG_HUMAN (Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 2.143e-55
Identity = 87/107 (81.31%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NS  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  316 GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDL 422          
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Match: sp|A3FEM2|FEV_DANRE (Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.496e-55
Identity = 86/114 (75.44%), Postives = 93/114 (81.58%), Query Frame = 1
Query:  301 TSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            T   K  GQIQLWQFLLELL+DS N   I+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP    ++  ++ S+ 
Sbjct:   49 TGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAIYKFQSNF 162          
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Match: A0A3Q8PZR7 (Transcriptional regulator ERG-like protein, isoform 2 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 2.836e-59
Identity = 98/166 (59.04%), Postives = 120/166 (72.29%), Query Frame = 1
Query:  157 SSWTMQSTKKDE-PILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            ++WT QS+ + + P+    +   S        +H ++L +    +  +  + W+ QG  QIQLWQFLLELL+DS N+G I+WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP     +  +Y  D+F
Sbjct:   32 TAWTPQSSPQSQVPLSGAEIPPRSIQKHPFPSYHPNSLPAITKSTLDSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPSSTDPTAYKYQQDIF 197          
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Match: A0A2T7NJ12 (ETS domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19309 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.606e-59
Identity = 91/114 (79.82%), Postives = 99/114 (86.84%), Query Frame = 1
Query:  310 WKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            W+ QG  QIQLWQFLLELL+DS N+G I+WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP  G  +  +Y  D+F
Sbjct:   57 WRPQGSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPATGDPTAYKYQQDIF 170          
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Match: A0A3Q8PZT1 (Transcriptional regulator ERG-like protein, isoform 1 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.585e-58
Identity = 98/166 (59.04%), Postives = 120/166 (72.29%), Query Frame = 1
Query:  157 SSWTMQSTKKDE-PILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            ++WT QS+ + + P+    +   S        +H ++L +    +  +  + W+ QG  QIQLWQFLLELL+DS N+G I+WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP     +  +Y  D+F
Sbjct:   32 TAWTPQSSPQSQVPLSGAEIPPRSIQKHPFPSYHPNSLPAITKSTLDSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPSSTDPTAYKYQQDIF 197          
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Match: Q7M4I0 (Transcription factor erg/fli-1 homolog (Fragment) OS=Hediste diversicolor OX=126592 PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.646e-57
Identity = 97/150 (64.67%), Postives = 109/150 (72.67%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL----FSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNV 759
            GQIQLWQFLLELL+DS NS  I+WEG NGEFKL+DPDE ARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP     +  +Y  DL    + H     + AA   MA+  S       P+ +SL  +N+
Sbjct:    3 GQIQLWQFLLELLSDSANSHIITWEGTNGEFKLVDPDETARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPSTTDPAAYKYQQDLLMSGYHHTSKLNLMAAHAPMASSASGFFPPPAPYWSSLVGSNL 152          
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Match: K1R5Y9 (Retroviral integration site protein Fli-1-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10013593 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.651e-57
Identity = 96/142 (67.61%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  226 SVVISNSYHHSSALCSFGGLSKANYTSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLF 645
            S   S  Y H   L +          S W+ QG  QIQLWQFLLELL+DS NS +I+WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP     ++ +Y  D F
Sbjct:   34 SSPASPGYPHPGTLPAITKPGFDGPHSHWRPQGSGQIQLWQFLLELLSDSSNSNYITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPAADPTAY-KYQQDFF 174          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 193.356 bits (490), Expect = 3.995e-57
Identity = 87/107 (81.31%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NSG I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y +DL
Sbjct:  301 GQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDL 407          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 191.815 bits (486), Expect = 4.289e-57
Identity = 87/107 (81.31%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NSG I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y +DL
Sbjct:  249 GQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDL 355          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 193.356 bits (490), Expect = 5.695e-57
