EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30011490
Length (bp)670
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein (SMED30011490) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30011490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein (SMED30011490) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30011490) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011490SMESG000026288.1 SmedASXL_006699SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30011490SMESG000026288.1 dd_Smed_v4_824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30011490SMESG000026288.1 dd_Smed_v4_824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011490SMESG000026288.1 dd_Smed_v6_824_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011490SMESG000026288.1 dd_Smed_v6_824_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30011490SMESG000026288.1 dd_Smed_v6_824_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30011490SMESG000026288.1 dd_Smed_v4_824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011490SMESG000026288.1 dd_Smed_v4_824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P14202|TEGU_SCHMA (Tegument antigen OS=Schistosoma mansoni OX=6183 GN=A12 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.616e-12
Identity = 49/188 (26.06%), Postives = 104/188 (55.32%), Query Frame = 2
Query:   38 AQIKMATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXX--XXPKSDQMLDDIIEKTKELR-----KEHPDQN-------KIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMS 559
             + K++ M++ F+ AF  ID  + + I  ++L+++  K   D K +D W+  FD ++   I++EEFC   GL++ E+  ++++ ++E++    + P + +++   + KTK+       KE+ D         + VA+++K  ++  Y R W ++++ G YW ++S+ P  +  FK NN   + +R+ S
Sbjct:    3 TETKLSQMEE-FIRAFLEIDADSNEMIDKQELIKYCQKYRLDMKLIDPWIARFDTDKDNKISIEEFCRGFGLKVSEIRREKDELKKERDGKFPKLPPNIEIIAATMSKTKQYEICCQFKEYVDNTSRTGNDMREVANKMKSLLDNTYGRVWQVVLLTGSYWMNFSHEPFLSIQFKYNNYVCLAWRTPS 189          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A0X3NX37 (Antigen Sm21.7 OS=Schistocephalus solidus OX=70667 GN=SM21 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.907e-23
Identity = 64/172 (37.21%), Postives = 105/172 (61.05%), Query Frame = 2
Query:   65 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXXXXPKSD-QMLDD--------IIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
            DA + AFF+ID+ +T KIT   L +++  N+ DE F+++W  LFD   +GVITL+ FCDVLGLEL E++E R+K+      +  P    Q+ +D        I E  KE  +++ D  + +   LK  ++E+Y R W + ++RGQY+A+YSY   +++ FK +   +V+F++
Sbjct:    2 DALMEAFFTIDKDHTDKITMDALEQYRLDNDLDESFINQWKKLFDPGNSGVITLQTFCDVLGLELAEVQEDRDKFVAAATPSTIPAGILQIAEDMDLQRRLEIFELVKEAEEKNGDNERDIVKWLKLILDEKYGRVWHVFVVRGQYYAYYSYEAGNSYCFKKDKRIYVVFKT 173          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.763e-22
Identity = 57/173 (32.95%), Postives = 95/173 (54.91%), Query Frame = 2
Query:   53 ATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFC---DVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLD---DIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
             TM DAF+ A+F+ID +   +IT+ QL  +  +NNYDE FV KWL LFD + +G ITL+E+C    +   ++K     + +            SD  L+    IIE  ++ ++ +    K +A  +K+  + + +R W ++II GQ+W  YS+ P  +F+F+L      I+R+
Sbjct:    3 VTMTDAFIDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSDMTLELQLRIIEIVRDGQRLNS-MEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRT 174          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A2H1CKG3 (EF hand OS=Fasciola hepatica OX=6192 GN=D915_04679 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.003e-22
Identity = 54/172 (31.40%), Postives = 97/172 (56.40%), Query Frame = 2
Query:   65 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCD--------VXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKE--HPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFR 550
