migration and invasion-inhibitory protein

Overview
Namemigration and invasion-inhibitory protein
Smed IDSMED30011486
Length (bp)1583
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of migration and invasion-inhibitory protein (SMED30011486) t-SNE clustered cells

Violin plots show distribution of expression levels for migration and invasion-inhibitory protein (SMED30011486) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of migration and invasion-inhibitory protein (SMED30011486) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for migration and invasion-inhibitory protein (SMED30011486) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011486

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011486SMESG000018657.1 SmedASXL_017566SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011486SMESG000018657.1 dd_Smed_v4_15255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011486SMESG000018657.1 dd_Smed_v4_15255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30011486SMESG000018657.1 dd_Smed_v6_15255_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of migration and invasion-inhibitory protein vs. Ensembl Human
Match: MIIP (migration and invasion inhibitory protein [Source:HGNC Symbol;Acc:HGNC:25715])

HSP 1 Score: 56.225 bits (134), Expect = 7.365e-8
Identity = 53/200 (26.50%), Postives = 84/200 (42.00%), Query Frame = 3
Query:  288 NLAESFPKSSIT--SILSRSAYLSKSTPKRIPFGISNTFEQINDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER---------GIPNSNNPHIIKVSIPSNRFIKNHK 854
             L +  P+ + T  SIL++ + LSK    R+ F          + ++ ++  +    LGYDWI G ++  S  S   +P  +F  L +FR  NK+ CI + +  PQ   + +S+                       +  D   VY Y +N RLFPVP+D  T  R         G      P  ++VSIP +     H+
Sbjct:  130 RLGDPGPQEAQTPRSILAQQSKLSK---PRVTFS--------EESAVPKRSWRLRPYLGYDWIAGSLDTSS--SITSQPEAFFSKLQEFRETNKEECICS-HPEPQLPGLRESSGS--------------------GVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHR 295          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Zebrafish
Match: miip (migration and invasion inhibitory protein [Source:ZFIN;Acc:ZDB-GENE-130620-1])

HSP 1 Score: 72.0182 bits (175), Expect = 5.065e-13
Identity = 46/143 (32.17%), Postives = 69/143 (48.25%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGI--PNSNNPH------IIKVSIPSNRFIKNHK 854
            LLGYDWI G+++ +S  S  D+  ++F DL  FR++N+  CI         +L+          SS L+  +  P  D H         + Y +N RLF VPLD + +      P S +PH      +I+VSIP +  +  HK
Sbjct:  169 LLGYDWIAGLLDAES--SLADRSEQFFSDLRSFRQVNRDECI--------HSLLSGLPSVADLASSTLDSEEVRPPADSHQC------TFCYRVNSRLFAVPLDAQAACPVCKKPKSEHPHTETEPALIRVSIPRSTLLPAHK 295          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Mouse
Match: Miip (migration and invasion inhibitory protein [Source:MGI Symbol;Acc:MGI:106506])

HSP 1 Score: 53.1434 bits (126), Expect = 5.295e-7
Identity = 40/134 (29.85%), Postives = 57/134 (42.54%), Query Frame = 3
Query:  453 LGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER--GIPNSN-------NPHIIKVSIP 827
            LGYDWI G ++N S  +   +P  +F  L +FR  NK+ C+ N                  SP +    +Q     +   +  D   +Y Y +N RLFP P+D     R  GIP           P  ++VSIP
Sbjct:  182 LGYDWIAGSLDNSSPVT--SEPEAFFSMLQRFRENNKEDCVCN------------------SPEAVFPGLQ-----ESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVEPVQVRVSIP 290          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Mouse
Match: Miip (migration and invasion inhibitory protein [Source:MGI Symbol;Acc:MGI:106506])

