Xylosyltransferase

Overview
NameXylosyltransferase
Smed IDSMED30011480
Length (bp)1911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Xylosyltransferase (SMED30011480) t-SNE clustered cells

Violin plots show distribution of expression levels for Xylosyltransferase (SMED30011480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Xylosyltransferase (SMED30011480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Xylosyltransferase (SMED30011480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30011480h1SMcG0005512 dd_Smed_v4_11313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Xylosyltransferase vs. Ensembl Human
Match: AC099494.7 (Xylosyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q86Y38])

HSP 1 Score: 297.36 bits (760), Expect = 1.455e-89
Identity = 166/448 (37.05%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    +++  +YSNV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP +      S+  N Y    + D   SL+        S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  191 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAVVNQEIIGQLDYYLYGNYP-AGTPGLRSYWENVYD---EPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 629          
BLAST of Xylosyltransferase vs. Ensembl Human
Match: AC099494.7 (Xylosyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q86Y38])

HSP 1 Score: 297.36 bits (760), Expect = 1.455e-89
Identity = 166/448 (37.05%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    +++  +YSNV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP +      S+  N Y    + D   SL+        S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  191 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAVVNQEIIGQLDYYLYGNYP-AGTPGLRSYWENVYD---EPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 629          
BLAST of Xylosyltransferase vs. Ensembl Human
Match: XYLT1 (xylosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:15516])

HSP 1 Score: 297.36 bits (760), Expect = 1.274e-88
Identity = 166/448 (37.05%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    +++  +YSNV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP +      S+  N Y    + D   SL+        S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  324 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAVVNQEIIGQLDYYLYGNYP-AGTPGLRSYWENVYD---EPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 762          
BLAST of Xylosyltransferase vs. Ensembl Human
Match: XYLT2 (xylosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:15517])

HSP 1 Score: 293.508 bits (750), Expect = 8.333e-88
Identity = 158/448 (35.27%), Postives = 242/448 (54.02%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSL---AYSLYARL--------MSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L   Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD     SYP        ++  N Y           +   AY+ +ARL               +  F      S + L+   +     ++T+ V       +   E      G    + + + +S        + S  VG D+D KE LFR    L+ P
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVELAQGYDNVRVTPWRMVTIWGGASLLRMYLRSMRDLLEVPGWAWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSLACETLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILDFHLYGSYP-PGTPALKAYWENTYDAADGPSGLSDVMLTAYTAFARLSLHHAATAAPPMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQGSLKLLGRSDQAS-------RLQSLEVGTDWDPKERLFRNFGGLLGP 668          
BLAST of Xylosyltransferase vs. Ensembl Human
Match: XYLT2 (xylosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:15517])

HSP 1 Score: 283.493 bits (724), Expect = 3.810e-86
Identity = 128/291 (43.99%), Postives = 192/291 (65.98%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD 962
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L   Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVELAQGYDNVRVTPWRMVTIWGGASLLRMYLRSMRDLLEVPGWAWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSLACETLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILD 519          
BLAST of Xylosyltransferase vs. Ensembl Celegans
Match: sqv-6 (Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-Prot;Acc:Q965Q8])

HSP 1 Score: 224.172 bits (570), Expect = 2.690e-63
Identity = 113/288 (39.24%), Postives = 170/288 (59.03%), Query Frame = 3
Query:   84 KNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQD-ITSKKLK-WDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQH-SSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSID 938
            KN V I+FLL ++GR+  Q+ +  KSIY P +YY+IH+D R  ++ S   ++ D   N+ + +    TIWGGASLL  + + ++D +  +K K WD++IN SESD+PI  I + +  +  N  K+F+ S G +T  FI+KQG    F EC+  ++ +G R  P NL +DGGSDW G+      + ++ ++ L   L   +E+ LLP E+F+H    NS+FC  ++ +NLR TNW R++GCRC     +V WCGCSP V R              +  +FARKFD  +D
Sbjct:  226 KNPVKILFLLQLNGRNERQVKRFLKSIYLPHHYYYIHVDARQNYMFSEMQKVADFLDNIHITERRFSTIWGGASLLQMFLQVIRDSMKIEKFKDWDYIINFSESDFPILPISDFERLITVNNGKSFLASHGYNTGKFIQKQGFEYVFSECDNRMFRIGKREFPQNLRIDGGSDWVGIHRNLAEFSISDEE-LPRKLRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLKPIVDWCGCSPLVFREETMKKFELQKAISKPTYFARKFDSMVD 512          
BLAST of Xylosyltransferase vs. Ensembl Celegans
Match: sqv-6 (Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-Prot;Acc:Q965Q8])

HSP 1 Score: 224.172 bits (570), Expect = 2.690e-63
Identity = 113/288 (39.24%), Postives = 170/288 (59.03%), Query Frame = 3
Query:   84 KNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQD-ITSKKLK-WDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQH-SSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSID 938
            KN V I+FLL ++GR+  Q+ +  KSIY P +YY+IH+D R  ++ S   ++ D   N+ + +    TIWGGASLL  + + ++D +  +K K WD++IN SESD+PI  I + +  +  N  K+F+ S G +T  FI+KQG    F EC+  ++ +G R  P NL +DGGSDW G+      + ++ ++ L   L   +E+ LLP E+F+H    NS+FC  ++ +NLR TNW R++GCRC     +V WCGCSP V R              +  +FARKFD  +D
Sbjct:  226 KNPVKILFLLQLNGRNERQVKRFLKSIYLPHHYYYIHVDARQNYMFSEMQKVADFLDNIHITERRFSTIWGGASLLQMFLQVIRDSMKIEKFKDWDYIINFSESDFPILPISDFERLITVNNGKSFLASHGYNTGKFIQKQGFEYVFSECDNRMFRIGKREFPQNLRIDGGSDWVGIHRNLAEFSISDEE-LPRKLRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLKPIVDWCGCSPLVFREETMKKFELQKAISKPTYFARKFDSMVD 512          
BLAST of Xylosyltransferase vs. Ensembl Celegans
Match: sqv-6 (Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-Prot;Acc:Q965Q8])

HSP 1 Score: 112.464 bits (280), Expect = 2.707e-26
Identity = 52/135 (38.52%), Postives = 76/135 (56.30%), Query Frame = 3
Query:  537 LYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQH-SSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSID 938
            ++ +G R  P NL +DGGSDW G+      + ++ ++ L   L   +E+ LLP E+F+H    NS+FC  ++ +NLR TNW R++GCRC     +V WCGCSP V R              +  +FARKFD  +D
Sbjct:    1 MFRIGKREFPQNLRIDGGSDWVGIHRNLAEFSISDEE-LPRKLRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLKPIVDWCGCSPLVFREETMKKFELQKAISKPTYFARKFDSMVD 134          
BLAST of Xylosyltransferase vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 306.99 bits (785), Expect = 4.153e-93
Identity = 166/464 (35.78%), Postives = 251/464 (54.09%), Query Frame = 3
Query:   51 FTFNFVAT--SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTK--DNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSF-GFEAVYTYSGKAGTIKQYESSSSKTQS---------NFEIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            FT    AT  S+   +V I FLL ++GR + Q+++  K++Y P + Y+IH+D+R  +L    + L  K+ N+ +      TIWGGASLL    + M+D+      WDF+INLSESD+P++++D+L  FL AN  +NFVK  G+ T  FI+KQGL+K F+EC+ H++ +GDR LP  + VDGGSDW  LS  FV Y+   +  D L+  LL  F ++LLPAE+FFH  L+N+K CTS ++ NL  TNW R++GC+CQ+  VV WCGCSP+  +  ++  L+   T+ +S+FFARKF+  I+++++ +L+   Y    S   N H +  + Y           LA S+   +M     + K +P  L                     ++    H D + GF   Y   G  G     E+    TQ          +  + +F V  D+D KE + R    L+ P 
Sbjct:  232 FTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQ--ATEQKSLFFARKFEPVINQAVLLQLEEWLYGPYTSEYANLHGYWQSLYHHEDVHGSGDDLARSIGDSVMRLSARQAKLYPLELI--------------------ELTHYLHRDQYKGFLVRYRARGSTGKPLHLETRVRPTQQGKLARNARFSKRLRNFEVSTDFDQKEQIARNFGKLLGPQ 673          
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Match: xylt1 (xylosyltransferase I [Source:ZFIN;Acc:ZDB-GENE-111017-2])

HSP 1 Score: 295.434 bits (755), Expect = 2.481e-88
Identity = 135/291 (46.39%), Postives = 198/291 (68.04%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD 962
            V I F+L++ GR   Q+ + FK+IY  +++Y+IH+D+R  +L    + L  +Y NV V  W M TIWGGASLL  Y ++M+D+ + +   WDF INLS +DYPIR+ D+L  FL    N NF+KS G+    FIRKQGL++ F EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y++ T+D+L+ N+  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +    ++ R+  T  R  FFARKF+ S+++ I+ +LD
Sbjct:  285 VRIAFMLVVHGRAARQVQRLFKAIYHTSHFYYIHVDQRSNYLHRQMVALAHQYPNVRVTSWRMSTIWGGASLLTMYLQSMKDLLAMRDWSWDFFINLSAADYPIRTNDQLVAFLSKYRNMNFIKSHGRDNARFIRKQGLDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRMFVEYVINTQDDLVTNMKRFYAYTLLPAESFFHTVLENSPHCESMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKP--SDLPRFQQTT-RPTFFARKFEASVNQEIVNQLD 572          
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Match: xylt2 (xylosyltransferase II [Source:ZFIN;Acc:ZDB-GENE-081022-125])

HSP 1 Score: 280.796 bits (717), Expect = 2.473e-83
Identity = 136/301 (45.18%), Postives = 199/301 (66.11%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSK-KLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSY 974
            SK +N V +VF+L++ GR V QL +  K+IY   ++Y+IH+DKR  ++    +++ + Y NV    W M TIWGGASLL AY ++M D+ S    KWDF INLS +D+P R+ DEL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  L V GGSDWF L+ +FV Y+V ++D L+  L  F+  +LLPAE+FFH  L NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +   ++ +    R  FFARKF+ ++++  I  LDN  Y
Sbjct:  230 SKVENPVRVVFVLVVHGRAVRQLKRLLKAIYHKDHFYYIHVDKRSNYMHREVLKMAELYPNVRATPWRMVTIWGGASLLKAYLRSMHDLLSMLDWKWDFFINLSATDFPTRTNDELVAFLSQNRDKNFLKSHGRENARFIKKQGLDRLFHECDNHMWRLGERTIPEGLEVSGGSDWFSLTRKFVEYVVNSQDELVTGLKQFYTYALLPAESFFHTVLGNSHMCDTLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDLIRIQQLT---RPTFFARKFESTVNQEAIEILDNHLY 527          
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Match: gcnt7 (glucosaminyl (N-acetyl) transferase family member 7 [Source:ZFIN;Acc:ZDB-GENE-120919-3])

