enolase 4

Overview
Nameenolase 4
Smed IDSMED30011473
Length (bp)2002
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of enolase 4 (SMED30011473) t-SNE clustered cells

Violin plots show distribution of expression levels for enolase 4 (SMED30011473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of enolase 4 (SMED30011473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for enolase 4 (SMED30011473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011473SMESG000008275.1 SmedASXL_016680SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011473SMESG000008275.1 dd_Smed_v6_12607_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011473SMESG000008275.1 dd_Smed_v4_12607_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of enolase 4 vs. Ensembl Human
Match: ENO4 (enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670])

HSP 1 Score: 77.7962 bits (190), Expect = 1.589e-14
Identity = 51/187 (27.27%), Postives = 96/187 (51.34%), Query Frame = 1
Query: 1114 VLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWII-GKSPQVFPRVQKISETPLYMQNFAL-KVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIW--LEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIF 1662
             ++ + + + D+NKGKYEVI G  K++ E V L  ++++ YPSI+ LI+P RK+D + W ++  A+  RC+II G + +   ++       L   N ++ K + + I     +  SD +  +  LID  + + ++   E     + + DLA GL    + L  L   S   ++ ++  L++  E + 
Sbjct:  218 AINCAGHELMDYNKGKYEVIMGTYKNAAEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTASKSISKL-------LEQGNISIPKSNGLIIKHTNQTTMSDLVE-ITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLGVRFIKLGGL---SRGERVTKYNRLLTIEEELV 393          
BLAST of enolase 4 vs. Ensembl Human
Match: ENO4 (enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670])

HSP 1 Score: 78.1814 bits (191), Expect = 2.018e-14
Identity = 97/374 (25.94%), Postives = 175/374 (46.79%), Query Frame = 1
Query:  631 GKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLL-----SNGKGLPGKCQMIKKCLIIPNGLYSSPN--EVVADLKKIYIKVWSTV-------------------QSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANG--IFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFAL-KVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIW--LEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENI 1659
            G+   I    + P EP E +     +  ++S+A+    ++L  + LY   LN ++L ++  E+ T  ++PLL     S GK   GK  ++K+ + IP+   ++    E++ +++K   K+                       Q +    + +  C L    D  EQ L +I +I   L LE    + L I+  G  + D+NKGKYEVI G  K++ E V L  ++++ YPSI+ LI+P RK+D + W ++  A+  RC+II  +       + IS+  L   N ++ K + + I     +  SD +  +  LID  + + ++   E     + + DLA GL    + L  L   S   ++ ++  L++  E +
Sbjct:  213 GRKDTITEKPIAPAEPVEPVLSGSMAIGAVSLAVAKACAMLLNKPLY---LN-IALLKHNQEQPTTLSMPLLMVSLVSCGKSSSGKLNLMKEVICIPHPELTTKQGVEMLMEMQKHINKIIEMAPPSPPKAETKKGHDGSKRGQQQITGKMSHLGC-LTINCDSIEQPLLLIQEICANLGLELGTNLHLAINCAGHELMDYNKGKYEVIMGTYKNAAEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTAS-----KSISKL-LEQGNISIPKSNGLIIKHTNQTTMSDLVE-ITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLGVRFIKLGGL---SRGERVTKYNRLLTIEEEL 571          
BLAST of enolase 4 vs. Ensembl Human
Match: ENO4 (enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670])

HSP 1 Score: 77.7962 bits (190), Expect = 2.629e-14
Identity = 52/185 (28.11%), Postives = 96/185 (51.89%), Query Frame = 1
Query: 1114 VLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFAL-KVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIW--LEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENI 1659
             ++ + + + D+NKGKYEVI G  K++ E V L  ++++ YPSI+ LI+P RK+D + W ++  A+  RC+II  +       + IS+  L   N ++ K + + I     +  SD +  +  LID  + + ++   E     + + DLA GL    + L  L   S   ++ ++  L++  E +
Sbjct:  394 AINCAGHELMDYNKGKYEVIMGTYKNAAEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTAS-----KSISKL-LEQGNISIPKSNGLIIKHTNQTTMSDLVE-ITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLGVRFIKLGGL---SRGERVTKYNRLLTIEEEL 568          
BLAST of enolase 4 vs. Ensembl Zebrafish
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:558487])

HSP 1 Score: 97.4413 bits (241), Expect = 5.143e-25
Identity = 122/513 (23.78%), Postives = 232/513 (45.22%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFN-----LKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSG-----------KNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVA---DLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQ-VFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDY-INCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGL 1668
            ++ YF  LS  P +SKI   E     G + +  ++  + RNEE       M   F+     ++SGE L+  N  +        ++ I +  S  + G +P D   +++IL + A+ R +++ + + +E E E+  + + +   ++  TS            K   I    + P EP     P   +  ++S+A+   ++ L    LY++          K  ++ +P I ++S GK   GK  ++++ +++P+       EV+    DL+    ++ +    K     ++D   L   FDRPEQ LD++ +    L L     + L +  +A+ + D+++GKYEV++G  KS DE V + + +++ YP+I  LI+P RK+D+  W+ L   +   C ++  +   +  R ++    P       ++             +SD  I+ + Q I  +++    L    G   V DLA G     L L  LR   G+ ++D++  LM+  E   G+
Sbjct:   58 LANYFSGLSYTPVISKITGKEVFDGRGLTAVQAEVHCIIRNEEKMVCGAVMDGSFDGLPDGVESGEMLS--NGDLQHLSITMALKWIRENFSPVLRGFNPTDQTNVDKILSDFAMARYLEHKDSLIREKEEELRNEAMSEAPPQATPTSAPAKDKKGNDKGKKGNITENPLPPAEPPVPRLPGATAVGAVSLAVAKTAAELLGTPLYRHITAVRDPQAQKEMQLPVPIITIMSCGKNSAGKLNLLEEIILMPSSSLRV-REVIGMGLDLQCEMRRILNGSTYKALPVGVSDEGALQVGFDRPEQALDLLAEACANLALPLGSDLHLAVNCAAHSLMDYSRGKYEVMSGCHKSPDELVDIYEGLINKYPAIRSLIDPFRKEDVGQWERLASVIGQSCCLLADAASNLCSRWREAKPLPPGATKAIIRH------------HSDMTISDLIQSIAEHKETI--LAAGSGDASVVDLAVGSGVSFLKLGGLR---GAERMDKYNRLMAIEEEQEGI 550          

HSP 2 Score: 37.7354 bits (86), Expect = 5.143e-25
Identity = 15/34 (44.12%), Postives = 22/34 (64.71%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK KA  Y++ N +P+ IE  LN++F + P D Y
Sbjct:   22 LKNKAAEYYRSNGVPQKIESVLNEMFWQKPDDIY 55          
BLAST of enolase 4 vs. Ensembl Xenopus
Match: gpx3 (glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GENE-5884491])

HSP 1 Score: 97.8265 bits (242), Expect = 1.025e-20
Identity = 110/402 (27.36%), Postives = 186/402 (46.27%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRN-CIEIINQTLSKKIIGIDPRDYEEIERILRN------------DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY--TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIP-NGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDR---CELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKS 1341
            ++ YF   SKPP + +I   +     G  T+  ++F   +N +       +    +  S             NH+ +  I+ +N  LS K+ G+ P +  +I+++L +              +ER+   +    +           KK   K K  +   K IP     P+E  E + P   +  +LS+A+   SS+L K  LY +   L    LP      +  P I +LS G   PGK  ++K+ LIIP  GL    +  +A + +  I       SK   ++ N     C LI   DR EQ LD+I +  + + LE    + L I  +A+ + D+NKGKYEV++G  KS DE + L  ++++  P+I+ L++PLRK+D   W++L KA+  +C++   +
Sbjct:   54 LANYFAQFSKPPTICQIRGRKVLDGTGEPTVEAEVFCTVKNMDKRICSSVI----SAASEHPKASKGPEQESNHSADIAIQWLND-LSPKLRGMSPDEQNKIDQLLSDFYQPKIEEEKERRQMEREASPMPLQPEPSPVTSPAPGKKKGSGKGKKAAVVEKPIP-----PEETPEAVVPGSPAIGALSLAVAKASSVLSKTPLYLHIRALRNEKLPTEFF--MPTPMISILSCGTSSPGKLNLMKEVLIIPQTGLTVQQSLDMALMLQNQIVKQINAASKTGPAIKNVSPLGCMLI-GGDRIEQPLDLICEACQHVGLELGTNLYLAINCAAHELMDYNKGKYEVLSGTFKSPDEMIDLYVDLINRQPAILALLDPLRKEDTVQWESLAKALGSKCYLFADA 442          
BLAST of enolase 4 vs. Ensembl Xenopus
Match: gpx3 (glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GENE-5884491])