Identity = 87/107 (81.31%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NSG I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y +DL
Sbjct:  318 GQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDL 424          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 193.356 bits (490), Expect = 6.453e-57
Identity = 87/107 (81.31%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS NSG I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y +DL
Sbjct:  328 GQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDL 434          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Match: fli1a (Friend leukemia integration 1 transcription factor [Source:NCBI gene;Acc:103025486])

HSP 1 Score: 192.2 bits (487), Expect = 1.375e-56
Identity = 86/107 (80.37%), Postives = 94/107 (87.85%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+G I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     +  +Y SDL
Sbjct:  277 GQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTMYKYPSDL 383          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 189.119 bits (479), Expect = 3.933e-59
Identity = 85/107 (79.44%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y S+L
Sbjct:   32 GQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSVYKYPSEL 138          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 158.688 bits (400), Expect = 1.804e-47
Identity = 69/84 (82.14%), Postives = 78/84 (92.86%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF 573
            GQIQLWQFLLELL+D+ N+  I+WEG  GEFKL DPDEVAR+WG+RK+KPNMNYDKLSRALRYYYDKNIM+KVHGKRYAY+FDF
Sbjct:    4 GQIQLWQFLLELLSDAANAHCIAWEGACGEFKLTDPDEVARQWGKRKAKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDF 87          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002472.1 (pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 gene:ENSPMAG00000002241.1 transcript:ENSPMAT00000002472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.614e-32
Identity = 54/101 (53.47%), Postives = 71/101 (70.30%), Query Frame = 1
Query:  265 LCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            +C F    + +    +  +G +QLWQFL+ LL D  ++G I W G   EFKL+DP+EVAR WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:  360 VCGF----RESLPPVYPRRGSLQLWQFLVALLEDPAHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 456          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 120.553 bits (301), Expect = 8.256e-32
Identity = 51/86 (59.30%), Postives = 67/86 (77.91%), Query Frame = 1
Query:  310 WKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            ++ +G +QLWQFL+ LL D  N   I+W G   EFKL++P+EVAR+WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:  159 YQRRGSLQLWQFLVALLDDPANGHLITWTGRGMEFKLLEPEEVARKWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 244          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006723.1 (pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gene:ENSPMAG00000006043.1 transcript:ENSPMAT00000006723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 6.616e-31
Identity = 51/86 (59.30%), Postives = 67/86 (77.91%), Query Frame = 1
Query:  310 WKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            ++ +G +QLWQFL+ LL D  ++G I W G   EFKL+DP+EVAR WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY Y+F
Sbjct:  365 YQRRGSLQLWQFLVALLEDPVHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYRF 450          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 175.637 bits (444), Expect = 4.795e-55
Identity = 78/95 (82.11%), Postives = 87/95 (91.58%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMV 606
            GQIQLWQFLLELL+D +N+  I+WEG NGEFKL+DPDEVARRWGERK+KPNMNYDKLSRALRYYYDKNIMTK+HGKRYAYK+DF GLAQ  QP+ 
Sbjct:   13 GQIQLWQFLLELLSDPKNANCIAWEGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKYDFQGLAQLNQPIT 107          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Match: EDO37550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF5])

HSP 1 Score: 122.479 bits (306), Expect = 1.696e-34
Identity = 54/86 (62.79%), Postives = 68/86 (79.07%), Query Frame = 1
Query:  310 WKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            ++ +G +QLWQFL+ LL +   S FI+W G   EFKLIDP+EVARRWG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:    1 FQRRGSLQLWQFLVALLDEPECSSFIAWTGRGLEFKLIDPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 86          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Match: EDO43493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB7])

HSP 1 Score: 122.094 bits (305), Expect = 2.717e-34
Identity = 53/80 (66.25%), Postives = 64/80 (80.00%), Query Frame = 1
Query:  328 IQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            IQLWQFLLELL D      I W G  GEFKL DP++VA++WG+RK+KP MNY+KLSRALRYYYD +++ KVHGKR+ YKF