HSP 1 Score: 73.1738 bits (178), Expect = 3.269e-13
Identity = 69/297 (23.23%), Postives = 134/297 (45.12%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPT--NLIVDGGSDWFGLSFEFVSYLVTTKDNLIP-NLLAFFENSLLPAETFF----HMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFS 932
            SK +    + F++ I  +++    +  ++IY P N Y IHID++ +     ++R L   + NV +   ++   + G S L A    M+D+    ++W  +INL   DYPI++  EL  +++    K+   + G      +R +   +     N H+   G +  P   NL +  G+ ++ L+  FV Y++   DN +  +LL++ ++S  P E ++    H+              N+R   W+ ++G   Q        GC    +R    Y    L +++  ++   FA KF+ +
Sbjct:  104 SKEEEDYPLAFIITIH-KELATFVRLLRAIYAPQNVYCIHIDQKASEKYKSSVRNLSRCFPNVFLSSVNVKVTYAGFSRLQADINCMKDLVESPIQWKKVINLCGQDYPIQTNLELVRYMQTPEWKDRNMTPGIKQPPSMRYRTAFQYVEVKNTHVAQTGRKKGPPPHNLKIYFGTAYYSLTRPFVEYVL---DNPVAKDLLSWSKDSYSPDEHYWVTLNHIKEAPGSNVEGEWEGNVRAVKWSDQQGTAHQ--------GCKGQYIRGICVYGIGDLPWLI--EKESMFANKFEMA 386          
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Match: gcnt7 (glucosaminyl (N-acetyl) transferase family member 7 [Source:ZFIN;Acc:ZDB-GENE-120919-3])

HSP 1 Score: 70.8626 bits (172), Expect = 1.277e-12
Identity = 60/248 (24.19%), Postives = 115/248 (46.37%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPT--NLIVDGGSDWFGLSFEFVSYLVTTKDNLIP-NLLAFFENSLLPAE----TFFHMALQNSKFCTSVINTNLRYTNWNRERG 794
            SK +    + F++ I  +++    +  ++IY P N Y IHID++ +     ++R L   + NV +   ++   + G S L A    M+D+    ++W  +INL   DYPI++  EL  +++    K+   + G      +R +   +     N H+   G +  P   NL +  G+ ++ L+  FV Y++   DN +  +LL++ ++S  P E    T  H+              N+R   W+ ++G
Sbjct:  104 SKEEEDYPLAFIITIH-KELATFVRLLRAIYAPQNVYCIHIDQKASEKYKSSVRNLSRCFPNVFLSSVNVKVTYAGFSRLQADINCMKDLVESPIQWKKVINLCGQDYPIQTNLELVRYMQTPEWKDRNMTPGIKQPPSMRYRTAFQYVEVKNTHVAQTGRKKGPPPHNLKIYFGTAYYSLTRPFVEYVL---DNPVAKDLLSWSKDSYSPDEHYWVTLNHIKEAPGSNVEGEWEGNVRAVKWSDQQG 347          
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 67.781 bits (164), Expect = 1.400e-11
Identity = 77/319 (24.14%), Postives = 136/319 (42.63%), Query Frame = 3
Query:   48 GFTFNFVATSKNKNQVVIVFLLMISGRDVLQLYQQF-KSIYKPTNYYFIHID-KRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRK--QGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQ-----------NSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFSIDKSII 950
            G  F   A SK +    I + ++I   D ++++++  ++IY P N Y +H+D K     R     +   + NV V       I+   S + A    MQD+    ++W +L+N   +D+PI++  E    L+    KN ++S       +  +    +    I  +     +     P N  +  G+ +F +S EFV Y++ +K+  I NL+ + +++  P E  +   LQ           N+K+  S +N   R   W+   G     +S   +  C+    RS   Y    L++IV Q      A KFD  +D   I
Sbjct:  102 GRGFLMEALSKEEEDFPIAYSMVI--HDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSCFPNVFVASKLESVIYASWSRVQADVNCMQDLLKSPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSMESETVPGKNWRWQFHHNITNTVIRTD-----IRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKE--IQNLMEWEKDTYSPDEHMW-ATLQRMPSVPGSNSPNNKYEQSDMNAIARLVKWSYHEG---DLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHH--LLANKFDPEVDDVAI 405          
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Match: xylt1 (xylosyltransferase I [Source:NCBI gene;Acc:100145490])

HSP 1 Score: 296.975 bits (759), Expect = 8.971e-89
Identity = 164/448 (36.61%), Postives = 250/448 (55.80%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIIT--------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   +YYFIH DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP+R+ D+L  FL    N NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS +C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP S      S+  N Y    + D   S++  +     +     +K    SL T G +        + + +         +  +IK+H  +     + T        K ++ ++    S+F  + F  VG ++D KE +FR    LM P
Sbjct:  275 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHYYFIHCDKRSHYLHRQVLQFASQYPNVRVTSWRMSTIWGGASLLSTYLQSMRDLLEMSDWSWDFFINLSAADYPVRTNDQLVAFLSRYRNMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRKIPEGINVDGGSDWFLLNRKFVEYVTFSNDDLVTKMKQFYSYTLLPAESFFHTVLENSPYCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDFHRFQQT---SRPTFFARKFEAVVNQEIIGQLDYYLYGNYP-SGTPGLRSYWENLY---DEPDGIHSISDVMLTMFHAFSHMGLKRAESSLHTDGENTCRYYPMGHPVSVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIANP--TSDFGRLQFSEVGTEWDAKERIFRNFGGLMGP 713          
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Match: xylt1 (xylosyltransferase I [Source:NCBI gene;Acc:100145490])

HSP 1 Score: 296.975 bits (759), Expect = 1.131e-88
Identity = 164/448 (36.61%), Postives = 250/448 (55.80%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIIT--------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   +YYFIH DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP+R+ D+L  FL    N NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS +C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP S      S+  N Y    + D   S++  +     +     +K    SL T G +        + + +         +  +IK+H  +     + T        K ++ ++    S+F  + F  VG ++D KE +FR    LM P
Sbjct:  296 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHYYFIHCDKRSHYLHRQVLQFASQYPNVRVTSWRMSTIWGGASLLSTYLQSMRDLLEMSDWSWDFFINLSAADYPVRTNDQLVAFLSRYRNMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRKIPEGINVDGGSDWFLLNRKFVEYVTFSNDDLVTKMKQFYSYTLLPAESFFHTVLENSPYCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDFHRFQQT---SRPTFFARKFEAVVNQEIIGQLDYYLYGNYP-SGTPGLRSYWENLY---DEPDGIHSISDVMLTMFHAFSHMGLKRAESSLHTDGENTCRYYPMGHPVSVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIANP--TSDFGRLQFSEVGTEWDAKERIFRNFGGLMGP 734          
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Match: xylt1 (xylosyltransferase I [Source:NCBI gene;Acc:100145490])

HSP 1 Score: 296.59 bits (758), Expect = 1.276e-88
Identity = 164/448 (36.61%), Postives = 250/448 (55.80%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIIT--------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   +YYFIH DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP+R+ D+L  FL    N NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS +C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP S      S+  N Y    + D   S++  +     +     +K    SL T G +        + + +         +  +IK+H  +     + T        K ++ ++    S+F  + F  VG ++D KE +FR    LM P
Sbjct:  287 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHYYFIHCDKRSHYLHRQVLQFASQYPNVRVTSWRMSTIWGGASLLSTYLQSMRDLLEMSDWSWDFFINLSAADYPVRTNDQLVAFLSRYRNMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRKIPEGINVDGGSDWFLLNRKFVEYVTFSNDDLVTKMKQFYSYTLLPAESFFHTVLENSPYCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDFHRFQQT---SRPTFFARKFEAVVNQEIIGQLDYYLYGNYP-SGTPGLRSYWENLYD---EPDGIHSISDVMLTMFHAFSHMGLKRAESSLHTDGENTCRYYPMGHPVSVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIANP--TSDFGRLQFSEVGTEWDAKERIFRNFGGLMGP 725          
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Match: xylt1 (xylosyltransferase I [Source:NCBI gene;Acc:100145490])

HSP 1 Score: 296.59 bits (758), Expect = 1.858e-88
Identity = 164/448 (36.61%), Postives = 250/448 (55.80%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIIT--------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   +YYFIH DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP+R+ D+L  FL    N NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS +C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP S      S+  N Y    + D   S++  +     +     +K    SL T G +        + + +         +  +IK+H  +     + T        K ++ ++    S+F  + F  VG ++D KE +FR    LM P
Sbjct:  302 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHYYFIHCDKRSHYLHRQVLQFASQYPNVRVTSWRMSTIWGGASLLSTYLQSMRDLLEMSDWSWDFFINLSAADYPVRTNDQLVAFLSRYRNMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRKIPEGINVDGGSDWFLLNRKFVEYVTFSNDDLVTKMKQFYSYTLLPAESFFHTVLENSPYCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDFHRFQQT---SRPTFFARKFEAVVNQEIIGQLDYYLYGNYP-SGTPGLRSYWENLYD---EPDGIHSISDVMLTMFHAFSHMGLKRAESSLHTDGENTCRYYPMGHPVSVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIANPT--SDFGRLQFSEVGTEWDAKERIFRNFGGLMGP 740          
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Match: xylt2 (xylosyltransferase II [Source:NCBI gene;Acc:448400])