HSP 1 Score: 97.4413 bits (241), Expect = 1.329e-20
Identity = 110/402 (27.36%), Postives = 186/402 (46.27%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRN-CIEIINQTLSKKIIGIDPRDYEEIERILRN------------DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY--TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIP-NGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDR---CELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKS 1341
            ++ YF   SKPP + +I   +     G  T+  ++F   +N +       +    +  S             NH+ +  I+ +N  LS K+ G+ P +  +I+++L +              +ER+   +    +           KK   K K  +   K IP     P+E  E + P   +  +LS+A+   SS+L K  LY +   L    LP      +  P I +LS G   PGK  ++K+ LIIP  GL    +  +A + +  I       SK   ++ N     C LI   DR EQ LD+I +  + + LE    + L I  +A+ + D+NKGKYEV++G  KS DE + L  ++++  P+I+ L++PLRK+D   W++L KA+  +C++   +
Sbjct:   54 LANYFAQFSKPPTICQIRGRKVLDGTGEPTVEAEVFCTVKNMDKRICSSVI----SAASEHPKASKGPEQESNHSADIAIQWLND-LSPKLRGMSPDEQNKIDQLLSDFYQPKIEEEKERRQMEREASPMPLQPEPSPVTSPAPGKKKGSGKGKKAAVVEKPIP-----PEETPEAVVPGSPAIGALSLAVAKASSVLSKTPLYLHIRALRNEKLPTEFF--MPTPMISILSCGTSSPGKLNLMKEVLIIPQTGLTVQQSLDMALMLQNQIVKQINAASKTGPAIKNVSPLGCMLI-GGDRIEQPLDLICEACQHVGLELGTNLYLAINCAAHELMDYNKGKYEVLSGTFKSPDEMIDLYVDLINRQPAILALLDPLRKEDTVQWESLAKALGSKCYLFADA 442          
BLAST of enolase 4 vs. Ensembl Xenopus
Match: gpx3 (glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GENE-5884491])

HSP 1 Score: 67.781 bits (164), Expect = 3.004e-11
Identity = 26/64 (40.62%), Postives = 45/64 (70.31%), Query Frame = 1
Query: 1150 NKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKS 1341
            NKGKYEV++G  KS DE + L  ++++  P+I+ L++PLRK+D   W++L KA+  +C++   +
Sbjct:  324 NKGKYEVLSGTFKSPDEMIDLYVDLINRQPAILALLDPLRKEDTVQWESLAKALGSKCYLFADA 387          
BLAST of enolase 4 vs. Ensembl Mouse
Match: Eno4 (enolase 4 [Source:MGI Symbol;Acc:MGI:2441717])

HSP 1 Score: 91.6633 bits (226), Expect = 5.997e-23
Identity = 111/418 (26.56%), Postives = 193/418 (46.17%), Query Frame = 1
Query:  196 LMSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSG---EALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN-----DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPA-----LLVIPDEPSEMICPELHSHFSL---SIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAI--PLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV------------QSKFPASLINDRCE----LIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANG--IFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIG 1335
            L + YF  L+KPP + KI+       LG  TL +++    +N       V +P  F +      EAL  +++          ++ INQ++++++ G+ P +  E++  LR         +++ K +E+ ++E         +            K K   A     LL  P  P E   P LH   ++   S+A+   S+ L    LY  TL  L   + +    ++P +   +LS GK  PGK  ++K+ + IP+ GL +  + E++ +++K   +   T+             SK     I  +      L   +D  EQ L ++  I   L LE  +   L I+  G  + D++KGKYEV+ G  KS+ E V L  ++++ YPSI+ LI+P RK+D + W +L  A++ RC++I 
Sbjct:   55 LKANYFSKLAKPPSICKIVGKTILDGLGLPTLQVEISCTIQNFPKYICAVAIPTHFEVVENALPEALDAEDSE-RAQAVNTAVQWINQSITEELWGLVPSNQAEVDHRLRTFFEHKVQEDKERKELEKSQEELVPAPPPVTLPPPPPPPPPPPSKKKGQKAGRRDTLLEKPVSPPEPPEPVLHGSMAIGAVSLAVAKASATLASDPLY-LTLASLKHDQEQPSTFSMPLLMGSVLSCGKSSPGKLHLMKEVICIPSPGLTAKQSVELLLEIQKQVNRAMETLPPPKQETKKGHNGSKRAQPPITGKVSHLGCLTINYDAIEQPLLLLQGICSNLGLELGVNFHLAINCAGHELMDYSKGKYEVMVGTHKSAAEMVELYVDLINKYPSIIALIDPFRKEDAEQWDSLYAALASRCYLIA 470          

HSP 2 Score: 36.5798 bits (83), Expect = 5.997e-23
Identity = 14/34 (41.18%), Postives = 24/34 (70.59%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK++A+ Y+++N++P+ +E  LN  F   PAD Y
Sbjct:   19 LKQQAMAYYQENDVPRKLEDLLNSTFYLQPADVY 52          
BLAST of enolase 4 vs. Ensembl Mouse
Match: Eno4 (enolase 4 [Source:MGI Symbol;Acc:MGI:2441717])

HSP 1 Score: 91.6633 bits (226), Expect = 6.896e-23
Identity = 110/417 (26.38%), Postives = 193/417 (46.28%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSG---EALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN-----DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPA-----LLVIPDEPSEMICPELHSHFSL---SIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAI--PLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV------------QSKFPASLINDRCE----LIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANG--IFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIG 1335
            ++ YF  L+KPP + KI+       LG  TL +++    +N       V +P  F +      EAL  +++          ++ INQ++++++ G+ P +  E++  LR         +++ K +E+ ++E         +            K K   A     LL  P  P E   P LH   ++   S+A+   S+ L    LY  TL  L   + +    ++P +   +LS GK  PGK  ++K+ + IP+ GL +  + E++ +++K   +   T+             SK     I  +      L   +D  EQ L ++  I   L LE  +   L I+  G  + D++KGKYEV+ G  KS+ E V L  ++++ YPSI+ LI+P RK+D + W +L  A++ RC++I 
Sbjct:   55 LANYFSKLAKPPSICKIVGKTILDGLGLPTLQVEISCTIQNFPKYICAVAIPTHFEVVENALPEALDAEDSE-RAQAVNTAVQWINQSITEELWGLVPSNQAEVDHRLRTFFEHKVQEDKERKELEKSQEELVPAPPPVTLPPPPPPPPPPPSKKKGQKAGRRDTLLEKPVSPPEPPEPVLHGSMAIGAVSLAVAKASATLASDPLY-LTLASLKHDQEQPSTFSMPLLMGSVLSCGKSSPGKLHLMKEVICIPSPGLTAKQSVELLLEIQKQVNRAMETLPPPKQETKKGHNGSKRAQPPITGKVSHLGCLTINYDAIEQPLLLLQGICSNLGLELGVNFHLAINCAGHELMDYSKGKYEVMVGTHKSAAEMVELYVDLINKYPSIIALIDPFRKEDAEQWDSLYAALASRCYLIA 469          

HSP 2 Score: 36.5798 bits (83), Expect = 6.896e-23
Identity = 14/34 (41.18%), Postives = 24/34 (70.59%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK++A+ Y+++N++P+ +E  LN  F   PAD Y
Sbjct:   19 LKQQAMAYYQENDVPRKLEDLLNSTFYLQPADVY 52          
BLAST of enolase 4 vs. Ensembl Mouse
Match: Eno4 (enolase 4 [Source:MGI Symbol;Acc:MGI:2441717])

HSP 1 Score: 77.411 bits (189), Expect = 1.594e-14
Identity = 90/341 (26.39%), Postives = 163/341 (47.80%), Query Frame = 1
Query:  715 SLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAI--PLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV------------QSKFPASLINDRCE----LIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANG--IFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFA-LKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIW--LEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIF 1662
            ++S+A+   S+ L    LY  TL  L   + +    ++P +   +LS GK  PGK  ++K+ + IP+ GL +  + E++ +++K   +   T+             SK     I  +      L   +D  EQ L ++  I   L LE  +   L I+  G  + D++KGKYEV+ G  KS+ E V L  ++++ YPSI+ LI+P RK+D + W +L  A++ RC++I  +      V K+ E     +N + LK   + I     +  SD +  +  LI+G + + ++   +     + + DLA G     + L  L   S   ++ ++  L++  E + 
Sbjct:   67 AVSLAVAKASATLASDPLY-LTLASLKHDQEQPSTFSMPLLMGSVLSCGKSSPGKLHLMKEVICIPSPGLTAKQSVELLLEIQKQVNRAMETLPPPKQETKKGHNGSKRAQPPITGKVSHLGCLTINYDAIEQPLLLLQGICSNLGLELGVNFHLAINCAGHELMDYSKGKYEVMVGTHKSAAEMVELYVDLINKYPSIIALIDPFRKEDAEQWDSLYAALASRCYLIAGAAS--GSVSKLLEC----RNISTLKSHGLIIKHTNQTTMSDLVE-ITHLINGKKLLAVFGSTDSESSDDSLVDLAVGFGARFIKLGGL---SRGERMTKYNRLLAIEEELI 396          
BLAST of enolase 4 vs. Ensembl Mouse
Match: Eno4 (enolase 4 [Source:MGI Symbol;Acc:MGI:2441717])