HSP 1 Score: 52.7582 bits (125), Expect = 6.740e-7
Identity = 40/134 (29.85%), Postives = 57/134 (42.54%), Query Frame = 3
Query:  453 LGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER--GIPNSN-------NPHIIKVSIP 827
            LGYDWI G ++N S  +   +P  +F  L +FR  NK+ C+ N                  SP +    +Q     +   +  D   +Y Y +N RLFP P+D     R  GIP           P  ++VSIP
Sbjct:  182 LGYDWIAGSLDNSSPVT--SEPEAFFSMLQRFRENNKEDCVCN------------------SPEAVFPGLQ-----ESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVEPVQVRVSIP 290          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Mouse
Match: Miip (migration and invasion inhibitory protein [Source:MGI Symbol;Acc:MGI:106506])

HSP 1 Score: 52.7582 bits (125), Expect = 6.740e-7
Identity = 40/134 (29.85%), Postives = 57/134 (42.54%), Query Frame = 3
Query:  453 LGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER--GIPNSN-------NPHIIKVSIP 827
            LGYDWI G ++N S  +   +P  +F  L +FR  NK+ C+ N                  SP +    +Q     +   +  D   +Y Y +N RLFP P+D     R  GIP           P  ++VSIP
Sbjct:  182 LGYDWIAGSLDNSSPVT--SEPEAFFSMLQRFRENNKEDCVCN------------------SPEAVFPGLQ-----ESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVEPVQVRVSIP 290          
BLAST of migration and invasion-inhibitory protein vs. UniProt/SwissProt
Match: sp|Q5JXC2|MIIP_HUMAN (Migration and invasion-inhibitory protein OS=Homo sapiens OX=9606 GN=MIIP PE=1 SV=3)