            D F+++F ++D   + +IT  +L ++   NN D   V KW+ LFD ++TGVITLE FCD        V     +  + +R         ++ P  DQ+   I+++TK+L K   +PD    ++S+LK++ ++ +  AW + I+ G YW  +S+LPE++F F  +N  ++ ++
Sbjct:    2 DTFINSFLAVDADGSGQITEDELRQYVTDNNMDSMMVTKWMQLFDPDKTGVITLENFCDKLGLKPEEVERQRAETTQAERIPSDIMVIYDKLPIKDQV--QIVKETKKLAKNVNNPDDYIQLSSQLKQFADKEFGSAWQVAIVEGSYWITFSHLPENSFQFVYDNHAYLFWK 171          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A4E0RHQ2 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_003074 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.857e-22
Identity = 54/172 (31.40%), Postives = 97/172 (56.40%), Query Frame = 2
Query:   65 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCD--------VXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKE--HPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFR 550
            D F+++F ++D   + +IT  +L ++   NN D   V KW+ LFD ++TGVITLE FCD        V     +  + +R         ++ P  DQ+   I+++TK+L K   +PD    ++S+LK++ ++ +  AW + I+ G YW  +S+LPE++F F  +N  ++ ++
Sbjct:   18 DTFINSFLAVDADGSGQITEDELRQYVTDNNMDSMMVTKWMQLFDPDKTGVITLENFCDKLGLKPEEVERQRAETTQAERIPSDIMVIYDKLPIKDQV--QIVKETKKLAKNVNNPDDYIQLSSQLKQFADKEFGSAWQVAIVEGSYWITFSHLPENSFQFVYDNHAYLFWK 187          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.991e-21
Identity = 56/171 (32.75%), Postives = 94/171 (54.97%), Query Frame = 2
Query:   59 MDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFC---DVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLD---DIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
            M DAF+ A+F+ID +   +IT+ QL  +  +NNYDE FV KWL LFD + +G ITL+E+C    +   ++K     + +            SD  L+    IIE  ++ ++ +    K +A  +K+  + + +R W ++II GQ+W  YS+ P  +F+F+L      I+R+
Sbjct:    1 MTDAFIDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSDMTLELQLRIIEIVRDGQRLNS-MEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRT 170          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026288.1 (SMESG000026288.1)

HSP 1 Score: 298.13 bits (762), Expect = 5.138e-104
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 2
Query:   50 MATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD 562
            MATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD
Sbjct:    1 MATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD 171          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026288.1 (SMESG000026288.1)

HSP 1 Score: 290.812 bits (743), Expect = 3.040e-101
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 2
Query:   59 MDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD 562
            MDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD
Sbjct:    1 MDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRSMSD 168          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006950.1 (SMESG000006950.1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.294e-26
Identity = 57/176 (32.39%), Postives = 92/176 (52.27%), Query Frame = 2
Query:   59 MDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFC-----------DVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
            MDDAF+ A+  ID+  +  ITA +L  +  +NNY E FV KWL LFDR+ TG ITLEEFC           D      +  +            N    ++ ++  +I K +EL   +P+  K  ++ +K+ ++   +  W  +I +GQYWA+YS  PE +   K+ N  ++++R+
Sbjct:    1 MDDAFIKAYCQIDKDGSGTITADELRAYMTENNYQEDFVTKWLRLFDRDNTGRITLEEFCETLGLEVSDFIDKRTALKESADFSLYNGVNILSSNMVQPNEGIVIQVIRKAREL---YPNSFKEQSTYIKQNLDLVLETTWHCIITKGQYWAYYSCEPECSLAVKIENIVYLLWRT 173          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000045029.1 (SMESG000045029.1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.729e-18
Identity = 48/171 (28.07%), Postives = 89/171 (52.05%), Query Frame = 2
Query:   65 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDDIIEKTKELRKEHPDQNKIVASELKKYIEE--------RYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