HSP 1 Score: 55.0694 bits (131), Expect = 3.238e-8
Identity = 22/54 (40.74%), Postives = 38/54 (70.37%), Query Frame = 1
Query: 1114 VLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQ 1275
             ++ + + + D++KGKYEV+ G  KS+ E V L  ++++ YPSI+ LI+P RK+
Sbjct:  114 AINCAGHELMDYSKGKYEVMVGTHKSAAEMVELYVDLINKYPSIIALIDPFRKE 167          
BLAST of enolase 4 vs. UniProt/SwissProt
Match: sp|Q08BC6|ENO4_DANRE (Enolase 4 OS=Danio rerio OX=7955 GN=eno4 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.552e-25
Identity = 123/512 (24.02%), Postives = 229/512 (44.73%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFN-----LKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSG-----------KNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVA---DLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQ-VFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGL 1668
            ++ YF  LS  P +SKI   E     G + +  ++  + RNEE       M   F+     ++SGE L+  N  +        ++ I +  S  + G +P D   +++IL + A+ R +++ + + +E E E+  + + +   ++  TS            K   I    + P EP     P   +  ++S+A+   ++ L    LY++          K  ++ +P I ++S GK   GK  ++++ +++P+       EV+    DL+    ++ +    K     ++D   L   FDRPEQ LD++ +    L L     + L +  +A+ + D+++GKYEV++G  KS DE V + + +++ YP+I  LI+P RK+D+  W+ L   +   C ++  +   + PR ++    P          +   I        SD I  + +      K  I L    G   + DLA G     L L  LR   G+ ++D++  LM+  E   G+
Sbjct:   58 LANYFSGLSYTPVISKITGKEVFDGRGLTAVQAEVHCIIRNEEKMVCGAVMDGSFDGLPDGVESGEMLS--NGDLQHLSITMALKWIRENFSPVLRGFNPTDQTNVDKILSDFAMARYLEHKDSLIREKEEELRNEAMSEAPPQATPTSAPAKDKKGNDKGKKGNITENPLPPAEPPVPRLPGATAVGAVSLAVAKTAAELLGTPLYRHITAVRDPQAQKEMQLPVPIITIMSCGKNSAGKLNLLEEIILMPSSSLRV-REVIGMGLDLQCEMRRILNGSTYKALPVGVSDEGALQVGFDRPEQALDLLAEACANLALPLGSDLHLAVNCAAHSLMDYSRGKYEVMSGCHKSPDELVDIYEGLINKYPAIRSLIDPFRKEDVGQWERLASVIGQSCCLLADAASNLCPRWREAKPLP-------PGATKAIIRHHSDMTISDLIQSIAE-----HKETI-LAAGSGDASMVDLAVGSGVSFLKLGGLR---GAKRMDKYNRLMAIEEEQEGI 550          

HSP 2 Score: 37.7354 bits (86), Expect = 8.552e-25
Identity = 15/34 (44.12%), Postives = 22/34 (64.71%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK KA  Y++ N +P+ IE  LN++F + P D Y
Sbjct:   22 LKNKAAEYYRSNGVPQKIESVLNEMFWQKPDDIY 55          
BLAST of enolase 4 vs. UniProt/SwissProt
Match: sp|Q8C042|ENO4_MOUSE (Enolase 4 OS=Mus musculus OX=10090 GN=Eno4 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 3.638e-22
Identity = 111/418 (26.56%), Postives = 193/418 (46.17%), Query Frame = 1
Query:  196 LMSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSG---EALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN-----DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPA-----LLVIPDEPSEMICPELHSHFSL---SIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAI--PLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV------------QSKFPASLINDRCE----LIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANG--IFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIG 1335
            L + YF  L+KPP + KI+       LG  TL +++    +N       V +P  F +      EAL  +++          ++ INQ++++++ G+ P +  E++  LR         +++ K +E+ ++E         +            K K   A     LL  P  P E   P LH   ++   S+A+   S+ L    LY  TL  L   + +    ++P +   +LS GK  PGK  ++K+ + IP+ GL +  + E++ +++K   +   T+             SK     I  +      L   +D  EQ L ++  I   L LE  +   L I+  G  + D++KGKYEV+ G  KS+ E V L  ++++ YPSI+ LI+P RK+D + W +L  A++ RC++I 
Sbjct:   55 LKANYFSKLAKPPSICKIVGKTILDGLGLPTLQVEISCTIQNFPKYICAVAIPTHFEVVENALPEALDAEDSE-RAQAVNTAVQWINQSITEELWGLVPSNQAEVDHRLRTFFEHKVQEDKERKELEKSQEELVPAPPPVTLPPPPPPPPPPPSKKKGQKAGRRDTLLEKPVSPPEPPEPVLHGSMAIGAVSLAVAKASATLASDPLY-LTLASLKHDQEQPSTFSMPLLMGSVLSCGKSSPGKLHLMKEVICIPSPGLTAKQSVELLLEIQKQVNRAMETLPPPKQETKKGHNGSKRAQPPITGKVSHLGCLTINYDAIEQPLLLLQGICSNLGLELGVNFHLAINCAGHELMDYSKGKYEVMVGTHKSAAEMVELYVDLINKYPSIIALIDPFRKEDAEQWDSLYAALASRCYLIA 470          

HSP 2 Score: 36.5798 bits (83), Expect = 3.638e-22
Identity = 14/34 (41.18%), Postives = 24/34 (70.59%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK++A+ Y+++N++P+ +E  LN  F   PAD Y
Sbjct:   19 LKQQAMAYYQENDVPRKLEDLLNSTFYLQPADVY 52          
BLAST of enolase 4 vs. UniProt/SwissProt
Match: sp|B0BM20|ENO4_XENTR (Enolase 4 OS=Xenopus tropicalis OX=8364 GN=eno4 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.430e-20
Identity = 110/402 (27.36%), Postives = 186/402 (46.27%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRN-CIEIINQTLSKKIIGIDPRDYEEIERILRN------------DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY--TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIP-NGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDR---CELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKS 1341
            ++ YF   SKPP + +I   +     G  T+  ++F   +N +       +    +  S             NH+ +  I+ +N  LS K+ G+ P +  +I+++L +              +ER+   +    +           KK   K K  +   K IP     P+E  E + P   +  +LS+A+   SS+L K  LY +   L    LP      +  P I +LS G   PGK  ++K+ LIIP  GL    +  +A + +  I       SK   ++ N     C LI   DR EQ LD+I +  + + LE    + L I  +A+ + D+NKGKYEV++G  KS DE + L  ++++  P+I+ L++PLRK+D   W++L KA+  +C++   +
Sbjct:   54 LANYFAQFSKPPTICQIRGRKVLDGTGEPTVEAEVFCTVKNMDKRICSSVI----SAASEHPKASKGPEQESNHSADIAIQWLND-LSPKLRGMSPDEQNKIDQLLSDFYQPKIEEEKERRQMEREASPMPLQPEPSPVTSPAPGKKKGSGKGKKAAVVEKPIP-----PEETPEAVVPGSPAIGALSLAVAKASSVLSKTPLYLHIRALRNEKLPTEFF--MPTPMISILSCGTSSPGKLNLMKEVLIIPQTGLTVQQSLDMALMLQNQIVKQINAASKTGPAIKNVSPLGCMLI-GGDRIEQPLDLICEACQHVGLELGTNLYLAINCAAHELMDYNKGKYEVLSGTFKSPDEMIDLYVDLINRQPAILALLDPLRKEDTVQWESLAKALGSKCYLFADA 442          
BLAST of enolase 4 vs. UniProt/SwissProt
Match: sp|A9UMP7|ENO4_XENLA (Enolase 4 OS=Xenopus laevis OX=8355 GN=eno4 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.436e-18
Identity = 106/402 (26.37%), Postives = 183/402 (45.52%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQ-VTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN--------DAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGK----NKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY--TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIP-NGLYSSPN-EVVADLKKIYIKVWSTVQSKFPA--SLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKS 1341
            ++ YF   S PP + +I   +     G  T+ +++    +N +      V      + K+ E L  +      NH+ +      + LS  + G+ P +   I+++L +        +   RQM+        +              K      K     K IP     P E  E + P   +  +LS+A+   SS+L K  LY +  TL    LP      +  P I +LS GK  PGK  ++K+ L+IP  GL    + ++   L+   +K  +++    PA  ++    C LI   DR EQ LD+I +  + + LE    + L I  +A+ + D+NK KYE ++G  KS DE V L  ++++  P+I+ L++PLRK+D   W++L KA+  +C++   +
Sbjct:   55 LANYFAQFSMPPTICQIRGRKVLDGSGEPTVEVEVSCTVKNSDKRICSSVISAVSEHPKASEGLEQER-----NHSADTAIQWLKDLSPLLKGMSPNEQHNIDQLLSDFYQPKIEEEKARRQMEREASPMAIEPVPSPVTSPALGKKKGSGKGKKAVVMEKPIP-----PKEAPEPVVPGSPAIGALSLAVAKASSVLGKTPLYLHIATLRNEKLPSEFI--MPTPMISVLSCGKSSPGKLNLMKEVLVIPPTGLTVQQSLDMALMLQNQIVKQINSISKTGPAIKNVTPLGCMLI-GGDRIEQPLDLICEACQHVGLELGRNLYLAINCAAHELMDYNKAKYEALSGTFKSPDEMVDLYVDLINRQPAILALLDPLRKEDAAQWESLTKALGSKCFLFADA 443          
BLAST of enolase 4 vs. UniProt/SwissProt
Match: sp|A6NNW6|ENO4_HUMAN (Enolase 4 OS=Homo sapiens OX=9606 GN=ENO4 PE=2 SV=4)