HSP 1 Score: 290.812 bits (743), Expect = 2.505e-87
Identity = 159/446 (35.65%), Postives = 250/446 (56.05%), Query Frame = 3
Query:   99 IVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSG----NQKGDVYQSLAYSLYARL-MSQFQFKIK------C-FPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            ++++L++ GR + QL +  K+IY   ++Y+IH+D+R  +L    +RL   Y N+ V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  + +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+  TKD L+  L  F++ +LLPAE+FFH  L+NSK C S+++ NLR TNWNR+ GCRCQ+  +V WCGCSP+  +  +   L+ +    R  FFARKF+ S+++ ++  LD   +    S       +  + Y          DV  ++ Y+ + RL + + Q   K      C F  S   S ++L+   +     ++ ++V           E +  +    G++K  E   +  +    I    VG ++D KE +FR    L+ P
Sbjct:  186 VLYMLVVHGRAIRQLKRLIKAIYHQDHFYYIHVDQRSNYLHREVVRLAQSYENMRVTPWRMVTIWGGASLLTMYLRSMKDLLEVPDWPWDFFINLSATDYPTRTNEELVLFLSKHRHKNFLKSHGRDNARFIKKQGLDRLFHECDSHMWRLGERQIPEGIVVDGGSDWFALTRNFVEYVTYTKDILVSELRRFYKYTLLPAESFFHTVLENSKACDSLVDNNLRVTNWNRKLGCRCQYKHIVDWCGCSPNDFKPQDVVRLQQL---SRPTFFARKFESSVNQEVLDILDAHLFGELPSETPGIKGYWESVYDSIDGLGGLSDVTMTV-YAAFTRLALHELQGSKKETRQPSCWFTASGLPSSVELYFYDDHFQGYLVKQEVQ--------SGETLEIWMMPQGSLKLSEQGEAIGR----IQGLEVGTEWDPKERIFRNFGGLIGP 615          
BLAST of Xylosyltransferase vs. Ensembl Mouse
Match: Xylt2 (xylosyltransferase II [Source:MGI Symbol;Acc:MGI:2444797])

HSP 1 Score: 297.36 bits (760), Expect = 2.169e-89
Identity = 162/448 (36.16%), Postives = 251/448 (56.03%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYS-GNQKGDVYQSL--AYSLYARL--------MSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L   Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD     SYP  S     ++  N Y   +  G +   L  AY+ +ARL        +S     +  F      S + L+   +     ++T+ V       +   E ++    ++  +  +   +S+ Q      S  VG ++D KE LFR    L+ P
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLYREVVELAQHYENVRVTPWRMVTIWGGASLLRMYLRSMKDLLEIPGWTWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSPACASLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILDFHLYGSYP-PSTPALKAYWENIYDVADGPGGLSDVLLTAYTAFARLSLRHAATAVSPLATAVCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLE-MWLMPQRSLKLLGHSDQASRLQ------SLEVGTEWDPKERLFRNFGGLLGP 668          
BLAST of Xylosyltransferase vs. Ensembl Mouse
Match: Xylt1 (xylosyltransferase 1 [Source:MGI Symbol;Acc:MGI:2451073])

HSP 1 Score: 298.516 bits (763), Expect = 3.171e-89
Identity = 165/448 (36.83%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD+    +YP +      S+  N Y           +A +LY    S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  318 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQFSRQYDNVRVTSWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRRIPEGIAVDGGSDWFLLNRKFVEYVAFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAIVNQEIIGQLDSYLYGNYP-AGTPGLRSYWENVYDEPDGIHTLSDVALTLY---HSFIRLGLRRAESSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHVTNLAVSKLETLETWMMPKKVFKVASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 756          
BLAST of Xylosyltransferase vs. Ensembl Mouse
Match: Xylt2 (xylosyltransferase II [Source:MGI Symbol;Acc:MGI:2444797])

HSP 1 Score: 287.73 bits (735), Expect = 3.510e-88
Identity = 142/337 (42.14%), Postives = 212/337 (62.91%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYS-GNQKGDVYQSL--AYSLYARL 1082
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L   Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD     SYP S+     ++  N Y   +  G +   L  AY+ +ARL
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLYREVVELAQHYENVRVTPWRMVTIWGGASLLRMYLRSMKDLLEIPGWTWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSPACASLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILDFHLYGSYPPST-PALKAYWENIYDVADGPGGLSDVLLTAYTAFARL 564          
BLAST of Xylosyltransferase vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 72.0182 bits (175), Expect = 7.383e-13
Identity = 51/217 (23.50%), Postives = 107/217 (49.31%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYL----PTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFF 710
            S+ + +  + F L I  +D     + F++IY P N Y +H+D +        +R L   + N  +     P ++GG S L A    M+D+ + K+ W +++N    D+P+++  E+  +L+  I KN          A  R + +++  ++ +++ Y+     L    P NL +  G+ +  L+ EF ++++  KD    +L+++ +++  P E F+
Sbjct:   87 SEEEARFPLAFTLTIH-KDYDTFERLFRAIYMPQNVYCVHVDSKATDTFKEEVRQLLSCFPNAFLASRMEPVVYGGFSRLQADLNCMKDLVASKIPWKYVLNTCGQDFPLKTNKEIVQYLKRFIGKNLTPGVLPPAHAVGRTKYVHQELLD-HKNPYVHNTARLKAPPPHNLTIYFGTAYVALTREFANFVL--KDQRSVDLISWSKDTYSPDEHFW 299          
BLAST of Xylosyltransferase vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 68.5514 bits (166), Expect = 8.550e-12
Identity = 46/191 (24.08%), Postives = 94/191 (49.21%), Query Frame = 3
Query:  153 FKSIYKPTNYYFIHIDKRH-AFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYL----PTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFF 710
            F++I+ P N Y +H+D++  A  +    +L   + N  +     P ++GG S L A    ++D+++ ++ W + IN    D+P+++  E+  +L+    KN          A  R + +++  +   E  Y++    L    P NL +  GS +  LS EF ++++  +D    +LL + +++  P E F+
Sbjct:  112 FRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLS-KELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVL--RDPRAVDLLHWSKDTFSPDEHFW 299          
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Match: sp|Q7KVA1|XYLT_DROME (Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 4.163e-92
Identity = 166/464 (35.78%), Postives = 251/464 (54.09%), Query Frame = 3
Query:   51 FTFNFVAT--SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTK--DNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSF-GFEAVYTYSGKAGTIKQYESSSSKTQS---------NFEIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            FT    AT  S+   +V I FLL ++GR + Q+++  K++Y P + Y+IH+D+R  +L    + L  K+ N+ +      TIWGGASLL    + M+D+      WDF+INLSESD+P++++D+L  FL AN  +NFVK  G+ T  FI+KQGL+K F+EC+ H++ +GDR LP  + VDGGSDW  LS  FV Y+   +  D L+  LL  F ++LLPAE+FFH  L+N+K CTS ++ NL  TNW R++GC+CQ+  VV WCGCSP+  +  ++  L+   T+ +S+FFARKF+  I+++++ +L+   Y    S   N H +  + Y           LA S+   +M     + K +P  L                     ++    H D + GF   Y   G  G     E+    TQ          +  + +F V  D+D KE + R    L+ P 
Sbjct:  232 FTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQ--ATEQKSLFFARKFEPVINQAVLLQLEEWLYGPYTSEYANLHGYWQSLYHHEDVHGSGDDLARSIGDSVMRLSARQAKLYPLELI--------------------ELTHYLHRDQYKGFLVRYRARGSTGKPLHLETRVRPTQQGKLARNARFSKRLRNFEVSTDFDQKEQIARNFGKLLGPQ 673          
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Match: sp|Q5QQ50|XYLT2_CANLF (Xylosyltransferase 2 OS=Canis lupus familiaris OX=9615 GN=XYLT2 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.046e-88
Identity = 161/448 (35.94%), Postives = 251/448 (56.03%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFY-SGNQKGDVYQSL--AYSLYARL--------MSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L  +Y NV V  W M TIWGGASLL  Y ++MQD+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR  GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD     SYP  +     ++  N Y + +  G +   +  AY+ +ARL        +      +  F      S + L+   +     ++T+ V       +   E +  +    G++K    S   ++    + S  VG ++D KE LFR    L+ P
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLHREVVELARQYDNVRVTPWRMVTIWGGASLLRMYLRSMQDLLEVPGWAWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSPACESLVDNNLRVTNWNRRLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILDFHLYGSYPPGT-PALKAYWENTYDAADGPGGLSDVMLTAYTAFARLSLRHAATAIPPLATPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPA---ETLEMWLMPQGSLKLLGRSDQASR----LQSLEVGTEWDPKERLFRNFGGLLGP 668          
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Match: sp|Q9EPL0|XYLT2_MOUSE (Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3)