Sbjct:    1 IQLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKF 80          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 112.464 bits (280), Expect = 4.999e-31
Identity = 53/81 (65.43%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  328 IQLWQFLLELLADSRNSGFISWEG-NNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            I LW+FLL+LLAD R S  ISW    +GEFKL++ +EVARRWG  K +P MNYDKLSRALRYYY K I+ KVHG+R  YKF
Sbjct:    3 IHLWEFLLDLLADGRYSSIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKF 83          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 108.612 bits (270), Expect = 1.391e-29
Identity = 51/81 (62.96%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  328 IQLWQFLLELLADSRNSGFISW-EGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 567
            + LW+FLLELLAD   +  ISW +   GEFKL + +EVARRWG+ K +P MNYDKLSRALRYYY KNI+ KV+G+R  YKF
Sbjct:    3 VHLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKF 83          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 184.111 bits (466), Expect = 2.308e-56
Identity = 85/114 (74.56%), Postives = 92/114 (80.70%), Query Frame = 1
Query:  301 TSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            T   K  GQIQLWQFLLELL+DS N   I+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP    ++  ++  + 
Sbjct:   36 TGVQKGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQPTTTEQAIYKFQGNF 149          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 184.496 bits (467), Expect = 3.734e-56
Identity = 85/114 (74.56%), Postives = 92/114 (80.70%), Query Frame = 1
Query:  301 TSCWKSQGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            T   K  GQIQLWQFLLELL+DS N   I+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP    ++  ++  + 
Sbjct:   64 TGVQKGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQPTTTEQAIYKFQGNF 177          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 189.504 bits (480), Expect = 3.803e-56
Identity = 86/107 (80.37%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  249 GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDL 355          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 189.889 bits (481), Expect = 5.470e-56
Identity = 86/107 (80.37%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  278 GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDL 384          
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 190.274 bits (482), Expect = 5.803e-56
Identity = 86/107 (80.37%), Postives = 93/107 (86.92%), Query Frame = 1
Query:  322 GQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDL 642
            GQIQLWQFLLELL+DS N+  I+WEG NGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP     S  +Y SDL
Sbjct:  285 GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDL 391          
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 307/309 (99.35%), Postives = 307/309 (99.35%), Query Frame = 1
Query:   91 MERKIILYIISAVFESNKTTVHSSWTMQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGXXXXXXXXXXXXXXXXXXXXXXXXNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL 1011
            MERKIILYIISAVFESNKTTVHSSWTMQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG  QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGYAAYWSAAAAHQSSAALFSLQQQYNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL
Sbjct:    1 MERKIILYIISAVFESNKTTVHSSWTMQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGYAAYWSAAAAHQSSAALFSLQQQYNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL 309          
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 281/283 (99.29%), Postives = 281/283 (99.29%), Query Frame = 1
Query:  169 MQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGXXXXXXXXXXXXXXXXXXXXXXXXNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL 1011
            MQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQG  QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGYAAYWSAAAAHQSSAALFSLQQQYNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL
Sbjct:    1 MQSTKKDEPILTRPVNDLSSVVISNSYHHSSALCSFGGLSKANYTSCWKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSKSGYAAYWSAAAAHQSSAALFSLQQQYNQQHNHGPALTSVLNSSNFYPMSLNNNDPFL 283          
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 198.749 bits (504), Expect = 2.122e-60
Identity = 103/168 (61.31%), Postives = 115/168 (68.45%), Query Frame = 1
Query:  301 TSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGS------------ESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHH--ASLSPNN 756
            T+ W+ QG  QIQLWQFLLELL+DSRN+ FI+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP   +             S  +Y  DLF+     +++ A               W HH  A +SP N