HSP 1 Score: 77.7962 bits (190), Expect = 1.263e-13
Identity = 52/185 (28.11%), Postives = 96/185 (51.89%), Query Frame = 1
Query: 1114 VLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFAL-KVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIW--LEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENI 1659
             ++ + + + D+NKGKYEVI G  K++ E V L  ++++ YPSI+ LI+P RK+D + W ++  A+  RC+II  +       + IS+  L   N ++ K + + I     +  SD +  +  LID  + + ++   E     + + DLA GL    + L  L   S   ++ ++  L++  E +
Sbjct:  394 AINCAGHELMDYNKGKYEVIMGTYKNAAEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTAS-----KSISKL-LEQGNISIPKSNGLIIKHTNQTTMSDLVE-ITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLGVRFIKLGGL---SRGERVTKYNRLLTIEEEL 568          
BLAST of enolase 4 vs. TrEMBL
Match: W4XB85 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.623e-36
Identity = 114/409 (27.87%), Postives = 214/409 (52.32%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTM------PNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERI-------LRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPNEVVADLKKIYIKVWSTVQSKF--PASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXX--XXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKI 1371
            +S+YFE+ +KPP + K+   E     G  T+   +  + +  E  F   T       P++  L+               +T   + +IN  L++ + G+DP D +E + +       L+ +A +++     +  +E+ ++  K+  K+E   S     K     +++V  +EP E + P   +  ++S A+ +  + ++K  LY++  N     E     + +P + +L +GK  PGK  +IK+ LI+P  GL     E +  + ++Y ++   + +K   P   +ND     P +DR EQFLD++ + +  LEL   E + I L+ +A+ I++  KGKYEV+TG LK+S++ +    ++++ YP+I+ LI+PLRKQD + W  L + +S++C+IIG+   V+PRV++ 
Sbjct:   53 LSEYFESKAKPPVIHKVSGREVYDSKGQPTVQADISCIIKGLEKHFSTATASSYNHYPDNIPLEK----REAEEKERQQNTGAAVSLINGQLTEALCGVDPTDQKEADDVVLTLIDKLKAEADQKEEDERLKRIEEELNQEPKEPAKEEKTISPKGKKKAGSARSVIVALEEPKEPLYPACSAACAVSQAVAMAGAAVKKVELYEHICNAAGNVEVDVFTMPMPMVSVLCSGKPAPGKQNLIKELLILPKPGL--PLEEGMKQVTRVYHQIGKLLFTKLGVPGYYVNDNGTFTPQYDRQEQFLDLVQEAVTALELTPGEDIYIALNCAAHEIYEPEKGKYEVMTGMLKTSEDMIEFYADIINRYPAIIALIDPLRKQDSEVWSKLCERLSEKCYIIGE--HVYPRVERF 453          

HSP 2 Score: 40.4318 bits (93), Expect = 5.623e-36
Identity = 18/50 (36.00%), Postives = 31/50 (62.00%), Query Frame = 3
Query:   66 MNNEMCSERMV-----LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            M     SER       +K++A++++K+N +P+ IE+ LN++F E P D Y
Sbjct:    1 MAASRASERSAREFYEMKQRAVHFYKENQVPEKIEEVLNNMFHESPVDVY 50          
BLAST of enolase 4 vs. TrEMBL
Match: A0A5C2IF66 (Enolase-1 protein OS=Anadara broughtonii OX=148819 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.067e-31
Identity = 126/487 (25.87%), Postives = 241/487 (49.49%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDN----AMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERI-------LRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXX------------XTSGKNK-KIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAE-RVTIPAIPLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPNEVVADLKKIYIKVWST--VQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXX--XXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLID-GNQKVCIWLEDLCGQNWVTDLACGLN 1566
            ++ +FE  +K P +SKI A ++    G  T+  +++   +N+E + +  ++ +  N    E    ++     +      +  I ++N  L+ ++ G+DP    + + I       L+    ERQ     E    D  E +  + +   V S                GK K K    +VIP+EP E +    ++  +LS A+ + ++ ++  +LY++ ++ L   E K E ++ +P + +L +G+  PGK   +K+ +++P  G+    ++ +  + +IY  V ++   +S   A L+ND   L P FDRPEQ LD++ + +  L L   +   I L+ ++N IFD+ KGKYE+++GQ K  ++      E++  YPS++ LI+PLR+QD + W  L + +SD  ++IG      P +    E     ++F  K S + + ++  +  +D + C +++ + GN  V        G  +++DLA GLN
Sbjct:   53 LANFFEKFAKVPTVSKIQARQAYDSKGEPTIQTEIYCTVKNKE-KLISTSISSTQNSHIPEHARVEDKEPDEIERHESVKTAIRVLNTDLNNRLQGVDPTQQSQADSIITKLYDELKAADEERQAIEAAERAAADGDESSPSKDETASVTSGGGKKGKGSAKSPAQGGKKKGKSVTAVVIPEEPREKMLTGANAVCTLSQAISLTAAYIQDIDLYEH-ISSLKYGEVKNEFQIPLPMVTILQSGRPAPGKLNCVKEFMVVPKPGM--PLDQSLQYIHQIYKYVANSFYTKSGVTAKLVNDLGALCPTFDRPEQGLDLLQEAITHLGLSPGDDFHIALNCASNEIFDYEKGKYEIMSGQPKVPEDVTEFWAELLSRYPSVIALIDPLRQQDQEHWMRLCEGISDNTYVIGGHAYSRPGILNNEE---LTEDF--KSSGIVLKMEQLNTVTDTVQCTKKMEEAGNVIVVAACNGESGSTFLSDLAVGLN 530          
BLAST of enolase 4 vs. TrEMBL
Match: A0A3P9A2L0 (Enolase 4 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.349e-31
Identity = 111/408 (27.21%), Postives = 201/408 (49.26%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEE-IEFLQVTMPNDFNLKSGEALT-FDNAMINLNHTRNCIEI----INQTLSKKIIGIDPRDYEEIERILRNDAVE-RQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY-TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV--VADLKKIYIKVWSTVQSKFPA-SLINDRCELIPAFDRPEQ--FXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETP 1383
            ++ YF  LS PP +S+++  E     G  +L  ++  + +NEE + FL ++     +  S ++    D   I+ +  R+ + +    I+++LS  + G DP +   +++IL     E R +++                  K         G + + P   V   EPSE + P   +  S+S+A+    ++L+   LYKY T+ +   P  K  R+ +P + LLS GK  PGK  ++++ ++IP         +  V +L+K   K+ ++     P  + ++D   L+  F+RPEQ   L         L L E++ + L+ +A+ + D+ KGKY+VITG  K+ DE V + + ++  YP++V LI+PLRK+D++ W+ L  AV   C ++    +  P+V    E P
Sbjct:   59 LANYFSKLSTPPVISRVLGREIYDGKGELSLQAEVLCIIKNEEKVRFLSLSALVMISSHSEDSTDPSDGNNISNDKRRDSVNVALHWIHESLSTILKGSDPCNQTAVDQILWWWLWEARPLRWSILENVLPLKLCTTFGPIKFVSGFSGKKGNSTEKP---VPRPEPSEPVLPGSMAIGSVSLAVAKTGAVLQDVPLYKYITVLRNQQPYPKEIRIPVPLVTLLSCGKLSPGKLNLLEEVIVIPKAGQRLKQVITMVLELQKEMTKIINSASKTGPMLTTVSDSGALVVGFERPEQPLDLISEASNTLGLGLGEEIHLALNCAAHNLMDYPKGKYDVITGIPKTPDELVDMYEALISKYPAVVALIDPLRKEDVEQWERLSNAVGASCSLLSDVSK--PQVHGSHEDP 461          