HSP 1 Score: 297.36 bits (760), Expect = 1.517e-88
Identity = 162/448 (36.16%), Postives = 251/448 (56.03%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYS-GNQKGDVYQSL--AYSLYARL--------MSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I ++L++ GR + QL +  K++Y   ++++IH+DKR  +L    + L   Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYP R+ +EL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  ++VDGGSDWF L+  FV Y+V T D L+  L  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++  L+ +    R  FFARKF+ ++++ ++  LD     SYP  S     ++  N Y   +  G +   L  AY+ +ARL        +S     +  F      S + L+   +     ++T+ V       +   E ++    ++  +  +   +S+ Q      S  VG ++D KE LFR    L+ P
Sbjct:  232 VRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLYREVVELAQHYENVRVTPWRMVTIWGGASLLRMYLRSMKDLLEIPGWTWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSPACASLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQV---SRPTFFARKFESTVNQEVLEILDFHLYGSYP-PSTPALKAYWENIYDVADGPGGLSDVLLTAYTAFARLSLRHAATAVSPLATAVCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLE-MWLMPQRSLKLLGHSDQASRLQ------SLEVGTEWDPKERLFRNFGGLLGP 668          
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Match: sp|Q9EPI1|XYLT1_RAT (Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.250e-88
Identity = 165/448 (36.83%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    ++   +Y NV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQ L++ F+EC+ H++ +GDR +P  + VDGGSDWF L+ +FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD+    +YP +      S+  N Y    + D  QSL+        S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  189 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQFSRQYDNVRVTSWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQDLDRLFLECDTHMWRLGDRRIPEGIAVDGGSDWFLLNRKFVEYVAFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAIVNQEIIGQLDSYLYGNYP-AGTPGLRSYWENVYD---EPDGIQSLSDVALTMYHSFIRLGLRRAESSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHVTNLAVSKLETLETWMMPKKVFKVASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 627          
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Match: sp|Q5QQ57|XYLT1_PANTR (Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN=XYLT1 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.920e-88
Identity = 166/448 (37.05%), Postives = 253/448 (56.47%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID--LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    +++  +YSNV V  W M TIWGGASLL  Y ++M+D+       WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y+  + D+L+  +  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     +YP +      S+  N Y    + D   SL+        S  +  ++    SL T G +   +  +    S+ +       +  +IK+H  +     + T        K ++ +S    S+F  + F  VG D+D KE LFR    L+ P
Sbjct:  310 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTA---RPTFFARKFEAVVNQEIIGQLDYYLYGNYP-AGTPGLRSYWENVYD---EPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPP--SDFGRLQFSEVGTDWDAKERLFRNFGGLLGP 748          
BLAST of Xylosyltransferase vs. TrEMBL
Match: H3AK56 (Xylosyltransferase 1 OS=Latimeria chalumnae OX=7897 GN=XYLT1 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 3.518e-92
Identity = 168/448 (37.50%), Postives = 256/448 (57.14%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLD---NKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIIT--------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSF-MVGQDYDTKENLFRTLPFLMVP 1391
            N V I F+L++ GR   QL + FK+IY   ++Y+IH+DKR  +L    I+   +Y NV V  W M TIWGGASLL  Y ++M+D+   +   WDF INLS +DYPIR+ ++L  FL  + +KNF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y+  + D+L+ N+  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GCRCQ+  +V WCGCSP+  +  +++  +      R  FFARKF+  +++ II +LD     SYP  +  N  ++  N Y    + D  QS + +L     S  +  ++    SL T G +        + + I         +  ++K+H  +     + T        K ++ ++    S+F  + F  +G D+D KE +FR    LM P
Sbjct:   21 NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVIQFATRYPNVRVTPWRMATIWGGASLLTTYLQSMKDLLEMRDWPWDFFINLSAADYPIRTNEQLVAFLSRHQDKNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRKIPEGITVDGGSDWFILNRRFVEYVTYSNDDLVANMKRFYSYTLLPAESFFHTVLENSPHCESMVDNNLRITNWNRKLGCRCQYKHIVDWCGCSPNDFKPGDFHRFQQTA---RPTFFARKFEAVVNQEIIAQLDYYLYGSYPPGTL-NLKAYWENMYD---EADGVQSTSDTLLTMYHSFSRLGLRRAETSLHTDGNNSCRYFPMGHPVSIHLYFLADRFQGYLVKHHATNLATSKLETLETWVMPKKVFKIANPP--SDFGRLQFSEIGVDWDAKERIFRNFGGLMGP 459          
BLAST of Xylosyltransferase vs. TrEMBL
Match: A0A336JZS1 (CSON010162 protein OS=Culicoides sonorensis OX=179676 GN=CSON010162 PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.860e-90
Identity = 141/298 (47.32%), Postives = 204/298 (68.46%), Query Frame = 3
Query:   81 NKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSY 974
            N+  V I FLL ++GR + Q+Y+  KS+Y+P +Y+FIHID R  ++    + L  K+SN+ +      TIWGGASLL     AMQD+      WD++INLSESD+P++++D+L  FL AN  KNFVKS G+ T  FI+KQGL+K F+EC+ H++ +GDR LP N+ +DGGSDW  LS +FV Y+V  +D L+  LL  F  +LLPAE+FFH  L+NS+FC + I+ NL  TNW R+ GC+CQ+  VV WCGCSP+  +S +++ L    T+ ++I+FARKF+  I+ ++I +L+   Y
Sbjct:  271 NQKPVKIAFLLTLNGRAIRQVYRLIKSLYRPNHYFFIHIDSRQRYMYRELLSLESKFSNIRLARHRFSTIWGGASLLKMLMAAMQDLLQSPWDWDYIINLSESDFPVKTVDKLVRFLSANFGKNFVKSHGRETQRFIQKQGLDKTFVECDNHMWRIGDRELPENIQIDGGSDWLALSRDFVEYVVQEQDELVQGLLKIFGQTLLPAESFFHTVLRNSRFCHTYIDNNLHITNWRRKLGCKCQYKHVVDWCGCSPNDFKSEDWSRLEG--TEQKAIYFARKFEPVINHAVIIQLEEWVY 566          
BLAST of Xylosyltransferase vs. TrEMBL
Match: Q2KT96 (Protein-O-xylosyltransferase OS=Drosophila willistoni OX=7260 GN=xt PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 9.042e-90
Identity = 160/449 (35.63%), Postives = 256/449 (57.02%), Query Frame = 3
Query:   66 VATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTK--DNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNF--EIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            +AT   +++V I FLL ++GR + Q+++  K++Y P + Y+IH+D+R  +L    + L  K+SN+ +      TIWGGASLL    + MQD+     +WDF+INLSESD+P++++D+L  FL AN  +NFVK  G+ T  FI+KQGL+K F+EC+ H++ +GDR LP  + VDGGSDW  LS  FV Y+   +  D L+  LL  F ++LLPAE+FFH  L+N++ C + ++ NL  TNW R++GC+CQ+  VV WCGCSP+  +  ++  L+   T+ +S+FFARKF+  I+++++ +L+   Y        N H +  + Y    +   +  LA S+   LM     ++K  P  L    +  +L  +Q    ++      +   D    + +Y  +     I+  +       + F   + +F V  D+D KE + R    LM PN
Sbjct:  227 IATPTGESRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELETKFSNIRLARKRFSTIWGGASLLTMLLQCMQDLLKSNWQWDFVINLSESDFPVKTLDKLVDFLSANRGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSKSFVDYVTHPRKDDELLQALLKLFRHTLLPAESFFHTVLRNTEHCHTYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWARLQ--ATEQKSLFFARKFEPIINQAVLLQLEEWLYGPYTQEYVNLHGYWQSLYDHEDQHGGHDDLARSVGDSLMRLAAKQLKVAPLELLE--LTHYLHRDQYKGFLVR----FRARRDDPNAKDLYLET----RIRPVQQGKLARNARFSKRLRNFEVSTDFDQKEQIARNFAKLMGPN 663          
BLAST of Xylosyltransferase vs. TrEMBL
Match: B4J0I5 (GH16481 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH16481 PE=4 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.236e-89
Identity = 164/457 (35.89%), Postives = 256/457 (56.02%), Query Frame = 3
Query:   51 FTFNFVATSK---NKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLV--TTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVY--TYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            FT    A+S    ++ +V I FLL ++GR + Q+++  +++Y P + Y+IH+D R  +L    + L  K+ N+ +      TIWGGASLL    + MQD+      WDF+INLSESD+P++++D+L  F+ AN  +NFVK  G+ T  FI+KQGL+K F+EC+ H++ +GDR LPT + VDGGSDW  LS  FVSY+     +D L+  LL  F ++LLPAE+FFH  L+N++ C S ++ NL  TNW R++GC+CQ+  VV WCGCSP+  +  ++   R + T+ +S+FFARKF+  I+++++ +L+   Y    S   N H +  + Y    K      LA ++   LM     + K  P  L    +  +L  +Q    ++  +V+ +        E        GK     ++    SK   NFE+ +     D+D KE + R    L+ P 
Sbjct:  236 FTAQLAASSPAPGDEQRVRIAFLLTLNGRALRQVHRLLRALYAPQHVYYIHVDARQDYLYRQLLELEPKFPNIRLARKRFSTIWGGASLLTMLMQCMQDLLQSHWPWDFVINLSESDFPVKTLDKLVEFMSANRGRNFVKGHGRETQRFIQKQGLDKTFVECDTHMWRIGDRKLPTGIQVDGGSDWVALSRPFVSYVTHPAKEDKLLQALLQLFRHTLLPAESFFHTVLRNTQHCHSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWA--RLLATEQKSLFFARKFEPIINQAVLLQLEEWLYGPYTSEYANLHGYWQSLYHHEDKHGAGDDLARTVGDSLMRHAAQQFKLQPVELLE--LTHYLHRDQYKGFLLRYNVLRRNDSKELQMETRVRPVQHGKVARNARF----SKRLRNFEVST-----DFDQKEQVARNFAKLLGPQ 679          
BLAST of Xylosyltransferase vs. TrEMBL
Match: B4N301 (Oxt OS=Drosophila willistoni OX=7260 GN=Dwil\oxt PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.881e-89
Identity = 163/456 (35.75%), Postives = 258/456 (56.58%), Query Frame = 3
Query:   51 FTFNFVATSK--NKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTK--DNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYP--LSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNF--EIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            FT    ATS    +++V I FLL ++GR + Q+++  K++Y P + Y+IH+D+R  +L    + L  K+SN+ +      TIWGGASLL    + MQD+     +WDF+INLSESD+P++++D+L  FL AN  +NFVK  G+ T  FI+KQGL+K F+EC+ H++ +GDR LP  + VDGGSDW  LS  FV Y+   +  D L+  LL  F ++LLPAE+FFH  L+N++ C + ++ NL  TNW R++GC+CQ+  VV WCGCSP+  +  ++  L+   T+ +S+FFARKF+  I+++++ +L+   Y        N H +  + Y    +   +  LA S+   LM     ++K  P  L    +  +L  +Q    ++      +   D    + +Y  +     I+  +       + F   + +F V  D+D KE + R    LM PN
Sbjct:  240 FTAQLAATSSPTGESRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELETKFSNIRLARKRFSTIWGGASLLTMLLQCMQDLLKSNWQWDFVINLSESDFPVKTLDKLVDFLSANRGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSKSFVDYVTHPRKDDELLQALLKLFRHTLLPAESFFHTVLRNTEHCHTYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWARLQ--ATEQKSLFFARKFEPIINQAVLLQLEEWLYGPYTQEYVNLHGYWQSLYDHEDQHGGHDDLARSVGDSLMRLAAKQLKVAPLELLE--LTHYLHRDQYKGFLVR----FRARRDDPNAKDLYLET----RIRPVQQGKLARNARFSKRLRNFEVSTDFDQKEQIARNFAKLMGPN 683          
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Match: xylt2 (xylosyltransferase 2 [Source:NCBI gene;Acc:103031104])