Sbjct:   67 TNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPA---------------WQHHISAGMSPTN 219          
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 198.749 bits (504), Expect = 2.297e-60
Identity = 103/168 (61.31%), Postives = 115/168 (68.45%), Query Frame = 1
Query:  301 TSCWKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGS------------ESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHH--ASLSPNN 756
            T+ W+ QG  QIQLWQFLLELL+DSRN+ FI+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP   +             S  +Y  DLF+     +++ A               W HH  A +SP N
Sbjct:   70 TNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPA---------------WQHHISAGMSPTN 222          
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Match: SMESG000080027.1 (SMESG000080027.1)

HSP 1 Score: 186.422 bits (472), Expect = 8.923e-55
Identity = 85/99 (85.86%), Postives = 89/99 (89.90%), Query Frame = 1
Query:  310 WKSQG--QIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQP 600
            W+ QG  QIQLWQFLLELL+DSRN   I WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQAM P
Sbjct:  130 WRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 228          
The following BLAST results are available for this feature:
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERG8.396e-5863.09ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
ERG8.411e-5863.09ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
FLI11.197e-5779.44Fli-1 proto-oncogene, ETS transcription factor [So... [more]
ERG5.505e-5781.31ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
ERG8.186e-5781.31ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets-54.492e-5584.21ETS domain-containing transcription factor ets-5 ... [more]
ets-51.038e-5484.21ETS domain-containing transcription factor ets-5 ... [more]
ast-11.438e-5280.41Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
lin-14.558e-3164.20LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
lin-14.558e-3164.20LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets65A3.024e-5880.56gene:FBgn0005658 transcript:FBtr0077055[more]
Ets65A1.368e-5680.56gene:FBgn0005658 transcript:FBtr0273355[more]
Ets65A1.510e-5680.56gene:FBgn0005658 transcript:FBtr0077054[more]
Ets65A2.165e-5580.56gene:FBgn0005658 transcript:FBtr0347000[more]
Ets65A7.901e-5580.56gene:FBgn0005658 transcript:FBtr0347001[more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev2.179e-5675.44FEV transcription factor, ETS family member [Sourc... [more]
fev3.306e-5675.44FEV transcription factor, ETS family member [Sourc... [more]
fli1a6.900e-5679.44Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fli1a8.192e-5679.44Fli-1 proto-oncogene, ETS transcription factor a [... [more]
erg2.204e-5462.68ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erg3.081e-5579.44v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg3.299e-5579.44v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg4.933e-5579.44v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg7.428e-5579.44v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg9.354e-5579.44v-ets avian erythroblastosis virus E26 oncogene ho... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erg9.390e-5863.09ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg1.098e-5763.09ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg7.489e-5781.31ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg1.556e-5681.31ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg2.105e-5681.31ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01414|ERG_LYTVA4.291e-6083.18Transcriptional regulator ERG homolog (Fragment) O... [more]
sp|P29774|ETS3_DROME1.514e-5580.56DNA-binding protein D-ETS-3 OS=Drosophila melanoga... [more]
sp|Q90837|ERG_CHICK1.991e-5581.31Transcriptional regulator Erg OS=Gallus gallus OX=... [more]
sp|P11308|ERG_HUMAN2.143e-5581.31Transcriptional regulator ERG OS=Homo sapiens OX=9... [more]
sp|A3FEM2|FEV_DANRE2.496e-5575.44Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q8PZR72.836e-5959.04Transcriptional regulator ERG-like protein, isofor... [more]
A0A2T7NJ123.606e-5979.82ETS domain-containing protein OS=Pomacea canalicul... [more]
A0A3Q8PZT12.585e-5859.04Transcriptional regulator ERG-like protein, isofor... [more]
Q7M4I01.646e-5764.67Transcription factor erg/fli-1 homolog (Fragment) ... [more]
K1R5Y91.651e-5767.61Retroviral integration site protein Fli-1-like pro... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erg3.995e-5781.31ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg4.289e-5781.31ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg5.695e-5781.31ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg6.453e-5781.31ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