HSP 2 Score: 41.5874 bits (96), Expect = 2.349e-31
Identity = 22/53 (41.51%), Postives = 29/53 (54.72%), Query Frame = 3
Query:   51 KDLFKMNNEMCSERM---VLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            K L   N+ +  E     VLK KA  YF+ N +P+ IE  LND+F + P D Y
Sbjct:    4 KGLISCNSRVSKEDQEFYVLKNKAAEYFRSNGVPQKIECILNDMFFDQPDDIY 56          
BLAST of enolase 4 vs. TrEMBL
Match: A0A1S3KE19 (enolase 4 OS=Lingula unguis OX=7574 GN=LOC106181008 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.031e-31
Identity = 140/516 (27.13%), Postives = 244/516 (47.29%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPN-----------DFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRD--------YEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTS------GKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY--TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPASL------INDRCELIPAFDRPEQFXXXXXXXXXXXXXX--XXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLID-GNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAEL 1638
            ++ YFE+ SK P ++K++A E+    G  T+  +++ + +N E      T+ +           D + +  E   F  A          +E +N +LS  + G+DP++        YE IER+   +  ER  K  E   +++E +      ++ + K K  S      GK K  PA+ VIPDEP E +    +   ++SI +   ++ L+K  LY++  +L    +P      V +P + +L +GK  PGK   +K+ +++P      P   V +  +    + + +     A        +ND   L P  DRPEQ LD++ D +  LEL   E   IVL+  A+  FD  KGKYEVI G  KS ++ V    E++  YPS++GLI+P+R+Q+   W  +   +S+RC+IIG++    P + K  E     + F    S V   ++  +  +D ++C +++ + GNQ +    +       + D+A GLN   + +          K++R  +L
Sbjct:   58 VANYFESFSKTPTITKLLAREAFDSKGQPTVQTEVYCVVKNFEQLLATATLSSQNWLPDSARQEDKDTEDAERQEFVTA---------AVEHVNGSLSAALKGVDPKNQKEVDQIIYEIIERMRLKEVEERVAKEQELAAQQEEEQAAALAAEEANSKGKAKSPPKSPKGKGK-APAVAVIPDEPKEEMYKGSNCLGAVSITVCQAAAQLKKVELYEHIASLRFEKMPSKFC--VPLPMVTILQSGKAFPGKLNCVKEFMLVPK-----PGMPVQEAMRHMTTISNNIAKGLMAKAGIIQKNVNDLGSLCPQIDRPEQGLDMLQDAITGLELTPGEDFHIVLNCGAHEWFDAEKGKYEVIGGLQKSYEDMVEFWAELLGRYPSVIGLIDPIRQQEKKQWMEICDRLSERCFIIGENVYSRPGLLKHDE---LTEEFV--SSGVVFRLEQMNQVTDILDCAKKMEEAGNQIILSSCQGETSDTQIVDMAVGLNARFIKVGGPSRGERIAKINRLLQL 551          
BLAST of enolase 4 vs. TrEMBL
Match: A0A3P9A2M5 (Enolase 4 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 6.273e-30
Identity = 112/419 (26.73%), Postives = 201/419 (47.97%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEI----INQTLSKKIIGIDPRDYEEIERIL--------------RNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKY-TLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV--VADLKKIYIKVWSTVQSKFPA-SLINDRCELIPAFDRPEQ--FXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETP 1383
            ++ YF  LS PP +S+++  E     G  +L  ++  + +NEE       + +     +  +   D   I+ +  R+ + +    I+++LS  + G DP +   +++IL              RN   E Q   +   E    +   KD+   +  K   ++ K    P       EPSE + P   +  S+S+A+    ++L+   LYKY T+ +   P  K  R+ +P + LLS GK  PGK  ++++ ++IP         +  V +L+K   K+ ++     P  + ++D   L+  F+RPEQ   L         L L E++ + L+ +A+ + D+ KGKY+VITG  K+ DE V + + ++  YP++V LI+PLRK+D++ W+ L  AV   C ++    +  P+V    E P
Sbjct:   59 LANYFSKLSTPPVISRVLGREIYDGKGELSLQAEVLCIIKNEEKTTGSAVISSHSEDSTDPS---DGNNISNDKRRDSVNVALHWIHESLSTILKGSDPCNQTAVDQILCDFFMARFLEYQDVRNRETENQPPGMPVPEPSPSAAHPKDKKGGDKGKKGNSTEKPVPRP-------EPSEPVLPGSMAIGSVSLAVAKTGAVLQDVPLYKYITVLRNQQPYPKEIRIPVPLVTLLSCGKLSPGKLNLLEEVIVIPKAGQRLKQVITMVLELQKEMTKIINSASKTGPMLTTVSDSGALVVGFERPEQPLDLISEASNTLGLGLGEEIHLALNCAAHNLMDYPKGKYDVITGIPKTPDELVDMYEALISKYPAVVALIDPLRKEDVEQWERLSNAVGASCSLLSDVSK--PQVHGSHEDP 465          

HSP 2 Score: 41.2022 bits (95), Expect = 6.273e-30
Identity = 22/53 (41.51%), Postives = 29/53 (54.72%), Query Frame = 3
Query:   51 KDLFKMNNEMCSERM---VLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            K L   N+ +  E     VLK KA  YF+ N +P+ IE  LND+F + P D Y
Sbjct:    4 KGLISCNSRVSKEDQEFYVLKNKAAEYFRSNGVPQKIECILNDMFFDQPDDIY 56          
BLAST of enolase 4 vs. Ensembl Cavefish
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:558487])

HSP 1 Score: 73.559 bits (179), Expect = 3.279e-13
Identity = 77/286 (26.92%), Postives = 139/286 (48.60%), Query Frame = 1
Query:  826 IPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVV------ADLKKIYIKVWSTVQSKFPASL-INDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFAL--KVSMVGINIDGYSIYSDYINCMRQL--IDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMS 1644
            IP + +LS GK   GK  ++++ +++P   YS+   VV       ++K+I     ++     PA L +++   L  + +R EQ LD++ +    L+L    ++ L I  +A+ + D+ KGKYEV+ G LKS DE V +   +V  YPSI  LINP RK+D + W  L   +   C ++  +          + +P +     L   V+ V +        +D ++ + Q    DG   + +  E++ G + + D+A G+    + L  L   SG  +++++  L S
Sbjct:  299 IPLLTVLSCGKASAGKLNLLEELILLPTRTYSTREIVVMGCELQREIKRISTSTTTSKTG--PAVLGVSEGGALQLSLERSEQALDLLMEACVNLKLPMGTELRLAINCAAHKLMDYAKGKYEVMAGTLKSPDELVDMYVGLVSKYPSIAALINPFRKEDEEQWLKLSSLIGHSCCLVADA----------AYSPCWRDAKPLPQGVTWVTLRHGSEMTLTDLLHTVSQRAGTDGETILAVSSEEI-GDDSMVDVAVGVGVTFIKLGGL---SGGSRMNKYNRLQS 568          

HSP 2 Score: 44.2838 bits (103), Expect = 3.388e-10
Identity = 27/109 (24.77%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQV--TMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN 519
            M+ YF  L+  P +S I   E     G + L + ++ M RNEE        T  ++   +SG+A+  DN           +E I + LS  + G +P    ++++++ +
Sbjct:   79 MANYFSRLAHTPVISSIAGREVYDSRGEAALQVDVYCMVRNEEKLVCSAVNTGLDEHRAESGDAVADDNH--QQASVATALEWIREQLSSMLCGFNPAHQTQLDKVVSD 185          

HSP 3 Score: 40.4318 bits (93), Expect = 3.388e-10
Identity = 16/34 (47.06%), Postives = 23/34 (67.65%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK +A  Y++ N +P T+E+ LN LF E P+D Y
Sbjct:   43 LKSRAAEYYRANRVPHTLEELLNQLFAEKPSDIY 76          
BLAST of enolase 4 vs. Ensembl Cavefish
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:558487])