HSP 1 Score: 293.508 bits (750), Expect = 5.295e-88
Identity = 136/301 (45.18%), Postives = 199/301 (66.11%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSK-KLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSY 974
            SK +N V + F+LM+ GR + QL +  K+IY   ++Y+IH+DKR  +L    +++ + Y NV    W M TIWGGASLL AY ++MQD+ S  + KWDF INLS +D+P R+ DEL  FL  N +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  L V GGSDWF L+  FV ++VT++D L+  L  F+  +LLPAE+FFH  L NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +   ++ +    R  FFARKF+ ++++  I  LD   Y
Sbjct:  235 SKVENPVRVAFVLMVHGRAIRQLKRLLKAIYHKDHFYYIHVDKRSNYLHREVLQMAELYPNVRATPWRMVTIWGGASLLKAYLRSMQDLLSMLEWKWDFFINLSATDFPTRTNDELVVFLSQNRDKNFLKSHGRENARFIKKQGLDRLFHECDNHMWRLGERTIPEGLEVSGGSDWFSLTRRFVEHVVTSQDELVNGLKQFYTYALLPAESFFHTVLGNSHMCDTLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPTDLIRIQQLT---RPTFFARKFESTVNQEAIDILDTHLY 532          
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Match: xylt1 (xylosyltransferase 1-like [Source:NCBI gene;Acc:103042681])

HSP 1 Score: 292.738 bits (748), Expect = 1.068e-87
Identity = 162/447 (36.24%), Postives = 257/447 (57.49%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID---LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYE-SSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I F+L++ GR   Q+ + FK+IY  +++Y+IH+D+R  FL    I L ++Y NV V  W M TIWGGASLL  Y ++M+D+ +  +  WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y++ ++D+L+ ++  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +    ++ R+  T  R  FFARKF+ S+++ I+ +LD+    S P  +     S+  N Y    + D   SL+ +L   L +  +  +     SL     D    +  +    S+ +       +  ++++H  +     + T        K ++ ++   T +  ++    +G D+D KE +FR    LM P
Sbjct:  241 VRIAFVLVVHGRAARQVQRLFKAIYHTSHFYYIHVDQRSNFLHRQMIALSNQYPNVRVTPWRMSTIWGGASLLSMYLQSMRDLLAMPEWPWDFFINLSAADYPIRTNDQLVAFLSKYRDMNFIKSHGRDNARFIRKQGLDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRVFVEYVINSQDDLVTSMKRFYAYTLLPAESFFHTVLENSPHCESMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKP--SDLPRFQQTT-RPTFFARKFEASVNQEIVNQLDSFLFGSLPQGTPA-LSSYWENLYD---EADGVHSLSDTLLTHLHAFARLGLTRATSSLQGDSSDNHCRYFAMGHPVSVHLYFLSDEFQGYLVRHHATNLATSKLETLETWIMPKKFFKFTNPPNTFNRLQLAE--IGTDWDAKERIFRNFGNLMGP 678          
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Match: xylt1 (xylosyltransferase 1-like [Source:NCBI gene;Acc:103042681])

HSP 1 Score: 291.967 bits (746), Expect = 4.063e-87
Identity = 162/447 (36.24%), Postives = 257/447 (57.49%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGID---LFLGINQNNSIIIT------KDVIIKYHHDSFGFEAVYTYSGKAGTIKQYE-SSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            V I F+L++ GR   Q+ + FK+IY  +++Y+IH+D+R  FL    I L ++Y NV V  W M TIWGGASLL  Y ++M+D+ +  +  WDF INLS +DYPIR+ D+L  FL    + NF+KS G+    FIRKQGL++ F EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y++ ++D+L+ ++  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +    ++ R+  T  R  FFARKF+ S+++ I+ +LD+    S P  +     S+  N Y    + D   SL+ +L   L +  +  +     SL     D    +  +    S+ +       +  ++++H  +     + T        K ++ ++   T +  ++    +G D+D KE +FR    LM P
Sbjct:  299 VRIAFVLVVHGRAARQVQRLFKAIYHTSHFYYIHVDQRSNFLHRQMIALSNQYPNVRVTPWRMSTIWGGASLLSMYLQSMRDLLAMPEWPWDFFINLSAADYPIRTNDQLVAFLSKYRDMNFIKSHGRDNARFIRKQGLDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRVFVEYVINSQDDLVTSMKRFYAYTLLPAESFFHTVLENSPHCESMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKP--SDLPRFQQTT-RPTFFARKFEASVNQEIVNQLDSFLFGSLPQGTPA-LSSYWENLYD---EADGVHSLSDTLLTHLHAFARLGLTRATSSLQGDSSDNHCRYFAMGHPVSVHLYFLSDEFQGYLVRHHATNLATSKLETLETWIMPKKFFKFTNPPNTFNRLQLAE--IGTDWDAKERIFRNFGNLMGP 736          
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 62.3882 bits (150), Expect = 7.417e-10
Identity = 67/294 (22.79%), Postives = 134/294 (45.58%), Query Frame = 3
Query:  114 MISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIA---FIRKQGLNKAFIECNEHLYLV--GDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNW-NRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN 965
            ++  +++  + +  ++IY PTN Y IH D++ +     A++ L   + N+ +        +   + L A    + D+ S ++KW + INL   D+P+RS  EL   L+     N ++SS  S +    F+ +  L     E ++            P ++ +  GS +F LS +FV Y+ T +  +  + L +  ++  P E F+    +       +  +    T+  ++ R  + ++     + GC+ + +RS   Y    LR+++  D   +FA KFD  +D  +I  L+ 
Sbjct:  129 LVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKCFPNIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQ--VAKDFLDWSADTYSPDEHFWATLARVPGVPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLL--DDGHWFANKFDPKVDPVLIKCLEE 418          
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 60.4622 bits (145), Expect = 3.022e-9
Identity = 75/326 (23.01%), Postives = 141/326 (43.25%), Query Frame = 3
Query:   57 FNFVATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRH-----AFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRY-------------LPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNW-NRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNK 968
            F+ + TS+ + +  + + L++  ++   + +   +IY P N Y IH D +      A ++  A+ L     NV +        +   + L A    + D+   K+KW ++INL   D+P+RS  EL   L+A          G S +   R   L K     +  L  VG +Y              P  L +  GS +F LS EFVS++  +   ++ + L++ E++  P E F+   ++       +  ++   ++  +R R  + Q+     +  C+   +RS   Y    LR+++      +FA K D  +D  ++  L+ K
Sbjct:  101 FHSIRTSQIEREFPLAYSLVVH-KEAAMVERILWAIYVPHNSYCIHYDLKSSPEFMAAMQGLALCL----PNVFIASKLERVQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKA--------LKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSP--MVKDFLSWSEDTYSPDEHFWATLIRVPGVPGELSRSDPDVSDLASRTRLVKWQYLEGKLYPACTGVHIRSVCIYGAGELRWLLNDGH--WFANKLDPRVDPVLVECLEEK 409          
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Match: xylt2 (xylosyltransferase II [Source:ZFIN;Acc:ZDB-GENE-081022-125])

HSP 1 Score: 298.13 bits (762), Expect = 7.026e-92
Identity = 164/452 (36.28%), Postives = 252/452 (55.75%), Query Frame = 3
Query:   84 KNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSY---PLSSCTNFHSHMLNFY-----SGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFT-------SGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            ++ V + F+L + GR   QL Q F++IY  +++Y+IH+DKR  +L    + L  +Y NV V  W M TIWGGASLL  Y +AM D+ +     WDF INLS SDYPIRS +EL  FL    +KNF+KS G+ T  FI+KQGLN+ F EC+EH++ VG+R +P  + +DGGSDWF ++ +FVSY++ +K  L+  L  F+  +LLPAE+FFH  L NS+ C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  + ++    + +    R  FFARKF+  + + ++  LD   +   P  S  +  ++  N Y     S    GD   ++   L+   ++Q   +      SL +       +   ++   ++   I++ +      H  S   E + T++  +   K Y S+        E     VG D+D KE +FR    L+ P
Sbjct:   76 RSPVRVAFVLAVHGRASRQLLQMFRAIYHASHFYYIHVDKRSNYLYKQVLVLAQRYENVRVTSWRMSTIWGGASLLTMYLRAMSDLMAMDDWPWDFFINLSGSDYPIRSNNELVAFLTKYKDKNFLKSHGRETEKFIKKQGLNRVFHECDEHMWRVGERKMPAGIAIDGGSDWFAVTRQFVSYIIHSKSRLVSQLKQFYAFALLPAESFFHTLLVNSEHCATLVDNNLRMTNWNRKLGCKCQYKHIVDWCGCSPNDFKMHDLPRFQQLT---RPTFFARKFEAVVSQGVLTSLDAALFGGPPPPSGPSLQAYWENAYDERTDSSASLGDAALTIYQGLFRLGLAQNAHQTPRSGSSLCSYEPVGHPTAAHIYFSADRFQGILVQQRA---SHSASRHEEVLETWAYPSNHYKVYNSTLLPRLQKME-----VGTDWDPKERVFRNFGGLLGP 516          
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Match: xylt1 (xylosyltransferase I [Source:ZFIN;Acc:ZDB-GENE-111017-2])