HSP 1 Score: 56.225 bits (134), Expect = 3.537e-7
Identity = 53/200 (26.50%), Postives = 84/200 (42.00%), Query Frame = 3
Query:  288 NLAESFPKSSIT--SILSRSAYLSKSTPKRIPFGISNTFEQINDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER---------GIPNSNNPHIIKVSIPSNRFIKNHK 854
             L +  P+ + T  SIL++ + LSK    R+ F          + ++ ++  +    LGYDWI G ++  S  S   +P  +F  L +FR  NK+ CI + +  PQ   + +S+                       +  D   VY Y +N RLFPVP+D  T  R         G      P  ++VSIP +     H+
Sbjct:  130 RLGDPGPQEAQTPRSILAQQSKLSK---PRVTFS--------EESAVPKRSWRLRPYLGYDWIAGSLDTSS--SITSQPEAFFSKLQEFRETNKEECICS-HPEPQLPGLRESSGS--------------------GVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHR 295          
BLAST of migration and invasion-inhibitory protein vs. UniProt/SwissProt
Match: sp|A2A7Y5|MIIP_MOUSE (Migration and invasion-inhibitory protein OS=Mus musculus OX=10090 GN=Miip PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.714e-6
Identity = 40/134 (29.85%), Postives = 57/134 (42.54%), Query Frame = 3
Query:  453 LGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSER--GIPNSN-------NPHIIKVSIP 827
            LGYDWI G ++N S  +   +P  +F  L +FR  NK+ C+ N                  SP +    +Q     +   +  D   +Y Y +N RLFP P+D     R  GIP           P  ++VSIP
Sbjct:  182 LGYDWIAGSLDNSSPVT--SEPEAFFSMLQRFRENNKEDCVCN------------------SPEAVFPGLQ-----ESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVEPVQVRVSIP 290          
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Match: A0A3Q0HC92 (migration and invasion-inhibitory protein OS=Alligator sinensis OX=38654 GN=MIIP PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.918e-11
Identity = 49/144 (34.03%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYET---------SERGIPNSNNPHIIKVSIPSNRFIKNHK 854
            LLGYDWI G++E  S  S  +K  +YF +L +FR +NK+ C+      P+S   LD          +L P Q     D   +P     +Y Y LN+RLFPVP+D  +         ++R       P  I+VSIP    +  HK
Sbjct:  302 LLGYDWIAGLLETDSSVS--EKSEQYFAELKEFRLVNKEACVYEQCLEPES---LD----------YLAPEQ-----DVDLVPTSHQCIYCYRLNKRLFPVPVDSASACPICKTPRAQRPPETLEEPAFIRVSIPRATLLPAHK 425          
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Match: A0A091GT73 (Migration and invasion-inhibitory protein (Fragment) OS=Cuculus canorus OX=55661 GN=N303_02601 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.132e-10
Identity = 41/108 (37.96%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETS 773
             LGYDWI G++E  S  S  +K  +YF DL +FR+ NK+ CI      P++   LD                 +PQ +P  I N    VY Y LN+RLF VP+D E++
Sbjct:  130 FLGYDWIAGLLETNS--SIAEKSDQYFADLREFRQANKEACIHEQPLEPEA---LD---------------YVVPQQEPDLITNSHKCVYCYRLNQRLFTVPVDSESA 217          
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Match: A0A093Q8U2 (Migration and invasion-inhibitory protein (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_00872 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.375e-10
Identity = 38/108 (35.19%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETS 773
             LGYDWI G++E KS  S  +K  +YF +L +FR+ N++ CI   +  P++   LD                 +P+ +P  I +     Y Y LN+RLFPVP+D E++
Sbjct:  127 FLGYDWIAGVLETKS--SVTEKSEQYFAELQQFRQANREACIDEQDLEPKA---LDCT---------------VPEQEPDLITSSHKCFYCYRLNQRLFPVPVDPESA 214          
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Match: A0A504YCK2 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_07603 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.956e-10
Identity = 56/176 (31.82%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  372 IPFGISNTFEQINDLSLNRKVLKSAD-LLGYDWIVGMMENKSKESQLDK----------PPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKK--SPSS-------FLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRF 839
            +PF   N+  +++  +L  + L  AD  LGYDWI  M++N+    Q D               F+ + KFR+ N + C S ++    S    D    K   SPSS        L PV+   +N   N+    P +Y+YTLN RLFP+P D  T++R  P     HI++V++P + F
Sbjct:   43 MPFYYVNSGVKMDGTALQSRKLTIADEHLGYDWIAAMLDNQKCYGQTDDDHSTGRHWLNHSGLFDQIAKFRQTNYEACHSQNSSGNLSAYQSDRPFQKAHISPSSRIRNRIDHLRPVRSGVKNT-KNLAR-SPEIYSYTLNTRLFPIPSDMATAKRLPPQPGQDHILRVTVPLHYF 216          
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Match: A0A267FN26 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007950g3 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.347e-10
Identity = 49/158 (31.01%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  432 VLKSADLLGYDWIVGMMENKSKESQL--------------DKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKK--------SPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRF 839
             L+SAD LGYDW++  +EN      +               +  E  + + +FR+  +  CIS+  R       LD    ++        +P    +     PQ  P + P   P VYAYT+NERLFPVPL+ +T  R  P+ ++P +++VSIP  R 
Sbjct:   87 ALRSADGLGYDWMMSSLENCGAAGGVLGNDIGVDRYDVLRQEHSELLQRVLQFRKTYRNECISDSYRHEH----LDEQALRRLKDLLPGSAPGDEDSDPATGPQARPSSPPAGPP-VYAYTVNERLFPVPLNLDTVFRQPPSKDSPAVVQVSIPYGRV 239          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Cavefish
Match: miip (migration and invasion inhibitory protein [Source:NCBI gene;Acc:103027394])

HSP 1 Score: 60.077 bits (144), Expect = 3.094e-9
Identity = 40/143 (27.97%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGI--PNSNNPH------IIKVSIPSNRFIKNHK 854
            LLGYDWI G+++ +S  S  ++  ++F +L  FR++NK  C+ + +    S L + ++ +       L+  +    N  H  P+     + Y +N RLF  PLD + +      P S +PH       I+VSIP +  +  ++
Sbjct:  206 LLGYDWIAGLLDAES--SLTERSEQFFTELRSFRQVNKDECVYSQS----SGLPVVADPW-------LSSAEEDAANQEH-APDTHQCTFCYRINSRLFAAPLDPQAACPVCKKPKSRHPHTEQEPAFIRVSIPRSTLLPAYR 334          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Cavefish
Match: miip (migration and invasion inhibitory protein [Source:NCBI gene;Acc:103027394])