HSP 1 Score: 73.559 bits (179), Expect = 3.839e-13
Identity = 77/286 (26.92%), Postives = 139/286 (48.60%), Query Frame = 1
Query:  826 IPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVV------ADLKKIYIKVWSTVQSKFPASL-INDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDI--SANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFAL--KVSMVGINIDGYSIYSDYINCMRQL--IDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMS 1644
            IP + +LS GK   GK  ++++ +++P   YS+   VV       ++K+I     ++     PA L +++   L  + +R EQ LD++ +    L+L    ++ L I  +A+ + D+ KGKYEV+ G LKS DE V +   +V  YPSI  LINP RK+D + W  L   +   C ++  +          + +P +     L   V+ V +        +D ++ + Q    DG   + +  E++ G + + D+A G+    + L  L   SG  +++++  L S
Sbjct:  299 IPLLTVLSCGKASAGKLNLLEELILLPTRTYSTREIVVMGCELQREIKRISTSTTTSKTG--PAVLGVSEGGALQLSLERSEQALDLLMEACVNLKLPMGTELRLAINCAAHKLMDYAKGKYEVMAGTLKSPDELVDMYVGLVSKYPSIAALINPFRKEDEEQWLKLSSLIGHSCCLVADA----------AYSPCWRDAKPLPQGVTWVTLRHGSEMTLTDLLHTVSQRAGTDGETILAVSSEEI-GDDSMVDVAVGVGVTFIKLGGL---SGGSRMNKYNRLQS 568          

HSP 2 Score: 43.8986 bits (102), Expect = 3.765e-10
Identity = 27/109 (24.77%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQV--TMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRN 519
            M+ YF  L+  P +S I   E     G + L + ++ M RNEE        T  ++   +SG+A+  DN           +E I + LS  + G +P    ++++++ +
Sbjct:   79 MANYFSRLAHTPVISSIAGREVYDSRGEAALQVDVYCMVRNEEKLVCSAVNTGLDEHRAESGDAVADDNH--QQASVATALEWIREQLSSMLCGFNPAHQTQLDKVVSD 185          

HSP 3 Score: 40.4318 bits (93), Expect = 3.765e-10
Identity = 16/34 (47.06%), Postives = 23/34 (67.65%), Query Frame = 3
Query:   99 LKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            LK +A  Y++ N +P T+E+ LN LF E P+D Y
Sbjct:   43 LKSRAAEYYRANRVPHTLEELLNQLFAEKPSDIY 76          
BLAST of enolase 4 vs. Ensembl Sea Lamprey
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:558487])

HSP 1 Score: 77.7962 bits (190), Expect = 2.313e-15
Identity = 82/347 (23.63%), Postives = 164/347 (47.26%), Query Frame = 1
Query:  628 SGKNKKIPALLVIPDEPSEMICPELHSHFSLS---IALGIMSSLLEKQNLYKY--TLNQLSLPE---NKAERVTIPA--IPLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV-QSKFPAS--LINDRCELIPA----------FDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQN---WVTDLACGLNPYLLVL 1584
            S K+ K  A L  P    EM  P L    ++S   +A+   ++ L+   LYK+  +L+   + E   N  +++ IP   + +L  GK  PGK  ++K+ +++P  GL +S    ++++++   +K    V ++ + A+  +  +   ++ A           +RP + ++ +   L      +     L+ +A+ + D+ KG+YEV +G  K++ + V L  +++  +P++V LI+PL  +D + W+ L  AV ++C+I  ++   F R+ ++    L      LK + V I        SD +   R L    + +C+      G      + D+A G+    L+L
Sbjct:   94 SRKHSKKSAALEKPLFHKEMRAPLLPGSVAISATSMAIAKAAARLKSCPLYKHIASLSHTEVSEDTFNVQQKLKIPVTMVTVLCCGKASPGKLNLLKEVMVLPRPGLTASQGLNIISEIQHQIMKHAEVVPKTGYDATNFVPYETMHVVGAVGAPLIGCDKLERPLEIIEEVARSLGLTAGVDFHL-ALNCAAHEVMDYEKGRYEVASGSFKATTDMVELYVQLLGQHPAVVALIDPLCPEDHEQWRRLSSAVGEKCFIFNEN---FCRLAELEN--LEHITGTLKATGVIIKHTNQVTVSDLLQASRYL--QGKGLCVAFGACSGDTPDGSLVDMALGMGASFLIL 432          
BLAST of enolase 4 vs. Ensembl Sea Lamprey
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:558487])

HSP 1 Score: 74.7146 bits (182), Expect = 1.929e-14
Identity = 67/308 (21.75%), Postives = 146/308 (47.40%), Query Frame = 1
Query:  715 SLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPN-GLYSSPN-EVVADLKKIYIKVWSTV-QSKFPAS--LINDRCELIPA----------FDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQN---WVTDLACGLNPYLLVL 1584
            + S+A+   ++ L+   LYK+  +       +  ++ +  + +L  GK  PGK  ++K+ +++P  GL +S    ++++++   +K    V ++ + A+  +  +   ++ A           +RP + ++ +   L      +     L+ +A+ + D+ KG+YEV +G  K++ + V L  +++  +P++V LI+PL  +D + W+ L  AV ++C+I  ++   F R+ ++    L      LK + V I        SD +   R L    + +C+      G      + D+A G+    L+L
Sbjct:  145 ATSMAIAKAAARLKSCPLYKHIASLSHTEVQQKLKIPVTMVTVLCCGKASPGKLNLLKEVMVLPRPGLTASQGLNIISEIQHQIMKHAEVVPKTGYDATNFVPYETMHVVGAVGAPLIGCDKLERPLEIIEEVARSLGLTAGVDFHL-ALNCAAHEVMDYEKGRYEVASGSFKATTDMVELYVQLLGQHPAVVALIDPLCPEDHEQWRRLSSAVGEKCFIFNEN---FCRLAELEN--LEHITGTLKATGVIIKHTNQVTVSDLLQASRYL--QGKGLCVAFGACSGDTPDGSLVDMALGMGASFLIL 444          
BLAST of enolase 4 vs. Ensembl Nematostella
Match: EDO48676 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIB7])

HSP 1 Score: 87.0409 bits (214), Expect = 9.711e-19
Identity = 56/174 (32.18%), Postives = 100/174 (57.47%), Query Frame = 1
Query:  826 IPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPAS--LINDRCELIPAFDRPEQFXXXXXXXXXX--XXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIG 1335
            +P + LLS+GK   GK  MIK+ LI+P    S+ ++ +  L ++Y ++ + +Q K  AS   + D     P  D+PE  L+ + D +      L   + I+L+I+AN  +D  K KYE+++   KS D+ + L  E ++ +P I+G+I+ +R QD + W  L + + ++C++IG
Sbjct:    3 LPVMTLLSSGKLASGKQNMIKEVLILPKPGEST-SKGLQMLTEVYHQMGALLQQKLGASGRCVTDDGSYSPPLDKPETALEYLQDAVSGCGYTLGTDLHIILNIAANDFYDQEKLKYEIMSNAFKSVDDVINLYCEFLEKFPGILGIIDGVRSQDREAWTKLNQRIGEKCFVIG 175          
BLAST of enolase 4 vs. Ensembl Medaka
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:101173085])

HSP 1 Score: 111.694 bits (278), Expect = 2.300e-26
Identity = 118/501 (23.55%), Postives = 227/501 (45.31%), Query Frame = 1
Query:  196 LMSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPA------LLVIPDEPSEMICPELHSHF---SLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLK--KIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQ--FXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENI 1659
             ++ YF+  S PP++S++   E     G   +  ++F + RN E       +    + +   + T D+      H R   + IN  LS  +   +P D  E++++L +  + R ++ +E  +K     ++++           T  K+KKI        ++  P EP E   P LH      S+S+A+    + L++  LY +     S  +     + +  + L+  G+  PGK  ++++ +++P         V   LK  K  +++  T+++    ++  DR     +F+RPEQ   L        +L+L     + L+ +A+ + D +KGKYEV  G LKS DE V L + ++  +P++V LI+P R +D + W+ L  AV ++C ++ +       V  +S+ P   +   LK+    +N    +  SD I        G+  + +   + C    ++DLA GL    + L  L    G+ ++ ++  L+S  E +
Sbjct:   56 FLADYFDKRSAPPRISRLKGREVYNAKGQLCIEAEVFCVVRNTEKSISSAAVSCCLDPERTSSDT-DDEEERTEHVRTAAQCINGPLSNMLKDRNPCDQSEVDKMLSHFFMTRCLEEMEVKKKVHSPRMDEESSPLPPP----TQDKDKKIRDKGKKNNIVETPAEPLE---PVLHGSTAIGSVSLAVAKAGAELQQIPLYHHIAALKSCQDQDRFHIPVSLVTLICCGRTSPGKLNLLEEVILVPKPGQGVKQIVTTTLKLQKEMMRIMMTMKAGAVQAIECDRGAPAVSFERPEQPLDLITEACSNLQLQLGTDAHLALNCAAHKLLDHSKGKYEVAAGVLKSPDELVDLYQTLLHKHPAVVTLIDPFRGEDKEQWQKLSNAVGNKCSLLSE-------VTNVSQLPAGGKRHILKL----VN---ETTISDLIRIASH--PGSVMLGVTESEPCSDASLSDLAVGLGLDYIKLGGLH---GAERMTKYNRLISLEEEL 529          