HSP 1 Score: 295.049 bits (754), Expect = 7.407e-90
Identity = 133/301 (44.19%), Postives = 203/301 (67.44%), Query Frame = 3
Query:   87 NQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYP 977
            N V IVF+L++ GR + QL +  K+IY   +YY+IH+DKR  +L+   +++ ++Y NV V  W M TIWGGASLL  Y + M+D+       WDF INLS +DYPIR+ D+L  FL    +KNF+KS G+    F++KQGL++ F EC+ H++ +GDR +P  ++VDGGSDWF L+  FV Y++ ++  L+  L  F+  +LLPAE+F+H  L+NS+ C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +++  + +    R  FFARKF+ ++++ +I +LD+    SYP
Sbjct:  167 NPVRIVFVLVVHGRAIRQLSRMLKAIYHRDHYYYIHVDKRSNYLQRQVLQVAERYPNVRVTPWRMATIWGGASLLTMYLRTMKDLLDMADWAWDFFINLSATDYPIRTNDQLVAFLTKYRDKNFLKSHGRDNNRFVKKQGLDRIFYECDTHMWRLGDRKIPDGIVVDGGSDWFALNRPFVEYVMRSQGELVSELKRFYAYTLLPAESFYHTVLENSEHCGSLVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQMA---RPTFFARKFESAVNQEVIEQLDSYLYGSYP 464          
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 65.4698 bits (158), Expect = 1.292e-11
Identity = 53/220 (24.09%), Postives = 102/220 (46.36%), Query Frame = 3
Query:   69 ATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKR--HAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANI-NKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYL---VGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFF 710
            A SK +    + +++ +  +D       F++IY P N Y IH+D +   +F +S   RL   + NV +   S   ++ G S L A    M+D+ ++   W +++NL   D+P+R+  E+   L+     KN      Q      R Q + K  ++ ++   +   V     P  + +  G+ ++ ++ EFV Y++   D    +LL + + +  P E +F
Sbjct:   84 ALSKEEQDFPLAYIITVH-KDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQ-RLAGCFDNVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVL--DDKKAQDLLEWSQETFSPDEHYF 299          
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 55.4546 bits (132), Expect = 1.903e-8
Identity = 72/322 (22.36%), Postives = 133/322 (41.30%), Query Frame = 3
Query:  114 MISGRDVLQLYQQFKSIYKPTNYYFIHID-KRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRY-------LPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNS---------KFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYPLSSCTNFHSHMLNF 1019
            ++  ++   L +  ++I+ P N Y +H+D K     +S    L   + NV V        +   S L A    + D+    ++W + INL   D+P+RS  EL + L++   ++ +++   S     ++Q     F+       L   ++        P  L V  GS +F LS EFV + +T+   +  + L +  ++  P E F+    ++          K   S + +  R   W+   G          +  CS   +RS   Y    L +++      +FA KFD  +D  ++  L+ +   +SS  N  +H LN 
Sbjct:   67 IVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKCFDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSA---YKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSA--VAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEG--------RLYPVCSGRHVRSVCIYGAAELGWLLRDGH--WFANKFDPHVDPVVVKCLEEE---ISSRQN--AHCLNM 368          
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 54.6842 bits (130), Expect = 3.505e-8
Identity = 66/305 (21.64%), Postives = 125/305 (40.98%), Query Frame = 3
Query:  114 MISGRDVLQLYQQFKSIYKPTNYYFIHID-KRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRY-------LPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNS---------KFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNK 968
            ++  ++   L +  ++I+ P N Y +H+D K     +S    L   + NV V        +   S L A    + D+    ++W + INL   D+P+RS  EL + L++   ++ +++   S     ++Q     F+       L   ++        P  L V  GS +F LS EFV + +T+   +  + L +  ++  P E F+    ++          K   S + +  R   W+   G          +  CS   +RS   Y    L +++      +FA KFD  +D  ++  L+ +
Sbjct:   68 IVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKCFDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSA---YKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSA--VAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEG--------RLYPVCSGRHVRSVCIYGAAELGWLLRDGH--WFANKFDPHVDPVVVKCLEEE 357          
BLAST of Xylosyltransferase vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 276.944 bits (707), Expect = 1.192e-83
Identity = 157/449 (34.97%), Postives = 250/449 (55.68%), Query Frame = 3
Query:   93 VVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQD-ITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSI-FFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGN----QKGDVYQSLAYSL----YARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNN---SIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVP 1391
            + I ++L + GR + Q+ + FK IY   +Y++ HID R  +LR     +   + N  +  WSM TIWGGA+LL    K+M+D I  K+ KWDF INLS +D+PI+    L +FLR++ + NF+K  G+    FI+KQGL++ F++C+EH++ +GDR LP +L +DGGSDW  L+ ++  YLVT++D L+  L   +  +LLPAE+FFH AL+N   C + +++NLR TNW R+ GCRCQ+  +V WCGCSP+  +    +M R  V Q +S  FFARKF+  +++ +I +LD      YP  +   +  +  N Y       +  D + S  +S       RL+   Q   +  P+     G+     +NQ++    ++   +V+ +   +  G +     S  +   K+   + +       +VS  VG  +D KE +FR L  L+ P
Sbjct:   78 IRIAYVLSLHGRALRQIRRLFKVIYHTHHYFYFHIDTRSDYLRREVSNMIKDFPNAALAPWSMATIWGGATLLQMLLKSMEDLIARKEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDELVTGLKHMYRYTLLPAESFFHTALRNGPHCQNWLSSNLRLTNWKRKLGCRCQYKHIVDWCGCSPNNFKP--EDMARIKVNQSQSTNFFARKFEAIVNQEVINQLDEWLYGKYPQGT-PGWDYYWENLYHHEDTLTRTSDPFLSFFHSFPRVAIKRLLRGMQDDCQITPQ-----GVREVTYLNQHDHFSGVVALYEVLFETPRNG-GKQRAVLESWLSPVAKEELMNLNMKNGPQRLVSLDVGTSWDQKERVFRNLARLIGP 517          
BLAST of Xylosyltransferase vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 57.7658 bits (138), Expect = 3.001e-9
Identity = 53/199 (26.63%), Postives = 91/199 (45.73%), Query Frame = 3
Query:  135 LQLYQQF-KSIYKPTNYYFIHIDKR-HAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYL-----PTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFF 710
            L L+++  +++Y P NYY IHIDK+ +++    A R+     NV +    +   WG  SL+ A    M ++ +   KW + INL   D+P+ +  E+   L++          G + I  I     N   +E   H    G + L     P  LI+  GS    L+ +F  +++  +D +  +LL + E+     E FF
Sbjct:   31 LPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACLPNVFIAKTRVNVKWGEISLVKAELSCMTELQT--FKWKYYINLVGQDFPLYNNMEIVRVLKS--------LHGLNNIESIEMPAYNVHRVEFVRH----GQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVL--RDKVARDLLKWLEDVFAADEIFF 213          
BLAST of Xylosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000001297.2 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 302.753 bits (774), Expect = 2.864e-91
Identity = 168/471 (35.67%), Postives = 258/471 (54.78%), Query Frame = 3
Query:   42 LFGFTFNFVATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNS---IIITKDVIIKYH--HDSF-GFEAVYTYSGKAGTIKQYESS----------SSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
            L    ++    S       I F+L++ GR   QL + FK+IY  ++YY+IH+D+R  FL    + L  +Y NV V  W M TIWGGASLL  Y ++M+D+ S     WDF INLS +D+PIR+ ++L  FL  + +KNF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF LS  FV Y+V + D L+ ++  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +   L+      R  FFARKF+ S+ + +I +LD     ++P  +     S+  N Y  +Q+ D   SL  S     +S +      F +   +       G   N+S   + ++  V +  +   D F G+   +  + +A T  +   +          +S   +N  +    VG D+D KE +FR    L+ P 
Sbjct:  257 LMTVQWDEGVASDGAPPACIAFVLVVHGRASRQLQRLFKAIYHTSHYYYIHVDQRSDFLHREVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNSGDELVNSMKRFYAYTLLPAESFFHTVLENSAHCETMVDNNLRLTNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDLPRLQQT---SRPTFFARKFEASVSQEVINQLDAFLFGAFPPGT-PGLQSYWENVY--DQETDGLSSLPDS----RLSHYH----AFARMGLSHAAGFLQGRPDNHSCRFMAVSHPVSVHLYFVSDRFRGYLVRHVATNRASTQMETLETWVTPTDHFALASPPHANNRLQHIQVGSDWDPKERIFRNWGGLLGPE 713          
BLAST of Xylosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000033084.1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 302.753 bits (774), Expect = 1.037e-90
Identity = 167/461 (36.23%), Postives = 255/461 (55.31%), Query Frame = 3
Query:   72 TSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNS---IIITKDVIIKYH--HDSF-GFEAVYTYSGKAGTIKQYESS----------SSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPN 1394
             S       I F+L++ GR   QL + FK+IY  ++YY+IH+D+R  FL    + L  +Y NV V  W M TIWGGASLL  Y ++M+D+ S     WDF INLS +D+PIR+ ++L  FL  + +KNF+KS G+    FIRKQGL++ F+EC+ H++ +GDR +P  + VDGGSDWF LS  FV Y+V + D L+ ++  F+  +LLPAE+FFH  L+NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +   L+      R  FFARKF+ S+ + +I +LD     ++P  +     S+  N Y  +Q+ D   SL  S     +S +      F +   +       G   N+S   + ++  V +  +   D F G+   +  + +A T  +   +          +S   +N  +    VG D+D KE +FR    L+ P 
Sbjct:  338 ASDGAPPACIAFVLVVHGRASRQLQRLFKAIYHTSHYYYIHVDQRSDFLHREVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNSGDELVNSMKRFYAYTLLPAESFFHTVLENSAHCETMVDNNLRLTNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDLPRLQQT---SRPTFFARKFEASVSQEVINQLDAFLFGAFPPGT-PGLQSYWENVY--DQETDGLSSLPDS----RLSHYH----AFARMGLSHAAGFLQGRPDNHSCRFMAVSHPVSVHLYFVSDRFRGYLVRHVATNRASTQMETLETWVTPTDHFALASPPHANNRLQHIQVGSDWDPKERIFRNWGGLLGPE 784          
BLAST of Xylosyltransferase vs. Ensembl Medaka
Match: xylt1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049390])