HSP 1 Score: 60.077 bits (144), Expect = 3.205e-9
Identity = 40/143 (27.97%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGI--PNSNNPH------IIKVSIPSNRFIKNHK 854
            LLGYDWI G+++ +S  S  ++  ++F +L  FR++NK  C+ + +    S L + ++ +       L+  +    N  H  P+     + Y +N RLF  PLD + +      P S +PH       I+VSIP +  +  ++
Sbjct:  206 LLGYDWIAGLLDAES--SLTERSEQFFTELRSFRQVNKDECVYSQS----SGLPVVADPW-------LSSAEEDAANQEH-APDTHQCTFCYRINSRLFAAPLDPQAACPVCKKPKSRHPHTEQEPAFIRVSIPRSTLLPAYR 334          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Nematostella
Match: EDO48135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA5])

HSP 1 Score: 60.4622 bits (145), Expect = 6.104e-10
Identity = 55/154 (35.71%), Postives = 76/154 (49.35%), Query Frame = 3
Query:  309 KSSITSILSRSAYLSKSTPK---RIPFGISNTFEQIN-DLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVY----AYTLNERLF 746
            K+   SIL   A  +K TPK   R+ F  S   E+ N D  LNR+      LLGYDWI G+++N+S  ++  K  ++F+DL +FRR+NKQ C S                 +  P S L P +  P+   +    +E  VY     Y LNERLF
Sbjct:  112 KTPSASILLTPANRAKKTPKKGLRVSFQTSFDKERDNIDDDLNRR-----SLLGYDWIAGILDNESYLAE--KHDDFFDDLKEFRRVNKQDCFS-----------------QALPDSLLTPYRTTPRK-INEEFEEEKEVYTCANTYRLNERLF 240          
BLAST of migration and invasion-inhibitory protein vs. Ensembl Medaka
Match: miip (migration and invasion inhibitory protein [Source:NCBI gene;Acc:101159342])