HSP 2 Score: 27.7202 bits (60), Expect = 2.300e-26
Identity = 8/30 (26.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  111 AINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            A  +++++ +P+ +E +L++LF   P D +
Sbjct:   25 AAEFYRQSGVPQELEAALDELFRRQPRDLH 54          
BLAST of enolase 4 vs. Ensembl Medaka
Match: eno4 (enolase 4 [Source:NCBI gene;Acc:101173085])

HSP 1 Score: 93.5893 bits (231), Expect = 4.291e-21
Identity = 118/537 (21.97%), Postives = 227/537 (42.27%), Query Frame = 1
Query:  196 LMSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPA------LLVIPDEPSEMICPELHSHF---SLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLK--KIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQ--FXXXXXXXXXXXXXXXXXXXVLDISANGIFDF------------------------------------NKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENI 1659
             ++ YF+  S PP++S++   E     G   +  ++F + RN E       +    + +   + T D+      H R   + IN  LS  +   +P D  E++++L +  + R ++ +E  +K     ++++           T  K+KKI        ++  P EP E   P LH      S+S+A+    + L++  LY +     S  +     + +  + L+  G+  PGK  ++++ +++P         V   LK  K  +++  T+++    ++  DR     +F+RPEQ   L        +L+L     + L+ +A+ + D                                     +KGKYEV  G LKS DE V L + ++  +P++V LI+P R +D + W+ L  AV ++C ++ +       V  +S+ P   +   LK+    +N    +  SD I        G+  + +   + C    ++DLA GL    + L  L    G+ ++ ++  L+S  E +
Sbjct:   56 FLADYFDKRSAPPRISRLKGREVYNAKGQLCIEAEVFCVVRNTEKSISSAAVSCCLDPERTSSDT-DDEEERTEHVRTAAQCINGPLSNMLKDRNPCDQSEVDKMLSHFFMTRCLEEMEVKKKVHSPRMDEESSPLPPP----TQDKDKKIRDKGKKNNIVETPAEPLE---PVLHGSTAIGSVSLAVAKAGAELQQIPLYHHIAALKSCQDQDRFHIPVSLVTLICCGRTSPGKLNLLEEVILVPKPGQGVKQIVTTTLKLQKEMMRIMMTMKAGAVQAIECDRGAPAVSFERPEQPLDLITEACSNLQLQLGTDAHLALNCAAHKLLDHVRRGKHSQGYMASAAGCGLTDRMLTEQQKSSRCFSQSKGKYEVAAGVLKSPDELVDLYQTLLHKHPAVVTLIDPFRGEDKEQWQKLSNAVGNKCSLLSE-------VTNVSQLPAGGKRHILKL----VN---ETTISDLIRIASH--PGSVMLGVTESEPCSDASLSDLAVGLGLDYIKLGGLH---GAERMTKYNRLISLEEEL 565          

HSP 2 Score: 28.1054 bits (61), Expect = 4.291e-21
Identity = 8/30 (26.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  111 AINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            A  +++++ +P+ +E +L++LF   P D +
Sbjct:   25 AAEFYRQSGVPQELEAALDELFRRQPRDLH 54          
BLAST of enolase 4 vs. Planmine SMEST
Match: SMESG000008275.1 (SMESG000008275.1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 505/512 (98.63%), Postives = 509/512 (99.41%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 1734
            +SKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFT+YRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLN TRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNKKIPALLVIPDEPSEMIC ELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV ADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSD+FVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWI+GKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI
Sbjct:   44 LSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTIYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNLTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNKKIPALLVIPDEPSEMICSELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVAADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSDDFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIMGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 555          

HSP 2 Score: 78.9518 bits (193), Expect = 4.708e-15
Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 3
Query:   78 MCSERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            M +ERMVLKEKAINYFKKNNIPKTIEKSLNDLFLE+PADAY
Sbjct:    1 MRNERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEVPADAY 41          
BLAST of enolase 4 vs. Planmine SMEST
Match: SMESG000008275.1 (SMESG000008275.1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 505/512 (98.63%), Postives = 509/512 (99.41%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 1734
            +SKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFT+YRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLN TRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNKKIPALLVIPDEPSEMIC ELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV ADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSD+FVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWI+GKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI
Sbjct:   48 LSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTIYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNLTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNKKIPALLVIPDEPSEMICSELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVAADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSDDFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIMGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 559          

HSP 2 Score: 87.0409 bits (214), Expect = 1.368e-17
Identity = 42/45 (93.33%), Postives = 44/45 (97.78%), Query Frame = 3
Query:   66 MNNEMCSERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            MNNEM +ERMVLKEKAINYFKKNNIPKTIEKSLNDLFLE+PADAY
Sbjct:    1 MNNEMRNERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEVPADAY 45          
BLAST of enolase 4 vs. Planmine SMEST
Match: SMESG000008275.1 (SMESG000008275.1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 505/513 (98.44%), Postives = 509/513 (99.22%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKN-KKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 1734
            +SKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFT+YRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLN TRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKN KKIPALLVIPDEPSEMIC ELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV ADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSD+FVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWI+GKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI
Sbjct:   44 LSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTIYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNLTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNSKKIPALLVIPDEPSEMICSELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVAADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSDDFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIMGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 556          

HSP 2 Score: 78.9518 bits (193), Expect = 4.598e-15
Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 3
Query:   78 MCSERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            M +ERMVLKEKAINYFKKNNIPKTIEKSLNDLFLE+PADAY
Sbjct:    1 MRNERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEVPADAY 41          
BLAST of enolase 4 vs. Planmine SMEST
Match: SMESG000008275.1 (SMESG000008275.1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 505/513 (98.44%), Postives = 509/513 (99.22%), Query Frame = 1
Query:  199 MSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVXXXXXXXXXXXXXXXXXXXXXXXXXTSGKN-KKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVVADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFXXXXXXXXXXXXXXXXXXXVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 1734
            +SKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFT+YRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLN TRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKN KKIPALLVIPDEPSEMIC ELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEV ADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSD+FVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWI+GKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI
Sbjct:   48 LSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTIYRNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNLTRNCIEIINQTLSKKIIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVKSKVTSGKNSKKIPALLVIPDEPSEMICSELHSHFSLSIALGIMSSLLEKQNLYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGLYSSPNEVAADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDIINDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSDDFVTLLKEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIMGKSPQVFPRVQKISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWLEDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFGLHFPVLHQESVTEIEELTSNLEI 560          