HSP 1 Score: 299.286 bits (765), Expect = 1.038e-89
Identity = 169/461 (36.66%), Postives = 258/461 (55.97%), Query Frame = 3
Query:   69 ATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDN---KSYPLSSCTNFHSHMLNFYSGNQKGDV----------YQSLAYSLYARLMSQFQ-----FKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFM-VGQDYDTKENLFRTLPFLMVP 1391
            A S   N V I F+L+I GR   Q  + FK+IY  +++Y+IH+D+R  +L      +  KY NV V  W M TIWGGASLL  Y ++M D+ + +   WDF INLS +DYPIR+ ++L  FL    + NF+KS G+    FIRKQGL++ F EC+ H++ +GDR +P  + VDGGSDWF L+  FV Y++ +KD+L+ ++  F+  +LLPAE+FFH  L+NS  C S+++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  ++   +  V   R  FFARKF+ S+++ I+ +LD      +P  S    +S+  N Y  ++   V          Y S +    AR  +  Q        + FP     S + L+   +Q       +  ++K+H ++     + T        K ++ ++  T S F  + F  VG ++D KE +FR +  LM P
Sbjct:  296 AESFPSNPVRIAFVLVIHGRASRQFQRLFKAIYHTSHFYYIHVDQRSNYLHRQVQIMAMKYPNVRVTPWRMATIWGGASLLTMYLRSMADLLAMRDWSWDFFINLSAADYPIRTNNQLVAFLSKYRDMNFIKSHGRDNARFIRKQGLDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRMFVDYVINSKDDLVTSMKRFYAYTLLPAESFFHTVLENSAHCESMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPADFPRFQQTV---RPTFFARKFEASVNQEIVNQLDAYLFGPFPQGSPA-LNSYWENAY--DEPDGVASLSDTMLTYYHSFSRMGLARAAASLQGNPNDHSCRYFPMGHPVS-VHLYFHSDQ------FQGYLVKHHANNLATRKLETMETWVAPKKSFKLTTPPT-STFSRLQFAEVGTEWDAKERMFRNIGGLMGP 742          
BLAST of Xylosyltransferase vs. Ensembl Medaka
Match: xylt2 (xylosyltransferase 2 [Source:NCBI gene;Acc:100049492])

HSP 1 Score: 288.5 bits (737), Expect = 4.022e-86
Identity = 135/301 (44.85%), Postives = 196/301 (65.12%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITS-KKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSY 974
            SK KN V + F+LM+ GR V QL +  K+IY   ++++IH+DKR +++    +++   Y N+    W M TIWGGASLL AY ++MQD+ S  + KWDF INLS +D+P R+ DEL  FL    +KNF+KS G+    FI+KQGL++ F EC+ H++ +G+R +P  L V GGSDWF L+  FV Y++ ++D L+  L  F+  +LLPAE+FFH  L NS  C ++++ NLR TNWNR+ GC+CQ+  +V WCGCSP+  +  +   L  I    R  FFARKF+ ++++  I  LD   Y
Sbjct:  243 SKVKNPVRVAFVLMVHGRAVRQLKRLIKAIYHRDHFFYIHVDKRCSYMHREVLQMAKHYPNIRATPWRMVTIWGGASLLKAYLRSMQDLLSMAEWKWDFFINLSATDFPTRTNDELVAFLSQYRDKNFLKSHGRENTRFIKKQGLDRLFHECDNHMWRLGERSIPKGLEVSGGSDWFALTRPFVEYVIHSQDELVLGLKQFYSYALLPAESFFHTVLGNSHMCDTLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQD---LIRIQQLSRPTFFARKFESTVNQEAIEILDTHLY 540          
BLAST of Xylosyltransferase vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 71.633 bits (174), Expect = 6.959e-13
Identity = 66/294 (22.45%), Postives = 126/294 (42.86%), Query Frame = 3
Query:   75 SKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPT--NLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFF----HMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRS---YNYNMLRYIVTQDRSIFFARKFD 926
            S+ +    + F++ I  +D+    +  ++IY P N Y IHID +        +R L   + N+ +   S    +GG S L A    M+D+    + W  ++NL   D+PI+S  EL  ++++   ++   + G    A IR +   +       H+   G++  P   NL +  G+ ++ L+  FV +++  K  +  NLL + +++  P E ++    H+              ++R   W  + G   Q        GC    +R    Y    + +I+  +    FA KF+
Sbjct:   96 SQEEEDYPLAFIMTIH-KDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGCFENIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYFGTAYYALTRAFVDFVL--KSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGDIRAIKWKDQEGTNHQ--------GCKGHYVRDICVYGMGDIEWIINNNN--MFANKFE 376          
BLAST of Xylosyltransferase vs. Planmine SMEST
Match: SMESG000025103.1 (SMESG000025103.1)

HSP 1 Score: 1139.02 bits (2945), Expect = 0.000e+0
Identity = 570/592 (96.28%), Postives = 572/592 (96.62%), Query Frame = 3
Query:   63 FVATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPNKTXXXXXXXXXXXXXXXXXXXXXXDPDKNKYSFKLPKSTTTISSDNQWFDGSSRTFIWYHGFDIQMPYRIGLWQVILYMNEFRKPSIKTFFYIHSQNQSFFDNASDRLNQWKLKSFCIYPNSQCNENSVYFCNVSCTLDSLFDVNLTD 1838
            F  TSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPNKTLSLEIQISSLK                  +FKLPKSTTTISSDNQWFDGSSRTFIWYHGFDIQMPYRIGLWQVILYMNEFRKPSIKTFFYIHSQNQSFFDNASDRLNQWKLKSFCIYPNSQCN+NSVYFCNVSCTLDSLFDVNLTD
Sbjct:  167 FKTTSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYNYNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYPLSSCTNFHSHMLNFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGINQNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFEIVSFMVGQDYDTKENLFRTLPFLMVPNKTLSLEIQISSLK------------------NFKLPKSTTTISSDNQWFDGSSRTFIWYHGFDIQMPYRIGLWQVILYMNEFRKPSIKTFFYIHSQNQSFFDNASDRLNQWKLKSFCIYPNSQCNDNSVYFCNVSCTLDSLFDVNLTD 740          
BLAST of Xylosyltransferase vs. Planmine SMEST
Match: SMESG000043055.1 (SMESG000043055.1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.025e-12
Identity = 40/130 (30.77%), Postives = 67/130 (51.54%), Query Frame = 3
Query:   63 FVATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-----LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRA 437
            F   S  +    I F +M+  +   Q+ +  + IY+P N+Y  HIDK+       AIR     L  K++N+V+ +  +   WG  S+LIA    M+D+  +   W + INL+  ++P+++  EL   LRA
Sbjct:   58 FQEPSNEEKSFPIAFSIMV-FKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNLELVKILRA 186          
BLAST of Xylosyltransferase vs. Planmine SMEST
Match: SMESG000008805.1 (SMESG000008805.1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.025e-12
Identity = 40/130 (30.77%), Postives = 67/130 (51.54%), Query Frame = 3
Query:   63 FVATSKNKNQVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-----LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRA 437
            F   S  +    I F +M+  +   Q+ +  + IY+P N+Y  HIDK+       AIR     L  K++N+V+ +  +   WG  S+LIA    M+D+  +   W + INL+  ++P+++  EL   LRA
Sbjct:   58 FQEPSNEEKSFPIAFSIMV-FKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNLELVKILRA 186          
BLAST of Xylosyltransferase vs. Planmine SMEST
Match: SMESG000043051.1 (SMESG000043051.1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.262e-12
Identity = 64/263 (24.33%), Postives = 111/263 (42.21%), Query Frame = 3
Query:   63 FVATSKNKN-QVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-----LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKF----------------CTSVINTNLRYTNWNR 785
            F  T++ +N ++    +   SG  + +L    ++IY+P NYY IHIDK+     + A+      L  +Y N++  +  +   WG  S+L A    M+++  +   W +LINL+  ++P+++  EL   L+A    N                 L   +   NE  Y V    +P  LI   GS    ++ +F+ ++  +  +   +LL   +   +P E FF     N +F                   +IN   RY NW R
Sbjct:   89 FPNTTEEENFRIAFTIVTFKSGSQIERL---LRTIYRPWNYYCIHIDKKSDKKFTEALEELVKCLNSRYKNIINTENRVDVQWGKMSVLTADLNCMKELYERFKDWKYLINLTGQEFPLKTNRELVKILKAYKGAN----------------NLEGTYKRRNE--YRVPTVKMPFPLIWYKGSVHVTVNRDFIKFIFESPKS--QDLLKALKGQHVPDEQFFATLNHNPQFRIPGSFIGDPDDLELEKQPLINFMTRYKNWGR 328          
BLAST of Xylosyltransferase vs. Planmine SMEST
Match: SMESG000043051.1 (SMESG000043051.1)