            D+F+ AFF+ID  ++ +I+  +L ++ NKN+Y  +F+ KWL +FD + +G ITLEE+C V       +E KR   Q        P++ ++L   +++ +         N I + +  K I +         Y   W   +I+GQ+W ++S+L   + +  ++    +IFR+
Sbjct:    2 DSFIEAFFAIDTDSSGEISTDELSDYMNKNHYRSEFIKKWLKIFDIDNSGTITLEEYCKV-----LGIEYKRASLQRRMSMYSIPENVKILQSTMDEGQRNNCIKIYLNAISSGDSPKGILKDVHENLILYYGTGWQCFLIKGQHWTYFSHLEGCSLIIHIDGFIFIIFRT 167          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026622.1 (SMESG000026622.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.092e-15
Identity = 58/180 (32.22%), Postives = 96/180 (53.33%), Query Frame = 2
Query:   65 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVXXXXXXXXXXXXXXXXXXXXXXXXPKSDQMLDD--IIEK--TKELRKEHPD---------QNKIVASELKKYIEER----YQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 553
            D F+ AFF+ID   +++IT  +L ++   NN  + FV KW+N+FD    GVITL+E+C V  L L   E +  + Q   E +  PK+  + DD  II+   T E+  E  D         QN   A ++ K+I+E     Y  +W  + + GQ+W+++S  P  +F +K     ++I+++
Sbjct:    2 DNFLTAFFNIDSDQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSV--LGLVTNEARIMREQFNIEHSAIPKT--LPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQN---APQVSKFIKEELDKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 174          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P14202|TEGU_SCHMA5.616e-1226.06Tegument antigen OS=Schistosoma mansoni OX=6183 GN... [more]
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NX375.907e-2337.21Antigen Sm21.7 OS=Schistocephalus solidus OX=70667... [more]
A0A267F2V42.763e-2232.95Dynein light chain (Fragment) OS=Macrostomum ligna... [more]
A0A2H1CKG36.003e-2231.40EF hand OS=Fasciola hepatica OX=6192 GN=D915_04679... [more]
A0A4E0RHQ27.857e-2231.40Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A1I8H6V51.991e-2132.75Dynein light chain OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026288.15.138e-104100.00SMESG000026288.1[more]
SMESG000026288.13.040e-101100.00SMESG000026288.1[more]
SMESG000006950.19.294e-2632.39SMESG000006950.1[more]
SMESG000045029.12.729e-1828.07SMESG000045029.1[more]
SMESG000026622.11.092e-1532.22SMESG000026622.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011490 ID=SMED30011490|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=670bp
GTTATTATTTTTTTGAAAGATTCATAATAACATATAAGCACAAATCAAAA
TGGCCACAATGGATGACGCCTTTGTTCATGCTTTCTTTTCCATTGACAGG
CAGAATACAAAAAAAATCACAGCCAAACAGCTACTGGAATTTCAGAACAA
AAACAATTACGACGAAAAATTTGTTGATAAATGGTTGAATCTTTTCGATC
GAGAGCGCACAGGGGTGATAACTTTAGAGGAGTTTTGTGATGTGCTTGGA
TTAGAATTGAAAGAAATGGAAGAAAAACGAGAAAAGTGGCAAGAGGAAAA
GGAGAAAAATAGAGAGCCAAAATCTGATCAAATGCTTGATGATATAATTG
AAAAAACAAAAGAACTCAGAAAAGAACATCCAGATCAAAATAAAATAGTA
GCGAGTGAGTTGAAAAAATATATCGAAGAACGTTATCAAAGAGCATGGGT
TATTCTTATCATTCGAGGACAGTATTGGGCCCATTATTCATACCTTCCAG
AGGATAATTTTGTTTTTAAACTGAACAACGATACTCATGTAATCTTCCGA
AGTATGAGCGATTAAAATAATTCCATTCAACAACCTAAAGGAAATTATTG
ATTAGATTGTACAATTTTTTAGGAATTTAATACATTTAGATTTTATTAAA
GTTTGCTTTGACCAAAATAA
back to top

protein sequence of SMED30011490-orf-1

>SMED30011490-orf-1 ID=SMED30011490-orf-1|Name=SMED30011490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MATMDDAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFD
RERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDDII
EKTKELRKEHPDQNKIVASELKKYIEERYQRAWVILIIRGQYWAHYSYLP
EDNFVFKLNNDTHVIFRSMSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 63..90
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 2..76
e-value: 7.2E-8
score: 34.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..96
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 10..64
e-value: 4.6E-7
score: 30.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 37..72
score: 11.556
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 77..168
e-value: 6.0E-6
score: 28.1
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 92..168
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 92..168
e-value: 8.2E-10
score: 38.9
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 8..76