HSP 2 Score: 87.0409 bits (214), Expect = 1.313e-17
Identity = 42/45 (93.33%), Postives = 44/45 (97.78%), Query Frame = 3
Query:   66 MNNEMCSERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEIPADAY 200
            MNNEM +ERMVLKEKAINYFKKNNIPKTIEKSLNDLFLE+PADAY
Sbjct:    1 MNNEMRNERMVLKEKAINYFKKNNIPKTIEKSLNDLFLEVPADAY 45          
The following BLAST results are available for this feature:
BLAST of enolase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENO41.589e-1427.27enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670][more]
ENO42.018e-1425.94enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670][more]
ENO42.629e-1428.11enolase 4 [Source:HGNC Symbol;Acc:HGNC:31670][more]
back to top
BLAST of enolase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of enolase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of enolase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eno45.143e-2523.78enolase 4 [Source:NCBI gene;Acc:558487][more]
back to top
BLAST of enolase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gpx31.025e-2027.36glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GE... [more]
gpx31.329e-2027.36glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GE... [more]
gpx33.004e-1140.63glutathione peroxidase 3 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of enolase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Eno45.997e-2326.56enolase 4 [Source:MGI Symbol;Acc:MGI:2441717][more]
Eno46.896e-2326.38enolase 4 [Source:MGI Symbol;Acc:MGI:2441717][more]
Eno41.594e-1426.39enolase 4 [Source:MGI Symbol;Acc:MGI:2441717][more]
Eno43.238e-840.74enolase 4 [Source:MGI Symbol;Acc:MGI:2441717][more]
back to top
BLAST of enolase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08BC6|ENO4_DANRE8.552e-2524.02Enolase 4 OS=Danio rerio OX=7955 GN=eno4 PE=2 SV=1[more]
sp|Q8C042|ENO4_MOUSE3.638e-2226.56Enolase 4 OS=Mus musculus OX=10090 GN=Eno4 PE=1 SV... [more]
sp|B0BM20|ENO4_XENTR5.430e-2027.36Enolase 4 OS=Xenopus tropicalis OX=8364 GN=eno4 PE... [more]
sp|A9UMP7|ENO4_XENLA2.436e-1826.37Enolase 4 OS=Xenopus laevis OX=8355 GN=eno4 PE=2 S... [more]
sp|A6NNW6|ENO4_HUMAN1.263e-1328.11Enolase 4 OS=Homo sapiens OX=9606 GN=ENO4 PE=2 SV=... [more]
back to top
BLAST of enolase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4XB855.623e-3627.87Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A5C2IF661.067e-3125.87Enolase-1 protein OS=Anadara broughtonii OX=148819... [more]
A0A3P9A2L02.349e-3127.21Enolase 4 OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A1S3KE195.031e-3127.13enolase 4 OS=Lingula unguis OX=7574 GN=LOC10618100... [more]
A0A3P9A2M56.273e-3026.73Enolase 4 OS=Esox lucius OX=8010 PE=4 SV=1[more]
back to top
BLAST of enolase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eno43.279e-1326.92enolase 4 [Source:NCBI gene;Acc:558487][more]
eno43.839e-1326.92enolase 4 [Source:NCBI gene;Acc:558487][more]
back to top
BLAST of enolase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eno42.313e-1523.63enolase 4 [Source:NCBI gene;Acc:558487][more]
eno41.929e-1421.75enolase 4 [Source:NCBI gene;Acc:558487][more]
back to top
BLAST of enolase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of enolase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO486769.711e-1932.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of enolase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eno42.300e-2623.55enolase 4 [Source:NCBI gene;Acc:101173085][more]
eno44.291e-2121.97enolase 4 [Source:NCBI gene;Acc:101173085][more]
back to top
BLAST of enolase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000008275.14.708e-1598.63SMESG000008275.1[more]
SMESG000008275.11.368e-1798.63SMESG000008275.1[more]
SMESG000008275.14.598e-1598.44SMESG000008275.1[more]
SMESG000008275.11.313e-1798.44SMESG000008275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011473 ID=SMED30011473|Name=enolase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2002bp
GATCTATTTATATCACAATTTTTGTTGCTAGGAACAAATTCAAAAAATTA
AAAGATTTATTCAAAATGAATAACGAAATGTGCAGTGAACGTATGGTTTT
GAAAGAAAAGGCCATAAACTATTTCAAAAAAAATAATATCCCAAAAACAA
TCGAAAAATCTCTAAATGATCTCTTTCTCGAGATTCCAGCTGATGCTTAT
GAGTAAATATTTTGAAAATCTCAGCAAACCTCCGAAGCTATCAAAAATTA
TGGCTTATGAATCAACTGGTGATCTAGGAACCAGTACATTGTCTATTAAA
CTGTTTACTATGTATCGCAACGAAGAAATTGAATTCCTTCAAGTTACAAT
GCCAAATGATTTCAATTTAAAATCTGGAGAAGCCTTAACATTTGACAATG
CAATGATAAATTTAAATCACACCAGAAACTGTATTGAAATTATAAATCAA
ACCCTTTCAAAGAAGATCATTGGAATTGATCCAAGAGACTATGAAGAGAT
TGAACGTATTCTTAGAAATGACGCAGTAGAGCGTCAAATGAAATACGTAG
AAGAAATTGAAAAAGAAGATGAAAGTGAAATTAATAAAGACGAAGTGAAG
AAGGAAGACGTAAAATCTAAAGTGACATCAGGAAAAAATAAAAAGATTCC
AGCATTACTAGTTATACCAGATGAACCTTCGGAAATGATTTGCCCTGAAC
TGCATTCCCATTTTTCTCTTTCCATCGCGTTGGGAATCATGTCCAGTTTA
CTGGAAAAACAAAATTTGTATAAATATACATTAAACCAGTTATCATTACC
GGAAAATAAAGCAGAAAGGGTAACTATACCTGCAATACCTTTGTTGAGTA
ATGGTAAAGGCCTCCCTGGAAAATGTCAGATGATTAAAAAGTGCCTTATT
ATACCTAATGGCCTTTATAGTTCACCTAATGAGGTCGTGGCAGATTTAAA
GAAGATATATATAAAAGTTTGGTCCACTGTTCAATCTAAATTTCCTGCCT
CCTTAATTAATGACCGATGTGAGTTAATCCCAGCATTTGATAGACCTGAA
CAATTCTTGGATATTATTAACGACATTCTAAAAGAATTAGAGTTAGAGGA
GAAAATGAAGATCGTCCTTGATATCAGTGCAAATGGAATTTTCGATTTTA
ATAAAGGAAAATATGAAGTTATTACTGGCCAGTTGAAAAGCTCTGATGAA
TTTGTGACGCTATTGAAAGAAATGGTTGATCATTACCCTTCAATCGTGGG
CCTTATCAATCCGCTAAGAAAGCAAGACATTGATGGGTGGAAAAATCTTG
TCAAAGCTGTAAGTGATCGTTGTTGGATAATAGGGAAAAGTCCTCAAGTA
TTTCCCAGGGTTCAAAAAATCTCAGAAACACCTCTGTATATGCAGAACTT
TGCGCTGAAAGTGTCAATGGTTGGTATTAACATTGATGGATACAGCATTT
ACAGTGATTACATAAATTGTATGAGACAATTAATCGATGGTAATCAAAAG
GTTTGTATATGGCTAGAAGACTTATGTGGACAGAACTGGGTGACTGATCT
GGCCTGTGGGTTAAATCCATATTTATTAGTATTACCGAGCTTACGATGTT
CAAGTGGATCAGGGAAATTAGATCGGTGGGCTGAATTAATGTCTCCTTCT
GAAAATATATTCGGACTACATTTCCCAGTGTTACACCAGGAGTCCGTTAC
AGAGATTGAAGAACTGACAAGCAATTTAGAAATTTAAACTAATTTAATAC
AGATTGTGTATTGCCTATACATTCGACTGATTTTTCATTAGTCAAACTAA
TTCCATCAATAATCTTTTTCATGCATGCTTCAACTAGATTAAGTTTAATG
TCAAATTAATAATAGAGATTTAATTATTACTCCAACAATACCAATGACTA
AACTTTATAAATTAGCAATACTTTTTATCGTTCTATAATGGCAACATTAA
TATTATGTAATAAAACTAAGATTACGTCATGTGTATATTTGTTGTAGAAT
AA
back to top

protein sequence of SMED30011473-orf-1

>SMED30011473-orf-1 ID=SMED30011473-orf-1|Name=SMED30011473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=524bp
MISFSRFQLMLMSKYFENLSKPPKLSKIMAYESTGDLGTSTLSIKLFTMY
RNEEIEFLQVTMPNDFNLKSGEALTFDNAMINLNHTRNCIEIINQTLSKK
IIGIDPRDYEEIERILRNDAVERQMKYVEEIEKEDESEINKDEVKKEDVK
SKVTSGKNKKIPALLVIPDEPSEMICPELHSHFSLSIALGIMSSLLEKQN
LYKYTLNQLSLPENKAERVTIPAIPLLSNGKGLPGKCQMIKKCLIIPNGL
YSSPNEVVADLKKIYIKVWSTVQSKFPASLINDRCELIPAFDRPEQFLDI
INDILKELELEEKMKIVLDISANGIFDFNKGKYEVITGQLKSSDEFVTLL
KEMVDHYPSIVGLINPLRKQDIDGWKNLVKAVSDRCWIIGKSPQVFPRVQ
KISETPLYMQNFALKVSMVGINIDGYSIYSDYINCMRQLIDGNQKVCIWL
EDLCGQNWVTDLACGLNPYLLVLPSLRCSSGSGKLDRWAELMSPSENIFG
LHFPVLHQESVTEIEELTSNLEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036849Enolase-like_C_sf
IPR000941Enolase
IPR020810Enolase_C
IPR029065Enolase_C-like
Vocabulary: cellular component
TermDefinition
GO:0000015phosphopyruvate hydratase complex
Vocabulary: molecular function
TermDefinition
GO:0000287magnesium ion binding
GO:0004634phosphopyruvate hydratase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020810Enolase, C-terminal TIM barrel domainSMARTSM01192Enolase_C_3coord: 216..430
e-value: 5.5E-5
score: -136.1
IPR020810Enolase, C-terminal TIM barrel domainPFAMPF00113Enolase_Ccoord: 221..392
e-value: 1.0E-11
score: 44.6
IPR036849Enolase-like, C-terminal domain superfamilyGENE3DG3DSA:3.20.20.120coord: 200..467
e-value: 9.1E-32
score: 112.2
IPR036849Enolase-like, C-terminal domain superfamilySUPERFAMILYSSF51604Enolase C-terminal domain-likecoord: 221..396
IPR000941EnolasePANTHERPTHR11902ENOLASEcoord: 12..467
NoneNo IPR availablePANTHERPTHR11902:SF30ENOLASE 4coord: 12..467