HSP 1 Score: 67.781 bits (164), Expect = 4.568e-12
Identity = 64/263 (24.33%), Postives = 111/263 (42.21%), Query Frame = 3
Query:   63 FVATSKNKN-QVVIVFLLMISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIR-----LRDKYSNVVVFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSIDELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYLPTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFHMALQNSKF----------------CTSVINTNLRYTNWNR 785
            F  T++ +N ++    +   SG  + +L    ++IY+P NYY IHIDK+     + A+      L  +Y N++  +  +   WG  S+L A    M+++  +   W +LINL+  ++P+++  EL   L+A    N                 L   +   NE  Y V    +P  LI   GS    ++ +F+ ++  +  +   +LL   +   +P E FF     N +F                   +IN   RY NW R
Sbjct:   81 FPNTTEEENFRIAFTIVTFKSGSQIERL---LRTIYRPWNYYCIHIDKKSDKKFTEALEELVKCLNSRYKNIINTENRVDVQWGKMSVLTADLNCMKELYERFKDWKYLINLTGQEFPLKTNRELVKILKAYKGAN----------------NLEGTYKRRNE--YRVPTVKMPFPLIWYKGSVHVTVNRDFIKFIFESPKS--QDLLKALKGQHVPDEQFFATLNHNPQFRIPGSFIGDPDDLELEKQPLINFMTRYKNWGR 320          
The following BLAST results are available for this feature:
BLAST of Xylosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC099494.71.455e-8937.05Xylosyltransferase 1 [Source:UniProtKB/Swiss-Prot... [more]
AC099494.71.455e-8937.05Xylosyltransferase 1 [Source:UniProtKB/Swiss-Prot... [more]
XYLT11.274e-8837.05xylosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
XYLT28.333e-8835.27xylosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
XYLT23.810e-8643.99xylosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sqv-62.690e-6339.24Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-... [more]
sqv-62.690e-6339.24Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-... [more]
sqv-62.707e-2638.52Xylosyltransferase sqv-6 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt4.153e-9335.78gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xylt12.481e-8846.39xylosyltransferase I [Source:ZFIN;Acc:ZDB-GENE-111... [more]
xylt22.473e-8345.18xylosyltransferase II [Source:ZFIN;Acc:ZDB-GENE-08... [more]
gcnt73.269e-1323.23glucosaminyl (N-acetyl) transferase family member ... [more]
gcnt71.277e-1224.19glucosaminyl (N-acetyl) transferase family member ... [more]
gcnt31.400e-1124.14glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xylt18.971e-8936.61xylosyltransferase I [Source:NCBI gene;Acc:1001454... [more]
xylt11.131e-8836.61xylosyltransferase I [Source:NCBI gene;Acc:1001454... [more]
xylt11.276e-8836.61xylosyltransferase I [Source:NCBI gene;Acc:1001454... [more]
xylt11.858e-8836.61xylosyltransferase I [Source:NCBI gene;Acc:1001454... [more]
xylt22.505e-8735.65xylosyltransferase II [Source:NCBI gene;Acc:448400... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xylt22.169e-8936.16xylosyltransferase II [Source:MGI Symbol;Acc:MGI:2... [more]
Xylt13.171e-8936.83xylosyltransferase 1 [Source:MGI Symbol;Acc:MGI:24... [more]
Xylt23.510e-8842.14xylosyltransferase II [Source:MGI Symbol;Acc:MGI:2... [more]
Gcnt27.383e-1323.50glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
Gcnt28.550e-1224.08glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
back to top
BLAST of Xylosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KVA1|XYLT_DROME4.163e-9235.78Xylosyltransferase oxt OS=Drosophila melanogaster ... [more]
sp|Q5QQ50|XYLT2_CANLF1.046e-8835.94Xylosyltransferase 2 OS=Canis lupus familiaris OX=... [more]
sp|Q9EPL0|XYLT2_MOUSE1.517e-8836.16Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=X... [more]
sp|Q9EPI1|XYLT1_RAT2.250e-8836.83Xylosyltransferase 1 (Fragment) OS=Rattus norvegic... [more]
sp|Q5QQ57|XYLT1_PANTR4.920e-8837.05Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN... [more]
back to top
BLAST of Xylosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3AK563.518e-9237.50Xylosyltransferase 1 OS=Latimeria chalumnae OX=789... [more]
A0A336JZS11.860e-9047.32CSON010162 protein OS=Culicoides sonorensis OX=179... [more]
Q2KT969.042e-9035.63Protein-O-xylosyltransferase OS=Drosophila willist... [more]
B4J0I51.236e-8935.89GH16481 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
B4N3011.881e-8935.75Oxt OS=Drosophila willistoni OX=7260 GN=Dwil\oxt P... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xylt25.295e-8845.18xylosyltransferase 2 [Source:NCBI gene;Acc:1030311... [more]
xylt11.068e-8736.24xylosyltransferase 1-like [Source:NCBI gene;Acc:10... [more]
xylt14.063e-8736.24xylosyltransferase 1-like [Source:NCBI gene;Acc:10... [more]
gcnt4a7.417e-1022.79glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt4b3.022e-923.01beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xylt27.026e-9236.28xylosyltransferase II [Source:ZFIN;Acc:ZDB-GENE-08... [more]
xylt17.407e-9044.19xylosyltransferase I [Source:ZFIN;Acc:ZDB-GENE-111... [more]
GCNT21.292e-1124.09glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
gcnt4a1.903e-822.36glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a3.505e-821.64glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Xylosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO368351.192e-8334.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396173.001e-926.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Xylosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001297.22.864e-9135.67xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
ENSORLT00000033084.11.037e-9036.23xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
xylt11.038e-8936.66xylosyltransferase 1 [Source:NCBI gene;Acc:1000493... [more]
xylt24.022e-8644.85xylosyltransferase 2 [Source:NCBI gene;Acc:1000494... [more]
gcnt76.959e-1322.45beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of Xylosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025103.10.000e+096.28SMESG000025103.1[more]
SMESG000043055.13.025e-1230.77SMESG000043055.1[more]
SMESG000008805.13.025e-1230.77SMESG000008805.1[more]
SMESG000043051.14.262e-1224.33SMESG000043051.1[more]
SMESG000043051.14.568e-1224.33SMESG000043051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011480 ID=SMED30011480|Name=Xylosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1911bp
GTAAAATTTAATTAATTTTTCCATTAATAAATGACTAATCCTTATTTGGT
TTTACATTTAATTTTGTAGCAACTTCCAAAAATAAAAACCAAGTTGTTAT
TGTATTTCTTTTAATGATTAGTGGAAGAGATGTATTACAATTATATCAAC
AGTTCAAATCGATTTATAAACCAACAAATTATTATTTCATTCATATAGAC
AAAAGACATGCATTTCTAAGGAGCTACGCAATAAGGTTGCGGGATAAATA
TTCTAATGTTGTTGTTTTTGATTGGTCAATGCCAACAATTTGGGGTGGAG
CTAGCCTATTGATTGCCTATTTCAAGGCGATGCAAGATATTACGAGTAAA
AAATTGAAATGGGATTTTCTAATCAATCTAAGTGAATCGGACTATCCAAT
AAGGAGTATCGATGAATTGCAGACATTCCTTCGGGCAAATATCAACAAAA
ATTTTGTGAAATCTTCCGGTCAATCTACGATTGCATTCATAAGGAAGCAA
GGATTAAACAAAGCATTTATTGAATGCAATGAGCACCTGTATCTGGTTGG
TGATAGATATTTACCCACCAATCTCATTGTCGACGGTGGCTCGGACTGGT
TTGGATTGTCGTTTGAATTTGTCTCATACTTAGTTACGACTAAAGATAAC
CTTATTCCAAACTTACTTGCGTTTTTTGAAAATTCTTTGCTTCCAGCTGA
AACATTCTTTCACATGGCATTGCAAAATAGCAAATTTTGTACCTCAGTAA
TTAATACAAATCTTCGATATACTAATTGGAACCGAGAAAGAGGATGTCGT
TGTCAACACTCGTCTGTTGTTGGGTGGTGTGGATGTTCTCCTTCTGTTTT
ACGCAGCTATAACTATAATATGCTCCGTTATATAGTTACACAAGATCGAT
CTATATTCTTTGCGAGAAAGTTTGATTTCTCTATAGATAAATCTATTATA
TACAAACTTGACAATAAAAGTTATCCGTTGAGTTCTTGCACAAACTTTCA
TAGTCATATGTTGAATTTTTATTCTGGAAACCAGAAAGGCGACGTTTATC
AGTCTCTCGCATATTCACTTTATGCTAGACTCATGTCGCAATTTCAATTC
AAAATCAAATGCTTTCCTAAATCATTGTTTACTTCGGGAATTGATTTGTT
TCTTGGAATCAATCAAAACAATTCAATTATTATTACCAAAGATGTAATTA
TTAAGTATCATCACGACAGTTTTGGATTTGAAGCTGTTTACACGTATTCC
GGTAAAGCGGGCACCATCAAGCAATACGAATCTTCATCGAGTAAAACTCA
ATCAAATTTTGAGATAGTTTCCTTTATGGTTGGGCAAGATTATGACACGA
AAGAAAATCTTTTTCGTACTCTTCCTTTCTTGATGGTTCCAAACAAGACT
TTGTCATTAGAAATTCAGATTTCTTCTTTGAAAAAGTTGAAACTAATTTT
CTATATTCTCTTTATTGACCCGGATAAAAACAAATATAGCTTCAAATTGC
CGAAATCGACTACAACTATTTCCAGTGATAATCAATGGTTTGATGGATCA
TCTAGAACCTTTATCTGGTATCATGGTTTTGACATTCAAATGCCATATAG
AATTGGGCTGTGGCAAGTTATTTTGTACATGAATGAATTTCGTAAACCCA
GCATCAAAACGTTTTTCTATATCCATTCACAGAATCAATCTTTCTTTGAC
AATGCATCAGATAGACTCAATCAATGGAAATTGAAATCGTTTTGCATTTA
TCCCAATAGCCAGTGCAATGAAAACTCGGTATATTTCTGTAATGTTTCTT
GTACGTTAGATAGCTTATTCGATGTCAACTTGACTGACTAACTCTTATTT
TCACATCGATTATGTCTCACTCAATATGTTTATTTTTTAGACAATACATT
TTTGAAATTTC
back to top

protein sequence of SMED30011480-orf-1

>SMED30011480-orf-1 ID=SMED30011480-orf-1|Name=SMED30011480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MISGRDVLQLYQQFKSIYKPTNYYFIHIDKRHAFLRSYAIRLRDKYSNVV
VFDWSMPTIWGGASLLIAYFKAMQDITSKKLKWDFLINLSESDYPIRSID
ELQTFLRANINKNFVKSSGQSTIAFIRKQGLNKAFIECNEHLYLVGDRYL
PTNLIVDGGSDWFGLSFEFVSYLVTTKDNLIPNLLAFFENSLLPAETFFH
MALQNSKFCTSVINTNLRYTNWNRERGCRCQHSSVVGWCGCSPSVLRSYN
YNMLRYIVTQDRSIFFARKFDFSIDKSIIYKLDNKSYPLSSCTNFHSHML
NFYSGNQKGDVYQSLAYSLYARLMSQFQFKIKCFPKSLFTSGIDLFLGIN
QNNSIIITKDVIIKYHHDSFGFEAVYTYSGKAGTIKQYESSSSKTQSNFE
IVSFMVGQDYDTKENLFRTLPFLMVPNKTLSLEIQISSLKKLKLIFYILF
IDPDKNKYSFKLPKSTTTISSDNQWFDGSSRTFIWYHGFDIQMPYRIGLW
QVILYMNEFRKPSIKTFFYIHSQNQSFFDNASDRLNQWKLKSFCIYPNSQ
CNENSVYFCNVSCTLDSLFDVNLTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005575cellular_component
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0008375acetylglucosaminyltransferase activity
GO:0030158protein xylosyltransferase activity
GO:0003674molecular_function
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
IPR024448XylT
Vocabulary: biological process
TermDefinition
GO:0006024glycosaminoglycan biosynthetic process
GO:0015012heparan sulfate proteoglycan biosynthetic process
GO:0030166proteoglycan biosynthetic process
GO:0030206chondroitin sulfate biosynthetic process
GO:0048681negative regulation of axon regeneration
GO:0070555response to interleukin-1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024448XylosyltransferasePFAMPF12529Xylo_Ccoord: 311..455
e-value: 2.6E-6
score: 27.2
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 5..247
e-value: 7.3E-37
score: 127.2
NoneNo IPR availablePANTHERPTHR46025FAMILY NOT NAMEDcoord: 1..534