HSP 1 Score: 61.6178 bits (148), Expect = 7.078e-10
Identity = 44/149 (29.53%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  450 LLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISN------DNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYE-------TSERGIPNS-NNPHIIKVSIPSNRFIKNHK 854
            LLGYDWI G+++ +   ++L    E+F DL  FR +NK+ C+        D   P S L+ D                   ++DP    +     ++Y +N RLFPVPL  +        S+   P+S   P +I+V+IP    +  HK
Sbjct:  147 LLGYDWIAGVLDTEDSVAELSD--EFFNDLQVFRFLNKEECVHAAQTEFFDVSLPASALLTD-------------------KDDPEADKDSHQCTFSYRINNRLFPVPLHSQDCCTVCKRSKFSHPHSIAEPALIRVNIPHAALLPPHK 274          
BLAST of migration and invasion-inhibitory protein vs. Planmine SMEST
Match: SMESG000018657.1 (SMESG000018657.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 448/451 (99.33%), Postives = 449/451 (99.56%), Query Frame = 3
Query:  105 MENSLAYQSRKLLEQLTNRRNFNIKDRSWQXXXXXXXXXXXXXXXXXXXXXXXXXXMTSKHNLAESFPKSSITSILSRSAYLSKSTPKRIPFGISNTFEQINDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRFIKNHKPLSNKERKILFNQNTNMKDIGEXXXXXXXXXXXTKISIPNSQVDNFVKKINSSRQEPAGLLGNLIHEPPNSIGHSLNENLLPFSNNQPKNEKEAIDQLTRGKTMSKFGRMVPSSLDTRNFKIDSNEVPSNICQTRIALKDIMDDSLPRVMDSIKTKDLKTFVSFNDNYQKESDDVPRPCISRKNMNKVFIDEIENIRNSSK 1457
            MENSL YQSRKLLEQLTNRRNFNIKDRSWQNNSTNAENSNNLLFNSNNLRQSNLSNMT+KHNLAESFPKSSITSILSRSAYLSKSTPKRIPFGISNTFEQINDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRFIKNHKPLSNKERKILFNQNTNMKDIGESLSLSSHCHSSTKISIP SQVDNFVKKINSSRQEPAGLLGNLIHEPPNSIGHSLNENLLPFSNNQPKNEKEAIDQLTRGKTMSKFGRMVPSSLDTRNFKIDSNEVPSNICQTRIALKDIMDDSLPRVMDSIKTKDLKTFVSFNDNYQKESDDVPRPCISRKNMNKVFIDEIENIRNSSK
Sbjct:    1 MENSLTYQSRKLLEQLTNRRNFNIKDRSWQNNSTNAENSNNLLFNSNNLRQSNLSNMTNKHNLAESFPKSSITSILSRSAYLSKSTPKRIPFGISNTFEQINDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRRMNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPNDEPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRFIKNHKPLSNKERKILFNQNTNMKDIGESLSLSSHCHSSTKISIPTSQVDNFVKKINSSRQEPAGLLGNLIHEPPNSIGHSLNENLLPFSNNQPKNEKEAIDQLTRGKTMSKFGRMVPSSLDTRNFKIDSNEVPSNICQTRIALKDIMDDSLPRVMDSIKTKDLKTFVSFNDNYQKESDDVPRPCISRKNMNKVFIDEIENIRNSSK 451          
The following BLAST results are available for this feature:
BLAST of migration and invasion-inhibitory protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MIIP7.365e-826.50migration and invasion inhibitory protein [Source:... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
miip5.065e-1332.17migration and invasion inhibitory protein [Source:... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Miip5.295e-729.85migration and invasion inhibitory protein [Source:... [more]
Miip6.740e-729.85migration and invasion inhibitory protein [Source:... [more]
Miip6.740e-729.85migration and invasion inhibitory protein [Source:... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q5JXC2|MIIP_HUMAN3.537e-726.50Migration and invasion-inhibitory protein OS=Homo ... [more]
sp|A2A7Y5|MIIP_MOUSE4.714e-629.85Migration and invasion-inhibitory protein OS=Mus m... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0HC926.918e-1134.03migration and invasion-inhibitory protein OS=Allig... [more]
A0A091GT731.132e-1037.96Migration and invasion-inhibitory protein (Fragmen... [more]
A0A093Q8U21.375e-1035.19Migration and invasion-inhibitory protein (Fragmen... [more]
A0A504YCK21.956e-1031.82Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A267FN262.347e-1031.01Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
miip3.094e-927.97migration and invasion inhibitory protein [Source:... [more]
miip3.205e-927.97migration and invasion inhibitory protein [Source:... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481356.104e-1035.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
miip7.078e-1029.53migration and invasion inhibitory protein [Source:... [more]
back to top
BLAST of migration and invasion-inhibitory protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018657.10.000e+099.33SMESG000018657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011486 ID=SMED30011486|Name=migration and invasion-inhibitory protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1583bp
TAAGAAAGGACAATTTGGTGAACAAGAATCAAGAGCAGAAGATCCATTAG
TGTTTTCGGTTTATAGATACTAAAATATAGATCGATTTAAATTATATTTT
GAAAATGGAAAATTCACTAGCATATCAATCTAGAAAACTTCTTGAACAAT
TAACCAATCGAAGAAATTTTAATATTAAAGATAGAAGTTGGCAAAACAAT
AGCACAAATGCTGAAAACAGTAACAATTTATTATTTAATTCTAATAATTT
GCGTCAAAGTAATCTTTCCAATATGACAAGTAAGCATAATTTGGCTGAAT
CCTTTCCTAAATCATCAATAACATCAATTTTGAGTCGAAGTGCATATTTA
AGCAAATCAACACCTAAAAGAATTCCATTCGGAATTTCCAATACTTTCGA
ACAAATTAATGATCTGTCGTTGAATCGTAAAGTTTTAAAAAGCGCTGATT
TATTGGGCTATGATTGGATAGTTGGAATGATGGAAAATAAATCCAAGGAA
TCTCAACTAGACAAACCTCCAGAATATTTTGAAGATTTAGATAAATTTCG
TCGCATGAATAAACAATACTGCATTTCTAATGATAATCGGTCACCCCAGT
CAAATCTTATCCTCGATTCAAATGAATATAAAAAATCACCTAGTAGTTTT
CTTAATCCAGTTCAATATATTCCACAAAATGATCCTCACAATATCCCAAA
TGACGAGCCTAGAGTATATGCATACACCTTGAATGAGCGATTGTTTCCTG
TTCCTCTAGATTATGAAACTTCGGAGCGTGGAATACCAAACTCTAATAAT
CCACATATTATCAAAGTTAGTATTCCTTCTAATAGATTTATTAAAAACCA
CAAACCGTTATCAAACAAAGAAAGAAAAATTCTATTTAATCAAAACACTA
ATATGAAAGATATTGGAGAAAGTCTTTCTCTATCTAGTCATTGTCATTCT
TCGACAAAAATCTCTATCCCAAATTCCCAAGTTGATAATTTCGTCAAAAA
AATCAATTCTTCTCGTCAAGAACCGGCGGGGCTGTTGGGAAACCTTATTC
ACGAGCCACCTAATTCTATTGGTCACAGCCTGAATGAGAATCTTTTACCA
TTTTCTAATAATCAACCGAAAAATGAAAAAGAAGCTATTGATCAATTAAC
TCGTGGAAAAACAATGAGTAAATTTGGTCGAATGGTTCCAAGCAGTCTTG
ATACTCGCAATTTCAAGATAGATTCCAATGAAGTTCCATCAAACATATGT
CAGACAAGGATAGCATTGAAGGATATAATGGATGATTCGTTACCTAGAGT
TATGGATTCAATAAAAACAAAGGATTTGAAAACTTTTGTATCATTTAATG
ATAATTATCAAAAAGAATCTGATGACGTACCAAGGCCATGCATTTCTAGG
AAAAATATGAATAAAGTATTCATTGATGAAATCGAAAATATTCGAAATAG
TTCTAAATTTAATTGATTTGTTTAATTTATTATTTTTGAAATTTTCTTAA
TTCTTTGTGATTTTTATCTGTATATAAAATTAGTTATTATTTTATATGTA
TATTTGTGTAAATATTATTGAATTATCCTATGC
back to top