fli1a1.375e-5680.37Friend leukemia integration 1 transcription factor... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fli1a3.933e-5979.44Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fev1.804e-4782.14FEV transcription factor, ETS family member [Sourc... [more]
ENSPMAT00000002472.13.614e-3253.47pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 ... [more]
etv18.256e-3259.30ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000006723.16.616e-3159.30pep scaffold:Pmarinus_7.0:GL483008:681:12314:1 gen... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399734.795e-5582.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375501.696e-3462.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434932.717e-3466.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443394.999e-3165.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453101.391e-2962.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev2.308e-5674.56protein FEV [Source:NCBI gene;Acc:111946795][more]
fev3.734e-5674.56protein FEV [Source:NCBI gene;Acc:111946795][more]
fli1a3.803e-5680.37Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a5.470e-5680.37Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a5.803e-5680.37Fli-1 proto-oncogene, ETS transcription factor [So... [more]
back to top
BLAST of Transcriptional regulator ERG homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036336.10.000e+099.35SMESG000036336.1[more]
SMESG000036336.10.000e+099.29SMESG000036336.1[more]
SMESG000078333.12.122e-6061.31SMESG000078333.1[more]
SMESG000078333.12.297e-6061.31SMESG000078333.1[more]
SMESG000080027.18.923e-5585.86SMESG000080027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011493 ID=SMED30011493|Name=Transcriptional regulator ERG homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
AAGGAAAAATAAGAGAACAAATGAAAAGAGAGGCCCAGGTATATCCGCAT
TGATTGATGTGGGGGTGATGTAGCTGTGTCAGCAAGTGTAATGGAGAGGA
AAATAATATTATATATTATTTCCGCCGTGTTTGAAAGTAATAAAACAACT
GTTCACAGTTCCTGGACAATGCAGTCTACTAAAAAGGATGAGCCAATATT
AACACGTCCTGTTAATGATCTTTCTTCAGTTGTTATATCTAATTCATATC
ATCATTCTTCAGCTCTTTGCAGTTTCGGAGGTTTATCGAAAGCCAATTAT
ACTTCATGTTGGAAATCTCAAGGTCAAATTCAATTGTGGCAATTTTTGCT
CGAACTTTTGGCTGATAGTCGAAACTCGGGTTTTATATCTTGGGAAGGTA
ACAATGGAGAATTCAAGTTAATTGATCCCGACGAAGTAGCTCGTCGATGG
GGAGAACGAAAAAGTAAACCGAACATGAATTATGACAAACTCAGTAGAGC
ATTGAGATATTATTATGACAAAAATATAATGACAAAGGTTCATGGTAAAC
GATACGCTTATAAATTTGATTTTGTTGGCCTGGCACAAGCAATGCAACCG
ATGGTTGGCAGTGAATCCTTTTGCCGATACACGTCGGATCTATTTTCCCA
CAACGACCCAAACTACATATCAGCCGCCGCAGTTGCAATGGCCACAAGAA
ATAGCAGATGCTCGAGTTCAATTTGGCCACATCATGCCAGTCTCTCACCA
AATAATGTCGATCATAATTCATCCTATCCATACAAATCAGTTTTTAACAG
TCAACAAATGCCAGATCTGTGTTTCAATCAGTTGTCGAAGTCTGGTTATG
CAGCGTATTGGTCAGCCGCTGCCGCACATCAGAGCAGTGCCGCGTTATTT
TCGCTACAACAGCAATACAACCAGCAGCACAATCACGGTCCTGCATTGAC
ATCTGTATTGAACTCTTCAAATTTTTATCCAATGTCTCTTAATAATAATG
ACCCATTTCTTTATTATAATTGAAATTAATACAATAATTATTATCAAATA
CAACATTTCTTTTATTTTAAAAAAAAAGAT
back to top

protein sequence of SMED30011493-orf-1

>SMED30011493-orf-1 ID=SMED30011493-orf-1|Name=SMED30011493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MERKIILYIISAVFESNKTTVHSSWTMQSTKKDEPILTRPVNDLSSVVIS
NSYHHSSALCSFGGLSKANYTSCWKSQGQIQLWQFLLELLADSRNSGFIS
WEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKV
HGKRYAYKFDFVGLAQAMQPMVGSESFCRYTSDLFSHNDPNYISAAAVAM
ATRNSRCSSSIWPHHASLSPNNVDHNSSYPYKSVFNSQQMPDLCFNQLSK
SGYAAYWSAAAAHQSSAALFSLQQQYNQQHNHGPALTSVLNSSNFYPMSL
NNNDPFLYYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0000980RNA polymerase II distal enhancer sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001077transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006366transcription from RNA polymerase II promoter
GO:0007599hemostasis
GO:0008015blood circulation
GO:0009887animal organ morphogenesis
GO:0030154cell differentiation
GO:0035855megakaryocyte development
GO:0045944positive regulation of transcription from RNA polymerase II promoter
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005829cytosol
GO:0016604nuclear body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 123..141
score: 72.42
coord: 104..122
score: 54.4
coord: 80..93
score: 65.31
coord: 142..160
score: 52.93
IPR000418Ets domainSMARTSM00413etsneu2coord: 79..164
e-value: 2.1E-56
score: 203.4
IPR000418Ets domainPFAMPF00178Etscoord: 81..159
e-value: 5.5E-36
score: 122.9
IPR000418Ets domainPROSITEPS00345ETS_DOMAIN_1coord: 82..90
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 126..141
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 80..160
score: 46.919
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 47..173
e-value: 1.9E-47
score: 162.3
NoneNo IPR availablePANTHERPTHR11849:SF274DNA-BINDING PROTEIN D-ETS-3coord: 44..237
NoneNo IPR availablePANTHERPTHR11849ETScoord: 44..237
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 78..223