protein sequence of SMED30011486-orf-1

>SMED30011486-orf-1 ID=SMED30011486-orf-1|Name=SMED30011486-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MENSLAYQSRKLLEQLTNRRNFNIKDRSWQNNSTNAENSNNLLFNSNNLR
QSNLSNMTSKHNLAESFPKSSITSILSRSAYLSKSTPKRIPFGISNTFEQ
INDLSLNRKVLKSADLLGYDWIVGMMENKSKESQLDKPPEYFEDLDKFRR
MNKQYCISNDNRSPQSNLILDSNEYKKSPSSFLNPVQYIPQNDPHNIPND
EPRVYAYTLNERLFPVPLDYETSERGIPNSNNPHIIKVSIPSNRFIKNHK
PLSNKERKILFNQNTNMKDIGESLSLSSHCHSSTKISIPNSQVDNFVKKI
NSSRQEPAGLLGNLIHEPPNSIGHSLNENLLPFSNNQPKNEKEAIDQLTR
GKTMSKFGRMVPSSLDTRNFKIDSNEVPSNICQTRIALKDIMDDSLPRVM
DSIKTKDLKTFVSFNDNYQKESDDVPRPCISRKNMNKVFIDEIENIRNSS
KFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031466MIIP
Vocabulary: biological process
TermDefinition
GO:0030336negative regulation of cell migration
GO:0010972negative regulation of G2/M transition of mitotic cell cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031466Migration and invasion-inhibitory proteinPFAMPF15734MIIPcoord: 36..291
e-value: 3.2E-21
score: 76.2
IPR031466Migration and invasion-inhibitory proteinPANTHERPTHR34831FAMILY NOT NAMEDcoord: 25..285